3I4MK

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4mK00
4YFXA 2YU9C 4A3BK 4Y7NC 2JA5C 3S16C 1K83K 3S14K 3GTPK 3S2DK 4G7ZA 2R92C 2A6HA 3CQZK 1HQMA 4AYBL 5FJ8K 2JA8C 3HOWK 4A3LK 3S17C 1TWAC 1SFOK 2B63K 4C3HK 3HOUK 3S1RK 3H0GK 5FLMK 1R9TK 4OIOA 4A3LC 1IW7A 4XLNA 2NVTC 3GTQC 1K83C 5IP7C 1ZYRA 4OIRA 5M3MK 1TWGC 2E2HC 4LK0A 2CW0A 3I4NK 3S1NC 3HOWC 5IYDK 1TWFC 2VUMK 4Q4ZA 1YNJA 3GTJK 5C4XC 4A3BC 3PO3K 3RZDK 3GTGC 4MEXA 3RZOC 2WB1L 4X6AC 4OIPA 3DXJA 1I3QC 4BBRC 3H0GC 2PMZL 5FLMC 3S1QC 1I6HC 4ZH4A 2WB1D 1SFOC 1TWCC 2E2IK 4KN7A 2JA6K 3PO2C 3M4OC 3I4MK 4A3EC 3HKZL 3CQZC 5C4JC 4A3MK 5C44K 2Y0SL 5M5XK 2JA8K 3S2DC 4G7OA 3FKIC 4NOIA 4OIQA 3HOVK 4A3FC 3GTMC 3HOXK 1YNNA 4A3CC 4JK1A 4A3MC 1TWFK 3S2HK 4C3IK 3GTLC 1TWCK 2E2IC 3GTMK 1I50K 4YG2A 2A68A 2R93K 5IP7K 4BY1K 5C44C 3GTGK 3GTOC 2R93C 3S15C 4BXXK 1SMYA 1I50C 2A69A 4Y52C 5TMCA 5TMFA 1R9TC 3PO2K 4G7HA 1Y1WC 3S1QK 2VUMC 4AYBD 1TWAK 2B63C 3HOUC 2R7ZK 4BY7C 5IP9C 3HOZK 2WAQL 2NVYC 3S1MC 3H3VD 2WAQD 4Y7NK 2PPBA 2PA8D 2NVTK 2YU9K 2JA7K 3GTKK 3HOVC 3M3YK 3S16K 4LLGA 4C2MK 3I4MC 4A3IC 2A6EA 3I4NC 4MEYA 1TWHC 3S1RC 1TWGK 1Y1WK 2NVQK 4Y52K 4X6AK 5D4DA 1XPPA 3GTQK 2PMZD 2R92K 4LJZA 4XLPA 3S1MK 1Y1VC 3S14C 3K7AK 4OINA 5IP9K 4A3IK 5IYDC 3HOZC 3S1NK 4BY7K 3K7AC 4YFKA 3WODA 4A3DK 3HOXC 4A3CK 4A3JK 3GTKC 4Q5SA 4BXXC 3H3VL 3S15K 3HKZD 2O5JA 4A93C 5M3FK 1WCMK 4XSXA 4MQ9A 4A3GK 2JA6C 4QIWD 1TWHK 3M4OK 5IYCC 2NVXK 3S17K 4A3GC 3S2HC 5IYBK 4XSZA 2BE5A 3M3YC 4LK1A 2JA7C 3RZDC 2JA5K 4A3FK 4QJVA 5C4XK 3FKIK 3HOYC 2NVYK 4QJVB 4A3KC 4BBSK 5M5WK 2E2JC 5C3EK 4KN4A 2PA8L 2R7ZC 4BBSC 5IYCK 1BDFA 3HOYK 1I6HK 4BBRK 4C3JK 3GTOK 4GZYA 1WCMC 4BY1C 3EQLA 4A93K 5C4JK 5IYBC 3PO3C 4A3EK 3GTJC 2NVXC 4KMUA 4A3JC 2Y0SD 2NVQC 1I6VA 2O5IA 4QIWL 5M5YK 3GTLK 4A3DC 5C3EC 1I3QK 4YFNA 2E2JK 3RZOK 4A3KK 1Y1VK 2E2HK 3GTPC
chains in the Genus database with same CATH superfamily
2YU9C 1K83K 2YU9A 1YCLA 4G7ZA 2R92C 2JA8C 4A3LK 3TFHA 1WQFA 1J6VA 4C3HK 3S1RK 3BUEA 1VJEA 3TTGA 1IW7A 1IE0A 3AQPA 4XLNA 2NVTC 4OIRA 2E2HC 1TWGC 1EFWA 2RGRA 5HL8A 3S1NC 5IYDK 3HXAA 2VUMK 4Q4ZA 3GTJK 1DD5A 2WB1L 3DXJA 2GAHC 4ZH4A 1SFOC 3M4OC 2JA6A 3GDZA 3FKIC 4NOIA 3HOVK 1L0WA 3FKIA 2XCRB 1HI9A 1YNNA 4JK1A 4RMFA 4KMDA 1V5VA 1UV7A 4P5AA 1TWHA 3NUHA 4KC6A 2Y3PA 4BXXK 1SMYA 2A69A 4Y52C 5TMCA 1O27A 3PO2K 3S1QK 2CFAB 5JFEA 4BY7C 4GT9A 2B63A 4GTFA 2WAQD 4Y7NK 3HOVC 2YU9K 4A3IC 3TFIA 1TWHC 2NVQK 1IBAA 5D4DA 4BKWA 1XPPA 2KWAA 4C3JC 4FM9A 1Y1VC 3S14C 3K7AK 4OINA 3G4CA 5IYDC 3S1NK 4BY7K 4GTBA 3WODA 4A3CK 3N0BA 1C0AA 3OEPA 4A93C 1VRQC 3ADAC 4WILA 1TWAA 4XSXA 2GSNA 3MMLB 1SFOA 2D6FC 5IYBK 4BLAA 4G0UA 5JVOA 4KARA 3RZDC 2E2HA 1F7UA 1VGXA 3OREA 3FKIK 4BBSK 3QX3A 1O24A 5M5WK 5C3EK 2R7ZC 3HOYK 5EGEA 4GZYA 2ZUFA 3EQLA 1KQ4A 3G4AA 5IYBC 3PO3C 4KMAA 2Y0SD 1F7VA 1I6VA 4A3DC 5M5YK 1I3QK 1ZXOA 2PHCB 1XZPB 3GTPC 3S16C 2GSUA 1B4AA 3CQZK 1XXAA 1ZBSA 4AYBL 4P5BA 5FJ8K 2JH3A 3LAPA 1B4BA 5EGHA 5FLMK 1R9TK 1VH2A 3Q3QA 4A3LC 4KB2A 2P5MA 1K83C 1ZYRA 4KB4A 3HOWC 1TWFC 1JQWA 3GTLA 4A3BC 3AQOA 4BBRC 5FLMC 1I6HC 4A3EC 3CQZC 3S2DC 2R92A 3GEHA 3IPJA 4A3CC 4A3MC 3AD7C 4C3IK 3GTLC 1TWCK 2E2IC 4YG2A 1GE9A 1AB4A 5IP7K 4PAAA 4BY1K 3S15C 5TMFA 4G7HA 1O2FB 4GTDA 4AYBD 1TWAK 2B63C 3HOUC 1BS2A 2R7ZK 1XZPA 1J98A 3GEEA 5IP9C 3S1MC 4C45A 1TWGK 5TJ3A 2PMZD 1WSRA 2RH6A 1RU0A 1IL2A 4LJZA 2XCOA 3FOFA 1PJ6A 3HOZC 3K7AC 4A3DK 4KATA 3GTKC 2R7ZA 1WCMK 3GTGA 4MQ9A 4A3GK 3M4OK 3JSTA 2NVXA 1INNA 3S2HC 4XSZA 2BE5A 1DCOA 4GFQA 4A3FK 5IORA 3HOYC 3L4JA 4QJVB 4G0WA 2E2JC 4KN4A 2PA8L 4BBSC 3L4KA 1WCMC 1Y1VA 4BY1C 4KMHA 1J6XA 4KMUA 4C3IC 3GTLK 1O2AA 3RZOK 2FQOA 1Y1VK 3S14K 4DDQA 1EH1A 4YFXA 2JA5C 1BGWA 1USOA 3GTPK 4LOWA 3S2DK 1F93A 1WOOA 3A8IA 3S17C 1JOEA 3AH5A 5CHPA 1TWAC 1SFOK 2B63K 3HOUK 3GTMA 3H0GA 4OIOA 3GTQC 3CQZA 4KM8A 5M3MK 2CW0A 3I4NK 3T01A 3GTPA 1WORA 3TFJA 1YNJA 1WIHA 3RZDK 4MEXA 1O25A 3RZOC 4X6AC 4P9SA 3S1QC 2WB1D 1WOPA 1TWCC 2E2IK 3PO2C 2JA6K 3I4MK 3HKZL 2JA8K 5C4JC 4A3MK 4G7OA 1WOSA 5CJ9A 4A3FC 1BJTA 1I3QA 3GTMC 3A8JA 3S2HK 2JA7A 2A68A 3GIRA 4BLBA 1EK8A 2FQTA 3GTOC 2R93C 1ZQ1C 1I50C 1R9TC 2CFAA 1F9NA 2VUMC 5IOTA 2WAQL 2PPBA 4GTEA 1I50A 3S16K 1X31C 4C2MK 1ISEA 1XXBA 2A6EA 3S1RC 4Y52K 3GTQA 3FHZA 2R92K 3GTJA 2GSOA 3BP3A 4YFKA 3HOXC 1TWCA 3H3VL 3HKZD 3ERED 5M3FK 3AD8C 1PJ7A 4LR2A 1EI6A 1TWHK 2GAGC 5IYCC 2NVXK 4A3GC 3M3YC 3OPFA 1O26A 3AD9C 2V6SA 2NVYK 4A3KC 1TWFA 3LAJA 1PJ5A 4ILDA 1EQRA 3GTOA 1USMA 5C4JK 2W7VA 4A93K 1IQ0A 2NVXC 1DCPA 2O5IA 4QIWL 4YFNA 4A3KK 1IS1A 1O2BA 2JA5A 3SZYA 4A3BK 4AH6A 4Y7NC 3GTKA 2A6HA 1HQMA 3GSIA 3HOWK 3V4GA 2ZUEA 2NVYA 3H0GK 3LPXA 1XZQA 1R9TA 5E68A 3BP8C 5IP7C 4LK0A 4J3NA 3SZZA 4WJ4A 3A8KA 5C4XC 4WJ3M 3PO3K 1ZVUA 4KM9A 3GTGC 4OIPA 1I3QC 3H0GC 2PMZL 2EBBA 4LQYA 4KN7A 4C2MC 5IOQA 5C44K 2Y0SL 5M5XK 3T02A 3N0CA 4OIQA 1XXCA 4GTLA 5L46A 3FOEA 1O28A 1VLOA 1WSVA 3HOXK 1TWFK 2ZFZA 1XZQB 2V6TA 2V6UA 3GTMK 3GEIA 1I50K 2R93K 1O29A 4XCHA 5C44C 3GTGK 1WCMA 4KDDA 3CAGA 1Y1WC 3HOZK 2NVYC 3H3VD 2P8TA 2PA8D 2NVTK 3GTKK 2JA7K 3M3YK 4LLGA 4G0VA 3I4MC 3I4NC 4MEYA 4GTAA 1G51A 4C3HC 4KAWX 1Y1WK 1WQHA 4M1XA 4X6AK 3GTQK 1DCHA 4XLPA 2E2IA 3S0XA 3S1MK 5IP9K 4A3IK 4PABA 4A3JK 4Q5SA 4BXXC 3VA7A 4FZBA 3S15K 2O5JA 1Y1WA 2VUMA 4GTCA 2XCQA 2JA6C 2R93A 4QIWD 3S17K 1WQGA 4LK1A 2JA7C 2JA5K 4QJVA 5C4XK 5IYCK 1TWGA 1BDFA 1YX2A 5IOSA 1I6HK 1K83A 4BBRK 4C3JK 3GTOK 3N3YA 1JVIA 3T00A 4A3EK 3GTJC 4A3JC 2NVQC 4O2DA 5C3EC 2E2JK 1J6WA 4KASA 2E2HK
chains in the Genus database with same CATH topology
4YFXA 2YU9C 4A3BK 4Y7NC 2JA5C 3S16C 1K83K 3S14K 3GTPK 3S2DK 4G7ZA 2R92C 2A6HA 3CQZK 1HQMA 4AYBL 5FJ8K 2JA8C 3HOWK 4A3LK 3S17C 1TWAC 1SFOK 2B63K 4C3HK 3HOUK 3S1RK 3H0GK 5FLMK 1R9TK 4OIOA 4A3LC 1IW7A 4XLNA 2NVTC 3GTQC 1K83C 5IP7C 1ZYRA 4OIRA 5M3MK 1TWGC 2E2HC 4LK0A 2CW0A 3I4NK 3S1NC 3HOWC 5IYDK 1TWFC 2VUMK 4Q4ZA 1YNJA 3GTJK 5C4XC 4A3BC 3PO3K 3RZDK 3GTGC 4MEXA 3RZOC 2WB1L 4X6AC 4OIPA 3DXJA 1I3QC 4BBRC 3H0GC 2PMZL 5FLMC 3S1QC 1I6HC 4ZH4A 2WB1D 1SFOC 1TWCC 2E2IK 4KN7A 2JA6K 3PO2C 3M4OC 3I4MK 4A3EC 3HKZL 3CQZC 5C4JC 4A3MK 5C44K 2Y0SL 5M5XK 2JA8K 3S2DC 4G7OA 3FKIC 4NOIA 4OIQA 3HOVK 4A3FC 3GTMC 3HOXK 1YNNA 4A3CC 4JK1A 4A3MC 1TWFK 3S2HK 4C3IK 3GTLC 1TWCK 2E2IC 3GTMK 1I50K 4YG2A 2A68A 2R93K 5IP7K 4BY1K 5C44C 3GTGK 3GTOC 2R93C 3S15C 4BXXK 1SMYA 1I50C 2A69A 4Y52C 5TMCA 5TMFA 1R9TC 3PO2K 4G7HA 1Y1WC 3S1QK 2VUMC 4AYBD 1TWAK 2B63C 3HOUC 2R7ZK 4BY7C 5IP9C 3HOZK 2WAQL 2NVYC 3S1MC 3H3VD 2WAQD 4Y7NK 2PPBA 2PA8D 2NVTK 2YU9K 2JA7K 3GTKK 3HOVC 3M3YK 3S16K 4LLGA 4C2MK 3I4MC 4A3IC 2A6EA 3I4NC 4MEYA 1TWHC 3S1RC 1TWGK 1Y1WK 2NVQK 4Y52K 4X6AK 5D4DA 1XPPA 3GTQK 2PMZD 2R92K 4LJZA 4XLPA 3S1MK 1Y1VC 3S14C 3K7AK 4OINA 5IP9K 4A3IK 5IYDC 3HOZC 3S1NK 4BY7K 3K7AC 4YFKA 3WODA 4A3DK 3HOXC 4A3CK 4A3JK 3GTKC 4Q5SA 4BXXC 3H3VL 3S15K 3HKZD 2O5JA 4A93C 5M3FK 1WCMK 4XSXA 4MQ9A 4A3GK 2JA6C 4QIWD 1TWHK 3M4OK 5IYCC 2NVXK 3S17K 4A3GC 3S2HC 5IYBK 4XSZA 2BE5A 3M3YC 4LK1A 2JA7C 3RZDC 2JA5K 4A3FK 4QJVA 5C4XK 3FKIK 3HOYC 2NVYK 4QJVB 4A3KC 4BBSK 5M5WK 2E2JC 5C3EK 4KN4A 2PA8L 2R7ZC 4BBSC 5IYCK 1BDFA 3HOYK 1I6HK 4BBRK 4C3JK 3GTOK 4GZYA 1WCMC 4BY1C 3EQLA 4A93K 5C4JK 5IYBC 3PO3C 4A3EK 3GTJC 2NVXC 4KMUA 4A3JC 2Y0SD 2NVQC 1I6VA 2O5IA 4QIWL 5M5YK 3GTLK 4A3DC 5C3EC 1I3QK 4YFNA 2E2JK 3RZOK 4A3KK 1Y1VK 2E2HK 3GTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFX A;  2YU9 C;  4A3B K;  4Y7N C;  2JA5 C;  3S16 C;  1K83 K;  3S14 K;  3GTP K;  3S2D K;  4G7Z A;  2R92 C;  2A6H A;  3CQZ K;  1HQM A;  4AYB L;  5FJ8 K;  2JA8 C;  3HOW K;  4A3L K;  3S17 C;  1TWA C;  1SFO K;  2B63 K;  4C3H K;  3HOU K;  3S1R K;  3H0G K;  5FLM K;  1R9T K;  4OIO A;  4A3L C;  1IW7 A;  4XLN A;  2NVT C;  3GTQ C;  1K83 C;  5IP7 C;  1ZYR A;  4OIR A;  5M3M K;  1TWG C;  2E2H C;  4LK0 A;  2CW0 A;  3I4N K;  3S1N C;  3HOW C;  5IYD K;  1TWF C;  2VUM K;  4Q4Z A;  1YNJ A;  3GTJ K;  5C4X C;  4A3B C;  3PO3 K;  3RZD K;  3GTG C;  4MEX A;  3RZO C;  2WB1 L;  4X6A C;  4OIP A;  3DXJ A;  1I3Q C;  4BBR C;  3H0G C;  2PMZ L;  5FLM C;  3S1Q C;  1I6H C;  4ZH4 A;  2WB1 D;  1SFO C;  1TWC C;  2E2I K;  4KN7 A;  2JA6 K;  3PO2 C;  3M4O C;  3I4M K;  4A3E C;  3HKZ L;  3CQZ C;  5C4J C;  4A3M K;  5C44 K;  2Y0S L;  5M5X K;  2JA8 K;  3S2D C;  4G7O A;  3FKI C;  4NOI A;  4OIQ A;  3HOV K;  4A3F C;  3GTM C;  3HOX K;  1YNN A;  4A3C C;  4JK1 A;  4A3M C;  1TWF K;  3S2H K;  4C3I K;  3GTL C;  1TWC K;  2E2I C;  3GTM K;  1I50 K;  4YG2 A;  2A68 A;  2R93 K;  5IP7 K;  4BY1 K;  5C44 C;  3GTG K;  3GTO C;  2R93 C;  3S15 C;  4BXX K;  1SMY A;  1I50 C;  2A69 A;  4Y52 C;  5TMC A;  5TMF A;  1R9T C;  3PO2 K;  4G7H A;  1Y1W C;  3S1Q K;  2VUM C;  4AYB D;  1TWA K;  2B63 C;  3HOU C;  2R7Z K;  4BY7 C;  5IP9 C;  3HOZ K;  2WAQ L;  2NVY C;  3S1M C;  3H3V D;  2WAQ D;  4Y7N K;  2PPB A;  2PA8 D;  2NVT K;  2YU9 K;  2JA7 K;  3GTK K;  3HOV C;  3M3Y K;  3S16 K;  4LLG A;  4C2M K;  3I4M C;  4A3I C;  2A6E A;  3I4N C;  4MEY A;  1TWH C;  3S1R C;  1TWG K;  1Y1W K;  2NVQ K;  4Y52 K;  4X6A K;  5D4D A;  1XPP A;  3GTQ K;  2PMZ D;  2R92 K;  4LJZ A;  4XLP A;  3S1M K;  1Y1V C;  3S14 C;  3K7A K;  4OIN A;  5IP9 K;  4A3I K;  5IYD C;  3HOZ C;  3S1N K;  4BY7 K;  3K7A C;  4YFK A;  3WOD A;  4A3D K;  3HOX C;  4A3C K;  4A3J K;  3GTK C;  4Q5S A;  4BXX C;  3H3V L;  3S15 K;  3HKZ D;  2O5J A;  4A93 C;  5M3F K;  1WCM K;  4XSX A;  4MQ9 A;  4A3G K;  2JA6 C;  4QIW D;  1TWH K;  3M4O K;  5IYC C;  2NVX K;  3S17 K;  4A3G C;  3S2H C;  5IYB K;  4XSZ A;  2BE5 A;  3M3Y C;  4LK1 A;  2JA7 C;  3RZD C;  2JA5 K;  4A3F K;  4QJV A;  5C4X K;  3FKI K;  3HOY C;  2NVY K;  4QJV B;  4A3K C;  4BBS K;  5M5W K;  2E2J C;  5C3E K;  4KN4 A;  2PA8 L;  2R7Z C;  4BBS C;  5IYC K;  1BDF A;  3HOY K;  1I6H K;  4BBR K;  4C3J K;  3GTO K;  4GZY A;  1WCM C;  4BY1 C;  3EQL A;  4A93 K;  5C4J K;  5IYB C;  3PO3 C;  4A3E K;  3GTJ C;  2NVX C;  4KMU A;  4A3J C;  2Y0S D;  2NVQ C;  1I6V A;  2O5I A;  4QIW L;  5M5Y K;  3GTL K;  4A3D C;  5C3E C;  1I3Q K;  4YFN A;  2E2J K;  3RZO K;  4A3K K;  1Y1V K;  2E2H K;  3GTP C; 
#chains in the Genus database with same CATH topology
 2YU9 C;  1K83 K;  2YU9 A;  1YCL A;  4G7Z A;  2R92 C;  2JA8 C;  4A3L K;  3TFH A;  1WQF A;  1J6V A;  4C3H K;  3S1R K;  3BUE A;  1VJE A;  3TTG A;  1IW7 A;  1IE0 A;  3AQP A;  4XLN A;  2NVT C;  4OIR A;  2E2H C;  1TWG C;  1EFW A;  2RGR A;  5HL8 A;  3S1N C;  5IYD K;  3HXA A;  2VUM K;  4Q4Z A;  3GTJ K;  1DD5 A;  2WB1 L;  3DXJ A;  2GAH C;  4ZH4 A;  1SFO C;  3M4O C;  2JA6 A;  3GDZ A;  3FKI C;  4NOI A;  3HOV K;  1L0W A;  3FKI A;  2XCR B;  1HI9 A;  1YNN A;  4JK1 A;  4RMF A;  4KMD A;  1V5V A;  1UV7 A;  4P5A A;  1TWH A;  3NUH A;  4KC6 A;  2Y3P A;  4BXX K;  1SMY A;  2A69 A;  4Y52 C;  5TMC A;  1O27 A;  3PO2 K;  3S1Q K;  2CFA B;  5JFE A;  4BY7 C;  4GT9 A;  2B63 A;  4GTF A;  2WAQ D;  4Y7N K;  3HOV C;  2YU9 K;  4A3I C;  3TFI A;  1TWH C;  2NVQ K;  1IBA A;  5D4D A;  4BKW A;  1XPP A;  2KWA A;  4C3J C;  4FM9 A;  1Y1V C;  3S14 C;  3K7A K;  4OIN A;  3G4C A;  5IYD C;  3S1N K;  4BY7 K;  4GTB A;  3WOD A;  4A3C K;  3N0B A;  1C0A A;  3OEP A;  4A93 C;  1VRQ C;  3ADA C;  4WIL A;  1TWA A;  4XSX A;  2GSN A;  3MML B;  1SFO A;  2D6F C;  5IYB K;  4BLA A;  4G0U A;  5JVO A;  4KAR A;  3RZD C;  2E2H A;  1F7U A;  1VGX A;  3ORE A;  3FKI K;  4BBS K;  3QX3 A;  1O24 A;  5M5W K;  5C3E K;  2R7Z C;  3HOY K;  5EGE A;  4GZY A;  2ZUF A;  3EQL A;  1KQ4 A;  3G4A A;  5IYB C;  3PO3 C;  4KMA A;  2Y0S D;  1F7V A;  1I6V A;  4A3D C;  5M5Y K;  1I3Q K;  1ZXO A;  2PHC B;  1XZP B;  3GTP C;  3S16 C;  2GSU A;  1B4A A;  3CQZ K;  1XXA A;  1ZBS A;  4AYB L;  4P5B A;  5FJ8 K;  2JH3 A;  3LAP A;  1B4B A;  5EGH A;  5FLM K;  1R9T K;  1VH2 A;  3Q3Q A;  4A3L C;  4KB2 A;  2P5M A;  1K83 C;  1ZYR A;  4KB4 A;  3HOW C;  1TWF C;  1JQW A;  3GTL A;  4A3B C;  3AQO A;  4BBR C;  5FLM C;  1I6H C;  4A3E C;  3CQZ C;  3S2D C;  2R92 A;  3GEH A;  3IPJ A;  4A3C C;  4A3M C;  3AD7 C;  4C3I K;  3GTL C;  1TWC K;  2E2I C;  4YG2 A;  1GE9 A;  1AB4 A;  5IP7 K;  4PAA A;  4BY1 K;  3S15 C;  5TMF A;  4G7H A;  1O2F B;  4GTD A;  4AYB D;  1TWA K;  2B63 C;  3HOU C;  1BS2 A;  2R7Z K;  1XZP A;  1J98 A;  3GEE A;  5IP9 C;  3S1M C;  4C45 A;  1TWG K;  5TJ3 A;  2PMZ D;  1WSR A;  2RH6 A;  1RU0 A;  1IL2 A;  4LJZ A;  2XCO A;  3FOF A;  1PJ6 A;  3HOZ C;  3K7A C;  4A3D K;  4KAT A;  3GTK C;  2R7Z A;  1WCM K;  3GTG A;  4MQ9 A;  4A3G K;  3M4O K;  3JST A;  2NVX A;  1INN A;  3S2H C;  4XSZ A;  2BE5 A;  1DCO A;  4GFQ A;  4A3F K;  5IOR A;  3HOY C;  3L4J A;  4QJV B;  4G0W A;  2E2J C;  4KN4 A;  2PA8 L;  4BBS C;  3L4K A;  1WCM C;  1Y1V A;  4BY1 C;  4KMH A;  1J6X A;  4KMU A;  4C3I C;  3GTL K;  1O2A A;  3RZO K;  2FQO A;  1Y1V K;  3S14 K;  4DDQ A;  1EH1 A;  4YFX A;  2JA5 C;  1BGW A;  1USO A;  3GTP K;  4LOW A;  3S2D K;  1F93 A;  1WOO A;  3A8I A;  3S17 C;  1JOE A;  3AH5 A;  5CHP A;  1TWA C;  1SFO K;  2B63 K;  3HOU K;  3GTM A;  3H0G A;  4OIO A;  3GTQ C;  3CQZ A;  4KM8 A;  5M3M K;  2CW0 A;  3I4N K;  3T01 A;  3GTP A;  1WOR A;  3TFJ A;  1YNJ A;  1WIH A;  3RZD K;  4MEX A;  1O25 A;  3RZO C;  4X6A C;  4P9S A;  3S1Q C;  2WB1 D;  1WOP A;  1TWC C;  2E2I K;  3PO2 C;  2JA6 K;  3I4M K;  3HKZ L;  2JA8 K;  5C4J C;  4A3M K;  4G7O A;  1WOS A;  5CJ9 A;  4A3F C;  1BJT A;  1I3Q A;  3GTM C;  3A8J A;  3S2H K;  2JA7 A;  2A68 A;  3GIR A;  4BLB A;  1EK8 A;  2FQT A;  3GTO C;  2R93 C;  1ZQ1 C;  1I50 C;  1R9T C;  2CFA A;  1F9N A;  2VUM C;  5IOT A;  2WAQ L;  2PPB A;  4GTE A;  1I50 A;  3S16 K;  1X31 C;  4C2M K;  1ISE A;  1XXB A;  2A6E A;  3S1R C;  4Y52 K;  3GTQ A;  3FHZ A;  2R92 K;  3GTJ A;  2GSO A;  3BP3 A;  4YFK A;  3HOX C;  1TWC A;  3H3V L;  3HKZ D;  3ERE D;  5M3F K;  3AD8 C;  1PJ7 A;  4LR2 A;  1EI6 A;  1TWH K;  2GAG C;  5IYC C;  2NVX K;  4A3G C;  3M3Y C;  3OPF A;  1O26 A;  3AD9 C;  2V6S A;  2NVY K;  4A3K C;  1TWF A;  3LAJ A;  1PJ5 A;  4ILD A;  1EQR A;  3GTO A;  1USM A;  5C4J K;  2W7V A;  4A93 K;  1IQ0 A;  2NVX C;  1DCP A;  2O5I A;  4QIW L;  4YFN A;  4A3K K;  1IS1 A;  1O2B A;  2JA5 A;  3SZY A;  4A3B K;  4AH6 A;  4Y7N C;  3GTK A;  2A6H A;  1HQM A;  3GSI A;  3HOW K;  3V4G A;  2ZUE A;  2NVY A;  3H0G K;  3LPX A;  1XZQ A;  1R9T A;  5E68 A;  3BP8 C;  5IP7 C;  4LK0 A;  4J3N A;  3SZZ A;  4WJ4 A;  3A8K A;  5C4X C;  4WJ3 M;  3PO3 K;  1ZVU A;  4KM9 A;  3GTG C;  4OIP A;  1I3Q C;  3H0G C;  2PMZ L;  2EBB A;  4LQY A;  4KN7 A;  4C2M C;  5IOQ A;  5C44 K;  2Y0S L;  5M5X K;  3T02 A;  3N0C A;  4OIQ A;  1XXC A;  4GTL A;  5L46 A;  3FOE A;  1O28 A;  1VLO A;  1WSV A;  3HOX K;  1TWF K;  2ZFZ A;  1XZQ B;  2V6T A;  2V6U A;  3GTM K;  3GEI A;  1I50 K;  2R93 K;  1O29 A;  4XCH A;  5C44 C;  3GTG K;  1WCM A;  4KDD A;  3CAG A;  1Y1W C;  3HOZ K;  2NVY C;  3H3V D;  2P8T A;  2PA8 D;  2NVT K;  3GTK K;  2JA7 K;  3M3Y K;  4LLG A;  4G0V A;  3I4M C;  3I4N C;  4MEY A;  4GTA A;  1G51 A;  4C3H C;  4KAW X;  1Y1W K;  1WQH A;  4M1X A;  4X6A K;  3GTQ K;  1DCH A;  4XLP A;  2E2I A;  3S0X A;  3S1M K;  5IP9 K;  4A3I K;  4PAB A;  4A3J K;  4Q5S A;  4BXX C;  3VA7 A;  4FZB A;  3S15 K;  2O5J A;  1Y1W A;  2VUM A;  4GTC A;  2XCQ A;  2JA6 C;  2R93 A;  4QIW D;  3S17 K;  1WQG A;  4LK1 A;  2JA7 C;  2JA5 K;  4QJV A;  5C4X K;  5IYC K;  1TWG A;  1BDF A;  1YX2 A;  5IOS A;  1I6H K;  1K83 A;  4BBR K;  4C3J K;  3GTO K;  3N3Y A;  1JVI A;  3T00 A;  4A3E K;  3GTJ C;  4A3J C;  2NVQ C;  4O2D A;  5C3E C;  2E2J K;  1J6W A;  4KAS A;  2E2H K; 
#chains in the Genus database with same CATH homology
 4YFX A;  2YU9 C;  4A3B K;  4Y7N C;  2JA5 C;  3S16 C;  1K83 K;  3S14 K;  3GTP K;  3S2D K;  4G7Z A;  2R92 C;  2A6H A;  3CQZ K;  1HQM A;  4AYB L;  5FJ8 K;  2JA8 C;  3HOW K;  4A3L K;  3S17 C;  1TWA C;  1SFO K;  2B63 K;  4C3H K;  3HOU K;  3S1R K;  3H0G K;  5FLM K;  1R9T K;  4OIO A;  4A3L C;  1IW7 A;  4XLN A;  2NVT C;  3GTQ C;  1K83 C;  5IP7 C;  1ZYR A;  4OIR A;  5M3M K;  1TWG C;  2E2H C;  4LK0 A;  2CW0 A;  3I4N K;  3S1N C;  3HOW C;  5IYD K;  1TWF C;  2VUM K;  4Q4Z A;  1YNJ A;  3GTJ K;  5C4X C;  4A3B C;  3PO3 K;  3RZD K;  3GTG C;  4MEX A;  3RZO C;  2WB1 L;  4X6A C;  4OIP A;  3DXJ A;  1I3Q C;  4BBR C;  3H0G C;  2PMZ L;  5FLM C;  3S1Q C;  1I6H C;  4ZH4 A;  2WB1 D;  1SFO C;  1TWC C;  2E2I K;  4KN7 A;  2JA6 K;  3PO2 C;  3M4O C;  3I4M K;  4A3E C;  3HKZ L;  3CQZ C;  5C4J C;  4A3M K;  5C44 K;  2Y0S L;  5M5X K;  2JA8 K;  3S2D C;  4G7O A;  3FKI C;  4NOI A;  4OIQ A;  3HOV K;  4A3F C;  3GTM C;  3HOX K;  1YNN A;  4A3C C;  4JK1 A;  4A3M C;  1TWF K;  3S2H K;  4C3I K;  3GTL C;  1TWC K;  2E2I C;  3GTM K;  1I50 K;  4YG2 A;  2A68 A;  2R93 K;  5IP7 K;  4BY1 K;  5C44 C;  3GTG K;  3GTO C;  2R93 C;  3S15 C;  4BXX K;  1SMY A;  1I50 C;  2A69 A;  4Y52 C;  5TMC A;  5TMF A;  1R9T C;  3PO2 K;  4G7H A;  1Y1W C;  3S1Q K;  2VUM C;  4AYB D;  1TWA K;  2B63 C;  3HOU C;  2R7Z K;  4BY7 C;  5IP9 C;  3HOZ K;  2WAQ L;  2NVY C;  3S1M C;  3H3V D;  2WAQ D;  4Y7N K;  2PPB A;  2PA8 D;  2NVT K;  2YU9 K;  2JA7 K;  3GTK K;  3HOV C;  3M3Y K;  3S16 K;  4LLG A;  4C2M K;  3I4M C;  4A3I C;  2A6E A;  3I4N C;  4MEY A;  1TWH C;  3S1R C;  1TWG K;  1Y1W K;  2NVQ K;  4Y52 K;  4X6A K;  5D4D A;  1XPP A;  3GTQ K;  2PMZ D;  2R92 K;  4LJZ A;  4XLP A;  3S1M K;  1Y1V C;  3S14 C;  3K7A K;  4OIN A;  5IP9 K;  4A3I K;  5IYD C;  3HOZ C;  3S1N K;  4BY7 K;  3K7A C;  4YFK A;  3WOD A;  4A3D K;  3HOX C;  4A3C K;  4A3J K;  3GTK C;  4Q5S A;  4BXX C;  3H3V L;  3S15 K;  3HKZ D;  2O5J A;  4A93 C;  5M3F K;  1WCM K;  4XSX A;  4MQ9 A;  4A3G K;  2JA6 C;  4QIW D;  1TWH K;  3M4O K;  5IYC C;  2NVX K;  3S17 K;  4A3G C;  3S2H C;  5IYB K;  4XSZ A;  2BE5 A;  3M3Y C;  4LK1 A;  2JA7 C;  3RZD C;  2JA5 K;  4A3F K;  4QJV A;  5C4X K;  3FKI K;  3HOY C;  2NVY K;  4QJV B;  4A3K C;  4BBS K;  5M5W K;  2E2J C;  5C3E K;  4KN4 A;  2PA8 L;  2R7Z C;  4BBS C;  5IYC K;  1BDF A;  3HOY K;  1I6H K;  4BBR K;  4C3J K;  3GTO K;  4GZY A;  1WCM C;  4BY1 C;  3EQL A;  4A93 K;  5C4J K;  5IYB C;  3PO3 C;  4A3E K;  3GTJ C;  2NVX C;  4KMU A;  4A3J C;  2Y0S D;  2NVQ C;  1I6V A;  2O5I A;  4QIW L;  5M5Y K;  3GTL K;  4A3D C;  5C3E C;  1I3Q K;  4YFN A;  2E2J K;  3RZO K;  4A3K K;  1Y1V K;  2E2H K;  3GTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...