3I4MK

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4mK00
2VUMK 3GTOC 4A3DC 1I3QC 2R93K 5C4XK 4Y7NK 4OIQA 4QJVB 3S17C 4Q5SA 2B63C 4X6AC 3DXJA 1WCMK 3M4OC 2R7ZK 4KN7A 4XLNA 4A3LC 3HOVK 4A3JK 4C3IK 3FKIK 3I4MC 3HOZC 3GTJK 1ZYRA 4A3MC 5TMFA 4G7HA 1Y1WK 5IYCC 4A3CK 3S1NC 4JK1A 5M5WK 2JA6C 3M3YC 5C44K 4Q4ZA 4A3IK 3S1RC 3RZOK 1SMYA 3HOWC 4BXXC 3PO2K 3GTPK 3GTLC 2PA8L 3GTQC 4BY7C 3CQZC 4XLPA 2E2JK 2JA5K 2JA7C 3S1QK 2PPBA 3RZDK 3S14C 4YFXA 4A3KC 1SFOK 4A3BK 1TWFK 4G7OA 3S2DC 2E2HC 2PA8D 1I50K 3H3VD 3GTKC 1TWGC 4Y52K 4XSZA 4A3EK 4GZYA 2E2IK 4A3FC 3PO3C 2JA8K 3HOUK 2NVXK 5IP9C 3GTGC 3S2HK 1Y1VK 5FLMC 4G7ZA 1I6HC 4LJZA 4C3HK 5IP7C 2YU9K 3GTMC 1YNNA 1TWHC 1TWAC 2R92K 2NVTC 4AYBL 5C3EK 3S15K 2O5JA 3S1MK 2NVYK 1TWCK 3I4NC 2A6EA 5IYDK 4A3LK 5IYBK 5FJ8K 5D4DA 2A69A 3K7AK 3EQLA 4ZH4A 4BBRK 2A6HA 2VUMC 3I4MK 2R93C 1K83K 2WB1L 5C4XC 4LK0A 4Y7NC 4YFKA 4OINA 3H0GK 4A3GK 3S16K 1XPPA 1WCMC 2WB1D 2R7ZC 2PMZL 4BY1K 3HOVC 4A3JC 3FKIC 2WAQL 4NOIA 2CW0A 4BBSK 3GTJC 1Y1WC 4A3CC 4A93K 4KMUA 4QIWL 3HOYK 3HOXC 5C44C 4A3IC 4QJVA 3RZOC 5C4JK 1YNJA 3GTOK 3PO2C 2Y0SL 1I3QK 3GTPC 4A3DK 4KN4A 2NVQC 2E2JC 3S1QC 2JA5C 4MEXA 3S17K 2B63K 4OIPA 5FLMK 4X6AK 3M4OK 1BDFA 4MQ9A 1SFOC 1TWFC 2BE5A 4A3BC 1I50C 4YFNA 1R9TC 4Y52C 3HOZK 4AYBD 4A3MK 4OIOA 2JA8C 4MEYA 5IYCK 4XSXA 5M5YK 2NVXC 3HOUC 3I4NK 2JA6K 3M3YK 3HKZL 1HQMA 1Y1VC 3S1RK 4OIRA 3S2HC 3HOWK 4BXXK 2YU9C 5TMCA 3GTLK 4BY7K 3GTQK 5M5XK 3HKZD 3CQZK 2R92C 4C3JK 5C3EC 2JA7K 3S15C 3S1MC 2NVYC 1TWCC 5IYDC 2O5IA 2PMZD 4A3KK 5IYBC 5M3FK 3S14K 3S1NK 3S2DK 2E2HK 2WAQD 3K7AC 4BBRC 3GTKK 1TWGK 1K83C 4YG2A 4QIWD 4A3FK 1I6VA 3H0GC 3WODA 3HOXK 3PO3K 4A3GC 3S16C 5IP9K 4LLGA 3GTGK 4C2MK 1IW7A 3RZDC 4BY1C 1I6HK 2Y0SD 4LK1A 5IP7K 2NVQK 3GTMK 3H3VL 4BBSC 1TWHK 1TWAK 5M3MK 2A68A 4A3EC 2NVTK 4A93C 2E2IC 3HOYC 1R9TK 5C4JC
chains in the Genus database with same CATH superfamily
2VUMK 3GTOC 3TFHA 1I3QC 4A3DC 4WJ4A 5C4XK 5JVOA 1BS2A 3DXJA 1WCMK 3CAGA 2R7ZK 4C3IK 3I4MC 4BLBA 2JA6A 1VRQC 2JA6C 1USOA 1X31C 4Q4ZA 4A3IK 3S1RC 1J6WA 3GTQA 3BUEA 3NUHA 3PO2K 2GSNA 3GTQC 1ZVUA 4XLPA 2PPBA 2E2HA 1O2AA 4A3KC 1SFOK 1TWGA 2E2HC 1KQ4A 3A8JA 1B4AA 1TWGC 3N0BA 4XSZA 5IP9C 5FLMC 1O25A 4G0UA 3G4CA 1TWHA 4C3HK 1TWHC 1JVIA 1J98A 3S15K 2NVYK 1TWCK 3I4NC 3S0XA 4BBRK 3EQLA 3I4MK 4LK0A 3S16K 1XPPA 1EH1A 4ILDA 4LQYA 2CW0A 4BBSK 2FQOA 3SZZA 1YNJA 2Y0SL 3BP3A 4KN4A 3HXAA 2E2JC 4X6AK 5FLMK 3M4OK 4A3BC 1IL2A 1O27A 4Y52C 4KC6A 1XXCA 3AQOA 2PHCB 1Y1VA 5IYCK 3I4NK 1IS1A 4XSXA 4GTDA 5M5YK 1WOPA 3S1NK 3HKZL 1Y1VC 4OIRA 4AH6A 4BXXK 1EFWA 4BY7K 3CQZK 4GT9A 3S1MC 2O5IA 3S14K 5IYBC 1K83A 4XCHA 3S2DK 2WAQD 5L46A 1K83C 3H0GA 3GEIA 1VLOA 4YG2A 4M1XA 1I6VA 3H0GC 5IOQA 2ZUFA 3T00A 3L4KA 3H3VL 5M3MK 2A68A 4A3EC 4KMAA 2EBBA 5C4JC 4Y7NK 4OIQA 4QJVB 4P9SA 4KN7A 4XLNA 4A3LC 4C45A 1EQRA 3FKIK 4GTAA 3HOZC 3GTJK 1DCHA 5TMFA 1ZBSA 1Y1WK 4A3CK 4JK1A 5M5WK 3HOWC 3GTLA 1GE9A 3GTPK 3GTLC 2PA8L 2JA5K 5IORA 3GTKA 1ZQ1C 1I50K 3GTKC 5IOSA 4A3EK 4GZYA 2GSUA 5EGHA 4A3FC 1O29A 2JA8K 3PO3C 1J6VA 3HOUK 2CFAA 4G7ZA 1I6HC 3ADAC 4LJZA 4BKWA 1WSVA 2NVTC 5C3EK 1RU0A 5IYDK 3SZYA 4A3LK 1INNA 2R93A 4GFQA 2A69A 3K7AK 5JFEA 1XZPA 2A6HA 2R93C 3VA7A 3GIRA 1XZQA 3T02A 4BY1K 2XCRB 4KASA 3HOVC 4A3JC 1IQ0A 4NOIA 4KMDA 2RH6A 5HL8A 1USMA 4A93K 4KMUA 4QIWL 3HOYK 5C44C 3RZOC 1PJ7A 3GTOK 4A3DK 1I3QK 5CJ9A 2NVQC 3S1QC 1TWFA 4MEXA 3TFIA 4KB4A 1BDFA 1TWFC 3GEEA 2NVXA 4AYBD 4KB2A 4MEYA 2NVXC 3S2HC 2JA6K 2YU9A 3S1RK 2FQTA 2RGRA 2YU9C 1O2BA 2R92A 3GTQK 5M5XK 3HKZD 2R92C 2O5JA 2PMZD 4A3KK 2D6FC 2E2HK 1F93A 1TWGK 1WIHA 1UV7A 3WODA 4A3GC 5IP9K 1IW7A 4G0WA 1L0WA 2V6TA 2NVQK 1TWHK 3LAPA 4WJ3M 2B63A 1DCOA 3GSIA 2P5MA 3S17C 4Q5SA 1VGXA 2B63C 2P8TA 1VJEA 4A3MC 1ZYRA 4G7HA 4P5BA 3M3YC 4KDDA 3FHZA 4O2DA 1JQWA 2JA7A 1WOSA 2E2JK 4C3JC 2JA7C 4YFXA 4A3BK 2GAHC 2PA8D 1IE0A 5E68A 4Y52K 3GTGA 2W7VA 3AD7C 1F7VA 3GTGC 4C2MC 3QX3A 1Y1VK 3GTMA 3V4GA 5IP7C 1TWAA 1VH2A 3GTMC 1TWAC 1JOEA 3S1MK 3TTGA 3N0CA 2VUMA 5IYBK 5FJ8K 4KMHA 5D4DA 3GDZA 2VUMC 1K83K 2JH3A 2WB1L 5C4XC 2Y3PA 1WCMA 4OINA 3Q3QA 3H0GK 3AD8C 1WCMC 3IPJA 2R7ZC 4C3IC 2WAQL 4BLAA 1AB4A 1HI9A 1EI6A 1F9NA 4A3IC 5C4JK 3PO2C 3AD9C 1SFOA 4OIPA 1BJTA 1SFOC 2BE5A 3AH5A 4KARA 3HOZK 4WILA 4FZBA 1BGWA 4OIOA 1DCPA 1XXAA 5IOTA 3HOWK 4C3HC 3OPFA 3GTLK 2NVYA 1TWCA 1ISEA 2CFAB 3A8KA 4PAAA 3S15C 2NVYC 1TWCC 4BBRC 3GTKK 2GAGC 3ERED 4A3FK 3PO3K 3GEHA 3S16C 4LLGA 1XZPB 3RZDC 1O2FB 1I6HK 2Y0SD 1XZQB 2E2IA 4BBSC 3A8IA 2NVTK 1IBAA 3FOFA 2E2IC 4GTLA 3N3YA 2R93K 2XCQA 4KATA 1G51A 4X6AC 3M4OC 3HOVK 4A3JK 4GTBA 3BP8C 5IYCC 2V6UA 3T01A 3S1NC 5C44K 3RZOK 1SMYA 4BXXC 1B4BA 3CQZA 4KAWX 4BY7C 4GTCA 3CQZC 3S1QK 5EGEA 3RZDK 3S14C 1TWFK 4G7OA 3S2DC 3G4AA 3H3VD 1YCLA 1WORA 2E2IK 1YX2A 2NVXK 3S2HK 4G0VA 3LPXA 2YU9K 4J3NA 1YNNA 4LR2A 2R92K 4DDQA 4AYBL 5TJ3A 1J6XA 2A6EA 4ZH4A 2GSOA 2V6SA 3AQPA 2KWAA 4Y7NC 4YFKA 1O24A 4A3GK 1PJ5A 3FKIA 2WB1D 4P5AA 2PMZL 3GTJA 3FKIC 4GTFA 5CHPA 1Y1WA 3OEPA 3GTJC 1Y1WC 4A3CC 3HOXC 3GTPA 4QJVA 1C0AA 3L4JA 1WQGA 1WSRA 3GTPC 2JA5A 4KM9A 2JA5C 3S17K 4GTEA 2B63K 1I50A 3FOEA 4MQ9A 1R9TA 1WOOA 1I50C 4YFNA 1R9TC 2ZFZA 3JSTA 4A3MK 1XXBA 2JA8C 3HOUC 3M3YK 2R7ZA 1HQMA 3LAJA 1WQHA 5TMCA 3MMLB 3TFJA 4FM9A 1ZXOA 4C3JK 5C3EC 2JA7K 5IYDC 1V5VA 1WQFA 2ZUEA 5M3FK 1F7UA 3K7AC 4RMFA 4PABA 2XCOA 3OREA 1DD5A 4QIWD 3HOXK 1EK8A 3GTGK 4C2MK 4BY1C 1PJ6A 4LK1A 5IP7K 3GTMK 1TWAK 4A93C 4KM8A 1O26A 4LOWA 3HOYC 3GTOA 1I3QA 1O28A 1R9TK
chains in the Genus database with same CATH topology
2VUMK 3GTOC 4A3DC 1I3QC 2R93K 5C4XK 4Y7NK 4OIQA 4QJVB 3S17C 4Q5SA 2B63C 4X6AC 3DXJA 1WCMK 3M4OC 2R7ZK 4KN7A 4XLNA 4A3LC 3HOVK 4A3JK 4C3IK 3FKIK 3I4MC 3HOZC 3GTJK 1ZYRA 4A3MC 5TMFA 4G7HA 1Y1WK 5IYCC 4A3CK 3S1NC 4JK1A 5M5WK 2JA6C 3M3YC 5C44K 4Q4ZA 4A3IK 3S1RC 3RZOK 1SMYA 3HOWC 4BXXC 3PO2K 3GTPK 3GTLC 2PA8L 3GTQC 4BY7C 3CQZC 4XLPA 2E2JK 2JA5K 2JA7C 3S1QK 2PPBA 3RZDK 3S14C 4YFXA 4A3KC 1SFOK 4A3BK 1TWFK 4G7OA 3S2DC 2E2HC 2PA8D 1I50K 3H3VD 3GTKC 1TWGC 4Y52K 4XSZA 4A3EK 4GZYA 2E2IK 4A3FC 3PO3C 2JA8K 3HOUK 2NVXK 5IP9C 3GTGC 3S2HK 1Y1VK 5FLMC 4G7ZA 1I6HC 4LJZA 4C3HK 5IP7C 2YU9K 3GTMC 1YNNA 1TWHC 1TWAC 2R92K 2NVTC 4AYBL 5C3EK 3S15K 2O5JA 3S1MK 2NVYK 1TWCK 3I4NC 2A6EA 5IYDK 4A3LK 5IYBK 5FJ8K 5D4DA 2A69A 3K7AK 3EQLA 4ZH4A 4BBRK 2A6HA 2VUMC 3I4MK 2R93C 1K83K 2WB1L 5C4XC 4LK0A 4Y7NC 4YFKA 4OINA 3H0GK 4A3GK 3S16K 1XPPA 1WCMC 2WB1D 2R7ZC 2PMZL 4BY1K 3HOVC 4A3JC 3FKIC 2WAQL 4NOIA 2CW0A 4BBSK 3GTJC 1Y1WC 4A3CC 4A93K 4KMUA 4QIWL 3HOYK 3HOXC 5C44C 4A3IC 4QJVA 3RZOC 5C4JK 1YNJA 3GTOK 3PO2C 2Y0SL 1I3QK 3GTPC 4A3DK 4KN4A 2NVQC 2E2JC 3S1QC 2JA5C 4MEXA 3S17K 2B63K 4OIPA 5FLMK 4X6AK 3M4OK 1BDFA 4MQ9A 1SFOC 1TWFC 2BE5A 4A3BC 1I50C 4YFNA 1R9TC 4Y52C 3HOZK 4AYBD 4A3MK 4OIOA 2JA8C 4MEYA 5IYCK 4XSXA 5M5YK 2NVXC 3HOUC 3I4NK 2JA6K 3M3YK 3HKZL 1HQMA 1Y1VC 3S1RK 4OIRA 3S2HC 3HOWK 4BXXK 2YU9C 5TMCA 3GTLK 4BY7K 3GTQK 5M5XK 3HKZD 3CQZK 2R92C 4C3JK 5C3EC 2JA7K 3S15C 3S1MC 2NVYC 1TWCC 5IYDC 2O5IA 2PMZD 4A3KK 5IYBC 5M3FK 3S14K 3S1NK 3S2DK 2E2HK 2WAQD 3K7AC 4BBRC 3GTKK 1TWGK 1K83C 4YG2A 4QIWD 4A3FK 1I6VA 3H0GC 3WODA 3HOXK 3PO3K 4A3GC 3S16C 5IP9K 4LLGA 3GTGK 4C2MK 1IW7A 3RZDC 4BY1C 1I6HK 2Y0SD 4LK1A 5IP7K 2NVQK 3GTMK 3H3VL 4BBSC 1TWHK 1TWAK 5M3MK 2A68A 4A3EC 2NVTK 4A93C 2E2IC 3HOYC 1R9TK 5C4JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM K;  3GTO C;  4A3D C;  1I3Q C;  2R93 K;  5C4X K;  4Y7N K;  4OIQ A;  4QJV B;  3S17 C;  4Q5S A;  2B63 C;  4X6A C;  3DXJ A;  1WCM K;  3M4O C;  2R7Z K;  4KN7 A;  4XLN A;  4A3L C;  3HOV K;  4A3J K;  4C3I K;  3FKI K;  3I4M C;  3HOZ C;  3GTJ K;  1ZYR A;  4A3M C;  5TMF A;  4G7H A;  1Y1W K;  5IYC C;  4A3C K;  3S1N C;  4JK1 A;  5M5W K;  2JA6 C;  3M3Y C;  5C44 K;  4Q4Z A;  4A3I K;  3S1R C;  3RZO K;  1SMY A;  3HOW C;  4BXX C;  3PO2 K;  3GTP K;  3GTL C;  2PA8 L;  3GTQ C;  4BY7 C;  3CQZ C;  4XLP A;  2E2J K;  2JA5 K;  2JA7 C;  3S1Q K;  2PPB A;  3RZD K;  3S14 C;  4YFX A;  4A3K C;  1SFO K;  4A3B K;  1TWF K;  4G7O A;  3S2D C;  2E2H C;  2PA8 D;  1I50 K;  3H3V D;  3GTK C;  1TWG C;  4Y52 K;  4XSZ A;  4A3E K;  4GZY A;  2E2I K;  4A3F C;  3PO3 C;  2JA8 K;  3HOU K;  2NVX K;  5IP9 C;  3GTG C;  3S2H K;  1Y1V K;  5FLM C;  4G7Z A;  1I6H C;  4LJZ A;  4C3H K;  5IP7 C;  2YU9 K;  3GTM C;  1YNN A;  1TWH C;  1TWA C;  2R92 K;  2NVT C;  4AYB L;  5C3E K;  3S15 K;  2O5J A;  3S1M K;  2NVY K;  1TWC K;  3I4N C;  2A6E A;  5IYD K;  4A3L K;  5IYB K;  5FJ8 K;  5D4D A;  2A69 A;  3K7A K;  3EQL A;  4ZH4 A;  4BBR K;  2A6H A;  2VUM C;  3I4M K;  2R93 C;  1K83 K;  2WB1 L;  5C4X C;  4LK0 A;  4Y7N C;  4YFK A;  4OIN A;  3H0G K;  4A3G K;  3S16 K;  1XPP A;  1WCM C;  2WB1 D;  2R7Z C;  2PMZ L;  4BY1 K;  3HOV C;  4A3J C;  3FKI C;  2WAQ L;  4NOI A;  2CW0 A;  4BBS K;  3GTJ C;  1Y1W C;  4A3C C;  4A93 K;  4KMU A;  4QIW L;  3HOY K;  3HOX C;  5C44 C;  4A3I C;  4QJV A;  3RZO C;  5C4J K;  1YNJ A;  3GTO K;  3PO2 C;  2Y0S L;  1I3Q K;  3GTP C;  4A3D K;  4KN4 A;  2NVQ C;  2E2J C;  3S1Q C;  2JA5 C;  4MEX A;  3S17 K;  2B63 K;  4OIP A;  5FLM K;  4X6A K;  3M4O K;  1BDF A;  4MQ9 A;  1SFO C;  1TWF C;  2BE5 A;  4A3B C;  1I50 C;  4YFN A;  1R9T C;  4Y52 C;  3HOZ K;  4AYB D;  4A3M K;  4OIO A;  2JA8 C;  4MEY A;  5IYC K;  4XSX A;  5M5Y K;  2NVX C;  3HOU C;  3I4N K;  2JA6 K;  3M3Y K;  3HKZ L;  1HQM A;  1Y1V C;  3S1R K;  4OIR A;  3S2H C;  3HOW K;  4BXX K;  2YU9 C;  5TMC A;  3GTL K;  4BY7 K;  3GTQ K;  5M5X K;  3HKZ D;  3CQZ K;  2R92 C;  4C3J K;  5C3E C;  2JA7 K;  3S15 C;  3S1M C;  2NVY C;  1TWC C;  5IYD C;  2O5I A;  2PMZ D;  4A3K K;  5IYB C;  5M3F K;  3S14 K;  3S1N K;  3S2D K;  2E2H K;  2WAQ D;  3K7A C;  4BBR C;  3GTK K;  1TWG K;  1K83 C;  4YG2 A;  4QIW D;  4A3F K;  1I6V A;  3H0G C;  3WOD A;  3HOX K;  3PO3 K;  4A3G C;  3S16 C;  5IP9 K;  4LLG A;  3GTG K;  4C2M K;  1IW7 A;  3RZD C;  4BY1 C;  1I6H K;  2Y0S D;  4LK1 A;  5IP7 K;  2NVQ K;  3GTM K;  3H3V L;  4BBS C;  1TWH K;  1TWA K;  5M3M K;  2A68 A;  4A3E C;  2NVT K;  4A93 C;  2E2I C;  3HOY C;  1R9T K;  5C4J C; 
#chains in the Genus database with same CATH topology
 2VUM K;  3GTO C;  3TFH A;  1I3Q C;  4A3D C;  4WJ4 A;  5C4X K;  5JVO A;  1BS2 A;  3DXJ A;  1WCM K;  3CAG A;  2R7Z K;  4C3I K;  3I4M C;  4BLB A;  2JA6 A;  1VRQ C;  2JA6 C;  1USO A;  1X31 C;  4Q4Z A;  4A3I K;  3S1R C;  1J6W A;  3GTQ A;  3BUE A;  3NUH A;  3PO2 K;  2GSN A;  3GTQ C;  1ZVU A;  4XLP A;  2PPB A;  2E2H A;  1O2A A;  4A3K C;  1SFO K;  1TWG A;  2E2H C;  1KQ4 A;  3A8J A;  1B4A A;  1TWG C;  3N0B A;  4XSZ A;  5IP9 C;  5FLM C;  1O25 A;  4G0U A;  3G4C A;  1TWH A;  4C3H K;  1TWH C;  1JVI A;  1J98 A;  3S15 K;  2NVY K;  1TWC K;  3I4N C;  3S0X A;  4BBR K;  3EQL A;  3I4M K;  4LK0 A;  3S16 K;  1XPP A;  1EH1 A;  4ILD A;  4LQY A;  2CW0 A;  4BBS K;  2FQO A;  3SZZ A;  1YNJ A;  2Y0S L;  3BP3 A;  4KN4 A;  3HXA A;  2E2J C;  4X6A K;  5FLM K;  3M4O K;  4A3B C;  1IL2 A;  1O27 A;  4Y52 C;  4KC6 A;  1XXC A;  3AQO A;  2PHC B;  1Y1V A;  5IYC K;  3I4N K;  1IS1 A;  4XSX A;  4GTD A;  5M5Y K;  1WOP A;  3S1N K;  3HKZ L;  1Y1V C;  4OIR A;  4AH6 A;  4BXX K;  1EFW A;  4BY7 K;  3CQZ K;  4GT9 A;  3S1M C;  2O5I A;  3S14 K;  5IYB C;  1K83 A;  4XCH A;  3S2D K;  2WAQ D;  5L46 A;  1K83 C;  3H0G A;  3GEI A;  1VLO A;  4YG2 A;  4M1X A;  1I6V A;  3H0G C;  5IOQ A;  2ZUF A;  3T00 A;  3L4K A;  3H3V L;  5M3M K;  2A68 A;  4A3E C;  4KMA A;  2EBB A;  5C4J C;  4Y7N K;  4OIQ A;  4QJV B;  4P9S A;  4KN7 A;  4XLN A;  4A3L C;  4C45 A;  1EQR A;  3FKI K;  4GTA A;  3HOZ C;  3GTJ K;  1DCH A;  5TMF A;  1ZBS A;  1Y1W K;  4A3C K;  4JK1 A;  5M5W K;  3HOW C;  3GTL A;  1GE9 A;  3GTP K;  3GTL C;  2PA8 L;  2JA5 K;  5IOR A;  3GTK A;  1ZQ1 C;  1I50 K;  3GTK C;  5IOS A;  4A3E K;  4GZY A;  2GSU A;  5EGH A;  4A3F C;  1O29 A;  2JA8 K;  3PO3 C;  1J6V A;  3HOU K;  2CFA A;  4G7Z A;  1I6H C;  3ADA C;  4LJZ A;  4BKW A;  1WSV A;  2NVT C;  5C3E K;  1RU0 A;  5IYD K;  3SZY A;  4A3L K;  1INN A;  2R93 A;  4GFQ A;  2A69 A;  3K7A K;  5JFE A;  1XZP A;  2A6H A;  2R93 C;  3VA7 A;  3GIR A;  1XZQ A;  3T02 A;  4BY1 K;  2XCR B;  4KAS A;  3HOV C;  4A3J C;  1IQ0 A;  4NOI A;  4KMD A;  2RH6 A;  5HL8 A;  1USM A;  4A93 K;  4KMU A;  4QIW L;  3HOY K;  5C44 C;  3RZO C;  1PJ7 A;  3GTO K;  4A3D K;  1I3Q K;  5CJ9 A;  2NVQ C;  3S1Q C;  1TWF A;  4MEX A;  3TFI A;  4KB4 A;  1BDF A;  1TWF C;  3GEE A;  2NVX A;  4AYB D;  4KB2 A;  4MEY A;  2NVX C;  3S2H C;  2JA6 K;  2YU9 A;  3S1R K;  2FQT A;  2RGR A;  2YU9 C;  1O2B A;  2R92 A;  3GTQ K;  5M5X K;  3HKZ D;  2R92 C;  2O5J A;  2PMZ D;  4A3K K;  2D6F C;  2E2H K;  1F93 A;  1TWG K;  1WIH A;  1UV7 A;  3WOD A;  4A3G C;  5IP9 K;  1IW7 A;  4G0W A;  1L0W A;  2V6T A;  2NVQ K;  1TWH K;  3LAP A;  4WJ3 M;  2B63 A;  1DCO A;  3GSI A;  2P5M A;  3S17 C;  4Q5S A;  1VGX A;  2B63 C;  2P8T A;  1VJE A;  4A3M C;  1ZYR A;  4G7H A;  4P5B A;  3M3Y C;  4KDD A;  3FHZ A;  4O2D A;  1JQW A;  2JA7 A;  1WOS A;  2E2J K;  4C3J C;  2JA7 C;  4YFX A;  4A3B K;  2GAH C;  2PA8 D;  1IE0 A;  5E68 A;  4Y52 K;  3GTG A;  2W7V A;  3AD7 C;  1F7V A;  3GTG C;  4C2M C;  3QX3 A;  1Y1V K;  3GTM A;  3V4G A;  5IP7 C;  1TWA A;  1VH2 A;  3GTM C;  1TWA C;  1JOE A;  3S1M K;  3TTG A;  3N0C A;  2VUM A;  5IYB K;  5FJ8 K;  4KMH A;  5D4D A;  3GDZ A;  2VUM C;  1K83 K;  2JH3 A;  2WB1 L;  5C4X C;  2Y3P A;  1WCM A;  4OIN A;  3Q3Q A;  3H0G K;  3AD8 C;  1WCM C;  3IPJ A;  2R7Z C;  4C3I C;  2WAQ L;  4BLA A;  1AB4 A;  1HI9 A;  1EI6 A;  1F9N A;  4A3I C;  5C4J K;  3PO2 C;  3AD9 C;  1SFO A;  4OIP A;  1BJT A;  1SFO C;  2BE5 A;  3AH5 A;  4KAR A;  3HOZ K;  4WIL A;  4FZB A;  1BGW A;  4OIO A;  1DCP A;  1XXA A;  5IOT A;  3HOW K;  4C3H C;  3OPF A;  3GTL K;  2NVY A;  1TWC A;  1ISE A;  2CFA B;  3A8K A;  4PAA A;  3S15 C;  2NVY C;  1TWC C;  4BBR C;  3GTK K;  2GAG C;  3ERE D;  4A3F K;  3PO3 K;  3GEH A;  3S16 C;  4LLG A;  1XZP B;  3RZD C;  1O2F B;  1I6H K;  2Y0S D;  1XZQ B;  2E2I A;  4BBS C;  3A8I A;  2NVT K;  1IBA A;  3FOF A;  2E2I C;  4GTL A;  3N3Y A;  2R93 K;  2XCQ A;  4KAT A;  1G51 A;  4X6A C;  3M4O C;  3HOV K;  4A3J K;  4GTB A;  3BP8 C;  5IYC C;  2V6U A;  3T01 A;  3S1N C;  5C44 K;  3RZO K;  1SMY A;  4BXX C;  1B4B A;  3CQZ A;  4KAW X;  4BY7 C;  4GTC A;  3CQZ C;  3S1Q K;  5EGE A;  3RZD K;  3S14 C;  1TWF K;  4G7O A;  3S2D C;  3G4A A;  3H3V D;  1YCL A;  1WOR A;  2E2I K;  1YX2 A;  2NVX K;  3S2H K;  4G0V A;  3LPX A;  2YU9 K;  4J3N A;  1YNN A;  4LR2 A;  2R92 K;  4DDQ A;  4AYB L;  5TJ3 A;  1J6X A;  2A6E A;  4ZH4 A;  2GSO A;  2V6S A;  3AQP A;  2KWA A;  4Y7N C;  4YFK A;  1O24 A;  4A3G K;  1PJ5 A;  3FKI A;  2WB1 D;  4P5A A;  2PMZ L;  3GTJ A;  3FKI C;  4GTF A;  5CHP A;  1Y1W A;  3OEP A;  3GTJ C;  1Y1W C;  4A3C C;  3HOX C;  3GTP A;  4QJV A;  1C0A A;  3L4J A;  1WQG A;  1WSR A;  3GTP C;  2JA5 A;  4KM9 A;  2JA5 C;  3S17 K;  4GTE A;  2B63 K;  1I50 A;  3FOE A;  4MQ9 A;  1R9T A;  1WOO A;  1I50 C;  4YFN A;  1R9T C;  2ZFZ A;  3JST A;  4A3M K;  1XXB A;  2JA8 C;  3HOU C;  3M3Y K;  2R7Z A;  1HQM A;  3LAJ A;  1WQH A;  5TMC A;  3MML B;  3TFJ A;  4FM9 A;  1ZXO A;  4C3J K;  5C3E C;  2JA7 K;  5IYD C;  1V5V A;  1WQF A;  2ZUE A;  5M3F K;  1F7U A;  3K7A C;  4RMF A;  4PAB A;  2XCO A;  3ORE A;  1DD5 A;  4QIW D;  3HOX K;  1EK8 A;  3GTG K;  4C2M K;  4BY1 C;  1PJ6 A;  4LK1 A;  5IP7 K;  3GTM K;  1TWA K;  4A93 C;  4KM8 A;  1O26 A;  4LOW A;  3HOY C;  3GTO A;  1I3Q A;  1O28 A;  1R9T K; 
#chains in the Genus database with same CATH homology
 2VUM K;  3GTO C;  4A3D C;  1I3Q C;  2R93 K;  5C4X K;  4Y7N K;  4OIQ A;  4QJV B;  3S17 C;  4Q5S A;  2B63 C;  4X6A C;  3DXJ A;  1WCM K;  3M4O C;  2R7Z K;  4KN7 A;  4XLN A;  4A3L C;  3HOV K;  4A3J K;  4C3I K;  3FKI K;  3I4M C;  3HOZ C;  3GTJ K;  1ZYR A;  4A3M C;  5TMF A;  4G7H A;  1Y1W K;  5IYC C;  4A3C K;  3S1N C;  4JK1 A;  5M5W K;  2JA6 C;  3M3Y C;  5C44 K;  4Q4Z A;  4A3I K;  3S1R C;  3RZO K;  1SMY A;  3HOW C;  4BXX C;  3PO2 K;  3GTP K;  3GTL C;  2PA8 L;  3GTQ C;  4BY7 C;  3CQZ C;  4XLP A;  2E2J K;  2JA5 K;  2JA7 C;  3S1Q K;  2PPB A;  3RZD K;  3S14 C;  4YFX A;  4A3K C;  1SFO K;  4A3B K;  1TWF K;  4G7O A;  3S2D C;  2E2H C;  2PA8 D;  1I50 K;  3H3V D;  3GTK C;  1TWG C;  4Y52 K;  4XSZ A;  4A3E K;  4GZY A;  2E2I K;  4A3F C;  3PO3 C;  2JA8 K;  3HOU K;  2NVX K;  5IP9 C;  3GTG C;  3S2H K;  1Y1V K;  5FLM C;  4G7Z A;  1I6H C;  4LJZ A;  4C3H K;  5IP7 C;  2YU9 K;  3GTM C;  1YNN A;  1TWH C;  1TWA C;  2R92 K;  2NVT C;  4AYB L;  5C3E K;  3S15 K;  2O5J A;  3S1M K;  2NVY K;  1TWC K;  3I4N C;  2A6E A;  5IYD K;  4A3L K;  5IYB K;  5FJ8 K;  5D4D A;  2A69 A;  3K7A K;  3EQL A;  4ZH4 A;  4BBR K;  2A6H A;  2VUM C;  3I4M K;  2R93 C;  1K83 K;  2WB1 L;  5C4X C;  4LK0 A;  4Y7N C;  4YFK A;  4OIN A;  3H0G K;  4A3G K;  3S16 K;  1XPP A;  1WCM C;  2WB1 D;  2R7Z C;  2PMZ L;  4BY1 K;  3HOV C;  4A3J C;  3FKI C;  2WAQ L;  4NOI A;  2CW0 A;  4BBS K;  3GTJ C;  1Y1W C;  4A3C C;  4A93 K;  4KMU A;  4QIW L;  3HOY K;  3HOX C;  5C44 C;  4A3I C;  4QJV A;  3RZO C;  5C4J K;  1YNJ A;  3GTO K;  3PO2 C;  2Y0S L;  1I3Q K;  3GTP C;  4A3D K;  4KN4 A;  2NVQ C;  2E2J C;  3S1Q C;  2JA5 C;  4MEX A;  3S17 K;  2B63 K;  4OIP A;  5FLM K;  4X6A K;  3M4O K;  1BDF A;  4MQ9 A;  1SFO C;  1TWF C;  2BE5 A;  4A3B C;  1I50 C;  4YFN A;  1R9T C;  4Y52 C;  3HOZ K;  4AYB D;  4A3M K;  4OIO A;  2JA8 C;  4MEY A;  5IYC K;  4XSX A;  5M5Y K;  2NVX C;  3HOU C;  3I4N K;  2JA6 K;  3M3Y K;  3HKZ L;  1HQM A;  1Y1V C;  3S1R K;  4OIR A;  3S2H C;  3HOW K;  4BXX K;  2YU9 C;  5TMC A;  3GTL K;  4BY7 K;  3GTQ K;  5M5X K;  3HKZ D;  3CQZ K;  2R92 C;  4C3J K;  5C3E C;  2JA7 K;  3S15 C;  3S1M C;  2NVY C;  1TWC C;  5IYD C;  2O5I A;  2PMZ D;  4A3K K;  5IYB C;  5M3F K;  3S14 K;  3S1N K;  3S2D K;  2E2H K;  2WAQ D;  3K7A C;  4BBR C;  3GTK K;  1TWG K;  1K83 C;  4YG2 A;  4QIW D;  4A3F K;  1I6V A;  3H0G C;  3WOD A;  3HOX K;  3PO3 K;  4A3G C;  3S16 C;  5IP9 K;  4LLG A;  3GTG K;  4C2M K;  1IW7 A;  3RZD C;  4BY1 C;  1I6H K;  2Y0S D;  4LK1 A;  5IP7 K;  2NVQ K;  3GTM K;  3H3V L;  4BBS C;  1TWH K;  1TWA K;  5M3M K;  2A68 A;  4A3E C;  2NVT K;  4A93 C;  2E2I C;  3HOY C;  1R9T K;  5C4J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...