3I4MK

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4mK00
5IP7K 2O5JA 3GTMK 1WCMK 1K83K 3H0GK 5C4JK 4G7OA 3S16C 2WB1D 4A3BC 4KMUA 4OIRA 4YG2A 3S14C 1IW7A 1TWAC 3S16K 5M5XK 4A3BK 4QIWL 2Y0SD 2WAQD 2CW0A 3S14K 1TWAK 4BY1C 2NVQC 1ZYRA 2A68A 4Y7NC 2R93C 4Y52C 4C3JK 2B63C 4BY1K 2NVQK 2JA5C 3S2HC 4C3IK 4Y7NK 3HOWC 5C3EC 2E2IC 2R93K 4Y52K 5IYCC 4BBSK 2B63K 3S2HK 3CQZC 2JA5K 5M3FK 3GTLC 3HOWK 5C3EK 2E2IK 2VUMK 4LK1A 5IYCK 5TMCA 3CQZK 4XLNA 4A3IC 2O5IA 4A3GC 3RZDC 3GTQC 2JA6C 4MEXA 4A93C 2E2JC 4KN7A 4A3IK 4A3GK 3RZDK 3GTQK 4A3EC 2JA6K 2A6HA 1R9TC 3H3VD 4A93K 2A69A 2E2JK 4Q4ZA 1YNJA 4LK0A 4A3EK 2PMZD 3HOUC 5M5WK 1R9TK 5C44C 1I3QC 3FKIC 2PA8D 3RZOC 1Y1WC 1Y1VC 3HOUK 5D4DA 3GTGC 5C44K 1I3QK 3FKIK 3RZOK 3S1QC 1Y1WK 1Y1VK 3HKZL 3DXJA 2NVTC 4G7ZA 4BBSC 4AYBL 3GTGK 2JA7C 1TWFC 3S1QK 2VUMC 3S15C 2NVTK 2R7ZC 4A3LC 2JA7K 1TWFK 5C4JC 3PO2C 3I4MC 4OIOA 2NVXC 3S15K 3S17C 4QIWD 1XPPA 2R7ZK 4XSZA 4A3LK 3PO2K 3I4MK 3HOZC 4KN4A 2YU9C 2NVXK 3S17K 4Q5SA 4C2MK 4YFNA 3HKZD 3WODA 3HOZK 2YU9K 4XSXA 2NVYC 4LJZA 3S2DC 1I50C 2NVYK 2A6EA 4C3HK 3S2DK 5C4XK 1TWHC 2WB1L 4QJVA 2PPBA 1TWGC 1I50K 2E2HC 3GTOC 3S1RC 3HOVC 3HOXC 2R92C 5IYBC 3K7AC 1TWHK 1TWGK 2Y0SL 2E2HK 2WAQL 3GTOK 3S1RK 3HOVK 3HOXK 4ZH4A 5IYBK 4A3FK 1I6VA 3K7AK 1SMYA 4NOIA 4G7HA 2R92K 3GTPC 3S1NC 1YNNA 4YFXA 1TWCC 3GTKC 3S1NK 5M5YK 3GTPK 4A3CC 3HOYC 4MQ9A 5TMFA 1TWCK 3GTKK 1I6HC 4BBRC 4A3CK 5IP9C 5FLMC 3GTJC 1BDFA 3HOYK 3M4OC 1I6HK 5IYDC 4A3KC 3I4NC 3M3YC 4BBRK 5IP9K 4AYBD 5FLMK 5M3MK 3GTJK 3M4OK 4A3MC 4QJVB 5C4XC 4A3KK 4OINA 3I4NK 1SFOC 3M3YK 4BXXC 2BE5A 3PO3C 3EQLA 5IYDK 2JA8C 4A3MK 4BY7C 5FJ8K 3H3VL 1SFOK 4BXXK 4X6AC 4MEYA 3PO3K 2JA8K 4A3FC 4GZYA 4BY7K 4YFKA 2PMZL 4OIPA 4X6AK 4A3JC 3S1MC 2PA8L 1HQMA 4A3DC 5IP7C 3GTMC 1WCMC 4LLGA 4A3JK 3GTLK 4JK1A 1K83C 3H0GC 4XLPA 4OIQA 3S1MK 4A3DK
chains in the Genus database with same CATH superfamily
2NVYA 3N0CA 1J98A 5IP7K 3GTMK 1XZQA 1I50A 2WB1D 1VH2A 4YG2A 3OPFA 4P5BA 1J6VA 2R92A 3G4AA 1TWAK 4BY1C 2A68A 2R93C 4Y52C 3GTPA 4C3JK 2NVQK 4WILA 5C3EC 1WOOA 5M3FK 2E2IK 4LK1A 5IYCK 4XLNA 4GTFA 1XZQB 4C45A 4A93C 3CAGA 4KN7A 2V6UA 4A3GK 5JFEA 3GTQK 2JA6K 1VRQC 2A6HA 2E2JK 1YNJA 4A3EK 5M5WK 1R9TK 5E68A 3FKIC 2PA8D 4PABA 3GEHA 2ZUEA 5HL8A 5IORA 3HKZL 4BBSC 3DXJA 4PAAA 4G7ZA 2NVTC 3GTGK 1PJ7A 4KMDA 3S15C 4A3LC 1IS1A 3I4MC 4QIWD 2R7ZK 4XSZA 3PO2K 4KN4A 2NVXK 4C2MK 4BKWA 3HKZD 3HOZK 4LJZA 2JH3A 2KWAA 1IE0A 4KB4A 1PJ6A 4WJ4A 1XXBA 1XXCA 2NVYK 2A6EA 3FHZA 3S2DK 1YX2A 3QX3A 1I50K 3K7AC 2E2HK 4GFQA 4ZH4A 2R92K 1B4BA 4BLAA 1YNNA 1TWCC 1F7UA 1WIHA 3GTPK 1JQWA 4MQ9A 1I3QA 3IPJA 5IP9C 5EGEA 1V5VA 5FLMC 3M4OC 1Y1WA 1Y1VA 3AH5A 3M3YC 3GEIA 4KM9A 3TFJA 1O2BA 5C4XC 4KC6A 1SFOC 3I4NK 1BGWA 3EQLA 4BY7C 4KATA 2FQTA 4X6AC 2JA8K 4A3FC 4KMHA 3AD7C 4XCHA 2YU9A 5IP7C 3GTMC 4FZBA 1J6XA 4J3NA 1R9TA 1YCLA 2O5JA 2P8TA 1ZVUA 4GTAA 5C4JK 1O2FB 3AQOA 2ZUFA 3Q3QA 1IW7A 1TWAC 1TWGA 3S16K 4A3BK 4C3JC 3SZYA 2NVQC 1ZYRA 3HXAA 2GAGC 3GTKA 3L4JA 2E2IC 2Y3PA 5IYCC 1PJ5A 3TTGA 2JA5K 3GTLC 3ERED 2VUMK 1EI6A 5TMCA 4A3GC 3GTQC 2JA6C 4AH6A 3AQPA 2E2JC 2RH6A 4A3IK 4A3EC 4KARA 1R9TC 1AB4A 4LK0A 3T02A 1IL2A 2E2HA 1GE9A 3AD9C 3GTGC 1I3QK 3N0BA 3RZOK 1HI9A 1Y1WK 1Y1VK 3H0GA 1K83A 4AYBL 2RGRA 2R7ZC 2FQOA 3PO2C 4OIOA 1EFWA 2NVXC 4C2MC 3HOZC 3BP3A 3S17K 1JOEA 4YFNA 4GTDA 3BP8C 3WODA 2YU9K 2NVYC 3S2DC 1I50C 2W7VA 3CQZA 3LAPA 2E2HC 2R92C 4LQYA 1C0AA 1TWGK 2Y0SL 1G51A 2WAQL 3S1RK 3HOXK 5IYBK 2CFAA 1SMYA 1O24A 3OREA 1DCHA 1ZXOA 4G7HA 3GTPC 4KB2A 3ADAC 3S1NK 5TMFA 3GTKK 4LR2A 4M1XA 4A3CK 1I6HK 3I4NC 3GIRA 4KDDA 5IYDK 2JA5A 2BE5A 2JA7A 4GT9A 2JA8C 1USOA 2VUMA 3H3VL 4MEYA 3PO3K 2CFAB 4YFKA 2PMZL 1BS2A 1WOSA 4DDQA 3SZZA 3S1MK 4JK1A 4OIQA 5C4JC 4XLPA 1EK8A 1USMA 1UV7A 4A3DK 1WCMK 1K83K 3H0GK 3S16C 4A3BC 1BJTA 1VGXA 4OIRA 1TWHA 3GTOA 1EQRA 2CW0A 3S14K 3N3YA 4GTLA 2JA5C 4C3IK 4Y7NK 1WQFA 4BBSK 2B63K 3S2HK 4LOWA 1B4AA 3HOWK 3LAJA 3GTJA 3CQZK 4A3IC 2O5IA 4G0VA 4MEXA 1F7VA 3V4GA 3BUEA 3RZDK 1DD5A 1I3QC 2ZFZA 3RZOC 1Y1WC 1Y1VC 2D6FC 3HOUK 1DCOA 5C44K 3S0XA 2V6SA 4P5AA 4G0WA 1WSRA 3S1QK 4G0UA 2JA7K 1TWFK 3S17C 4KAWX 1JVIA 4RMFA 3L4KA 5L46A 2YU9C 1IQ0A 1O28A 3FOEA 1KQ4A 2R93A 1O2AA 4C3HK 5C4XK 2WB1L 1ZBSA 2PPBA 1TWGC 3S1RC 3HOXC 5IYBC 1TWHK 1WCMA 4P9SA 1EH1A 3GTOK 3HOVK 4A3FK 3T01A 3S1NC 3LPXA 4YFXA 3GTKC 1VLOA 5M5YK 4A3CC 1I6HC 1IBAA 3TFHA 3FKIA 3HOYK 1O27A 4GTEA 3A8JA 5CJ9A 5IYDC 1WQHA 3GDZA 4BBRK 4AYBD 3GTJK 5M3MK 2EBBA 3T00A 2B63A 4A3KK 4OINA 3PO3C 3AD8C 4A3MK 5FJ8K 4BXXK 1F93A 1J6WA 4GZYA 4OIPA 3S1MC 2PA8L 4A3DC 3JSTA 1WCMC 4LLGA 5CHPA 4A3JK 3GTLK 1K83C 3H0GC 2GSNA 4G7OA 4ILDA 2PHCB 1VJEA 4KMUA 3MMLB 3S14C 5M5XK 1DCPA 4QIWL 2GSUA 2Y0SD 2WAQD 4C3IC 4Y7NC 1TWFA 5IOTA 2B63C 4BY1K 3S2HC 1TWCA 3HOWC 4KMAA 2R93K 4Y52K 3CQZC 3VA7A 5C3EK 5IOSA 3RZDC 3TFIA 1XXAA 4WJ3M 1INNA 1SFOA 1O29A 3FOFA 3H3VD 4A93K 2A69A 4Q4ZA 2XCRB 2PMZD 5IOQA 3HOUC 5C44C 5TJ3A 1WOPA 4O2DA 3GEEA 5D4DA 3OEPA 3FKIK 5JVOA 3S1QC 3GTMA 1WQGA 4GTCA 2JA7C 1TWFC 3A8KA 2VUMC 2NVTK 1F9NA 3S15K 1XPPA 3G4CA 4KASA 1TWAA 4A3LK 2P5MA 3NUHA 1WSVA 3I4MK 3GSIA 4Q5SA 4GTBA 4XSXA 4C3HC 1WORA 2E2IA 2GSOA 1TWHC 4QJVA 3GTLA 1O25A 3GTOC 3HOVC 1X31C 1RU0A 1ISEA 3A8IA 2XCQA 3GTQA 2JA6A 1I6VA 3K7AK 2V6TA 1XZPA 4NOIA 4FM9A 3HOYC 1TWCK 1L0WA 4BBRC 3GTJC 1BDFA 4BLBA 4A3KC 3GTGA 5IP9K 5FLMK 3M4OK 4A3MC 4QJVB 4BXXC 3M3YK 1O26A 2R7ZA 1SFOK 2GAHC 2NVXA 4KM8A 1XZPB 4BY7K 4X6AK 4A3JC 1HQMA 2XCOA 1ZQ1C 5EGHA
chains in the Genus database with same CATH topology
5IP7K 2O5JA 3GTMK 1WCMK 1K83K 3H0GK 5C4JK 4G7OA 3S16C 2WB1D 4A3BC 4KMUA 4OIRA 4YG2A 3S14C 1IW7A 1TWAC 3S16K 5M5XK 4A3BK 4QIWL 2Y0SD 2WAQD 2CW0A 3S14K 1TWAK 4BY1C 2NVQC 1ZYRA 2A68A 4Y7NC 2R93C 4Y52C 4C3JK 2B63C 4BY1K 2NVQK 2JA5C 3S2HC 4C3IK 4Y7NK 3HOWC 5C3EC 2E2IC 2R93K 4Y52K 5IYCC 4BBSK 2B63K 3S2HK 3CQZC 2JA5K 5M3FK 3GTLC 3HOWK 5C3EK 2E2IK 2VUMK 4LK1A 5IYCK 5TMCA 3CQZK 4XLNA 4A3IC 2O5IA 4A3GC 3RZDC 3GTQC 2JA6C 4MEXA 4A93C 2E2JC 4KN7A 4A3IK 4A3GK 3RZDK 3GTQK 4A3EC 2JA6K 2A6HA 1R9TC 3H3VD 4A93K 2A69A 2E2JK 4Q4ZA 1YNJA 4LK0A 4A3EK 2PMZD 3HOUC 5M5WK 1R9TK 5C44C 1I3QC 3FKIC 2PA8D 3RZOC 1Y1WC 1Y1VC 3HOUK 5D4DA 3GTGC 5C44K 1I3QK 3FKIK 3RZOK 3S1QC 1Y1WK 1Y1VK 3HKZL 3DXJA 2NVTC 4G7ZA 4BBSC 4AYBL 3GTGK 2JA7C 1TWFC 3S1QK 2VUMC 3S15C 2NVTK 2R7ZC 4A3LC 2JA7K 1TWFK 5C4JC 3PO2C 3I4MC 4OIOA 2NVXC 3S15K 3S17C 4QIWD 1XPPA 2R7ZK 4XSZA 4A3LK 3PO2K 3I4MK 3HOZC 4KN4A 2YU9C 2NVXK 3S17K 4Q5SA 4C2MK 4YFNA 3HKZD 3WODA 3HOZK 2YU9K 4XSXA 2NVYC 4LJZA 3S2DC 1I50C 2NVYK 2A6EA 4C3HK 3S2DK 5C4XK 1TWHC 2WB1L 4QJVA 2PPBA 1TWGC 1I50K 2E2HC 3GTOC 3S1RC 3HOVC 3HOXC 2R92C 5IYBC 3K7AC 1TWHK 1TWGK 2Y0SL 2E2HK 2WAQL 3GTOK 3S1RK 3HOVK 3HOXK 4ZH4A 5IYBK 4A3FK 1I6VA 3K7AK 1SMYA 4NOIA 4G7HA 2R92K 3GTPC 3S1NC 1YNNA 4YFXA 1TWCC 3GTKC 3S1NK 5M5YK 3GTPK 4A3CC 3HOYC 4MQ9A 5TMFA 1TWCK 3GTKK 1I6HC 4BBRC 4A3CK 5IP9C 5FLMC 3GTJC 1BDFA 3HOYK 3M4OC 1I6HK 5IYDC 4A3KC 3I4NC 3M3YC 4BBRK 5IP9K 4AYBD 5FLMK 5M3MK 3GTJK 3M4OK 4A3MC 4QJVB 5C4XC 4A3KK 4OINA 3I4NK 1SFOC 3M3YK 4BXXC 2BE5A 3PO3C 3EQLA 5IYDK 2JA8C 4A3MK 4BY7C 5FJ8K 3H3VL 1SFOK 4BXXK 4X6AC 4MEYA 3PO3K 2JA8K 4A3FC 4GZYA 4BY7K 4YFKA 2PMZL 4OIPA 4X6AK 4A3JC 3S1MC 2PA8L 1HQMA 4A3DC 5IP7C 3GTMC 1WCMC 4LLGA 4A3JK 3GTLK 4JK1A 1K83C 3H0GC 4XLPA 4OIQA 3S1MK 4A3DK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 K;  2O5J A;  3GTM K;  1WCM K;  1K83 K;  3H0G K;  5C4J K;  4G7O A;  3S16 C;  2WB1 D;  4A3B C;  4KMU A;  4OIR A;  4YG2 A;  3S14 C;  1IW7 A;  1TWA C;  3S16 K;  5M5X K;  4A3B K;  4QIW L;  2Y0S D;  2WAQ D;  2CW0 A;  3S14 K;  1TWA K;  4BY1 C;  2NVQ C;  1ZYR A;  2A68 A;  4Y7N C;  2R93 C;  4Y52 C;  4C3J K;  2B63 C;  4BY1 K;  2NVQ K;  2JA5 C;  3S2H C;  4C3I K;  4Y7N K;  3HOW C;  5C3E C;  2E2I C;  2R93 K;  4Y52 K;  5IYC C;  4BBS K;  2B63 K;  3S2H K;  3CQZ C;  2JA5 K;  5M3F K;  3GTL C;  3HOW K;  5C3E K;  2E2I K;  2VUM K;  4LK1 A;  5IYC K;  5TMC A;  3CQZ K;  4XLN A;  4A3I C;  2O5I A;  4A3G C;  3RZD C;  3GTQ C;  2JA6 C;  4MEX A;  4A93 C;  2E2J C;  4KN7 A;  4A3I K;  4A3G K;  3RZD K;  3GTQ K;  4A3E C;  2JA6 K;  2A6H A;  1R9T C;  3H3V D;  4A93 K;  2A69 A;  2E2J K;  4Q4Z A;  1YNJ A;  4LK0 A;  4A3E K;  2PMZ D;  3HOU C;  5M5W K;  1R9T K;  5C44 C;  1I3Q C;  3FKI C;  2PA8 D;  3RZO C;  1Y1W C;  1Y1V C;  3HOU K;  5D4D A;  3GTG C;  5C44 K;  1I3Q K;  3FKI K;  3RZO K;  3S1Q C;  1Y1W K;  1Y1V K;  3HKZ L;  3DXJ A;  2NVT C;  4G7Z A;  4BBS C;  4AYB L;  3GTG K;  2JA7 C;  1TWF C;  3S1Q K;  2VUM C;  3S15 C;  2NVT K;  2R7Z C;  4A3L C;  2JA7 K;  1TWF K;  5C4J C;  3PO2 C;  3I4M C;  4OIO A;  2NVX C;  3S15 K;  3S17 C;  4QIW D;  1XPP A;  2R7Z K;  4XSZ A;  4A3L K;  3PO2 K;  3I4M K;  3HOZ C;  4KN4 A;  2YU9 C;  2NVX K;  3S17 K;  4Q5S A;  4C2M K;  4YFN A;  3HKZ D;  3WOD A;  3HOZ K;  2YU9 K;  4XSX A;  2NVY C;  4LJZ A;  3S2D C;  1I50 C;  2NVY K;  2A6E A;  4C3H K;  3S2D K;  5C4X K;  1TWH C;  2WB1 L;  4QJV A;  2PPB A;  1TWG C;  1I50 K;  2E2H C;  3GTO C;  3S1R C;  3HOV C;  3HOX C;  2R92 C;  5IYB C;  3K7A C;  1TWH K;  1TWG K;  2Y0S L;  2E2H K;  2WAQ L;  3GTO K;  3S1R K;  3HOV K;  3HOX K;  4ZH4 A;  5IYB K;  4A3F K;  1I6V A;  3K7A K;  1SMY A;  4NOI A;  4G7H A;  2R92 K;  3GTP C;  3S1N C;  1YNN A;  4YFX A;  1TWC C;  3GTK C;  3S1N K;  5M5Y K;  3GTP K;  4A3C C;  3HOY C;  4MQ9 A;  5TMF A;  1TWC K;  3GTK K;  1I6H C;  4BBR C;  4A3C K;  5IP9 C;  5FLM C;  3GTJ C;  1BDF A;  3HOY K;  3M4O C;  1I6H K;  5IYD C;  4A3K C;  3I4N C;  3M3Y C;  4BBR K;  5IP9 K;  4AYB D;  5FLM K;  5M3M K;  3GTJ K;  3M4O K;  4A3M C;  4QJV B;  5C4X C;  4A3K K;  4OIN A;  3I4N K;  1SFO C;  3M3Y K;  4BXX C;  2BE5 A;  3PO3 C;  3EQL A;  5IYD K;  2JA8 C;  4A3M K;  4BY7 C;  5FJ8 K;  3H3V L;  1SFO K;  4BXX K;  4X6A C;  4MEY A;  3PO3 K;  2JA8 K;  4A3F C;  4GZY A;  4BY7 K;  4YFK A;  2PMZ L;  4OIP A;  4X6A K;  4A3J C;  3S1M C;  2PA8 L;  1HQM A;  4A3D C;  5IP7 C;  3GTM C;  1WCM C;  4LLG A;  4A3J K;  3GTL K;  4JK1 A;  1K83 C;  3H0G C;  4XLP A;  4OIQ A;  3S1M K;  4A3D K; 
#chains in the Genus database with same CATH topology
 2NVY A;  3N0C A;  1J98 A;  5IP7 K;  3GTM K;  1XZQ A;  1I50 A;  2WB1 D;  1VH2 A;  4YG2 A;  3OPF A;  4P5B A;  1J6V A;  2R92 A;  3G4A A;  1TWA K;  4BY1 C;  2A68 A;  2R93 C;  4Y52 C;  3GTP A;  4C3J K;  2NVQ K;  4WIL A;  5C3E C;  1WOO A;  5M3F K;  2E2I K;  4LK1 A;  5IYC K;  4XLN A;  4GTF A;  1XZQ B;  4C45 A;  4A93 C;  3CAG A;  4KN7 A;  2V6U A;  4A3G K;  5JFE A;  3GTQ K;  2JA6 K;  1VRQ C;  2A6H A;  2E2J K;  1YNJ A;  4A3E K;  5M5W K;  1R9T K;  5E68 A;  3FKI C;  2PA8 D;  4PAB A;  3GEH A;  2ZUE A;  5HL8 A;  5IOR A;  3HKZ L;  4BBS C;  3DXJ A;  4PAA A;  4G7Z A;  2NVT C;  3GTG K;  1PJ7 A;  4KMD A;  3S15 C;  4A3L C;  1IS1 A;  3I4M C;  4QIW D;  2R7Z K;  4XSZ A;  3PO2 K;  4KN4 A;  2NVX K;  4C2M K;  4BKW A;  3HKZ D;  3HOZ K;  4LJZ A;  2JH3 A;  2KWA A;  1IE0 A;  4KB4 A;  1PJ6 A;  4WJ4 A;  1XXB A;  1XXC A;  2NVY K;  2A6E A;  3FHZ A;  3S2D K;  1YX2 A;  3QX3 A;  1I50 K;  3K7A C;  2E2H K;  4GFQ A;  4ZH4 A;  2R92 K;  1B4B A;  4BLA A;  1YNN A;  1TWC C;  1F7U A;  1WIH A;  3GTP K;  1JQW A;  4MQ9 A;  1I3Q A;  3IPJ A;  5IP9 C;  5EGE A;  1V5V A;  5FLM C;  3M4O C;  1Y1W A;  1Y1V A;  3AH5 A;  3M3Y C;  3GEI A;  4KM9 A;  3TFJ A;  1O2B A;  5C4X C;  4KC6 A;  1SFO C;  3I4N K;  1BGW A;  3EQL A;  4BY7 C;  4KAT A;  2FQT A;  4X6A C;  2JA8 K;  4A3F C;  4KMH A;  3AD7 C;  4XCH A;  2YU9 A;  5IP7 C;  3GTM C;  4FZB A;  1J6X A;  4J3N A;  1R9T A;  1YCL A;  2O5J A;  2P8T A;  1ZVU A;  4GTA A;  5C4J K;  1O2F B;  3AQO A;  2ZUF A;  3Q3Q A;  1IW7 A;  1TWA C;  1TWG A;  3S16 K;  4A3B K;  4C3J C;  3SZY A;  2NVQ C;  1ZYR A;  3HXA A;  2GAG C;  3GTK A;  3L4J A;  2E2I C;  2Y3P A;  5IYC C;  1PJ5 A;  3TTG A;  2JA5 K;  3GTL C;  3ERE D;  2VUM K;  1EI6 A;  5TMC A;  4A3G C;  3GTQ C;  2JA6 C;  4AH6 A;  3AQP A;  2E2J C;  2RH6 A;  4A3I K;  4A3E C;  4KAR A;  1R9T C;  1AB4 A;  4LK0 A;  3T02 A;  1IL2 A;  2E2H A;  1GE9 A;  3AD9 C;  3GTG C;  1I3Q K;  3N0B A;  3RZO K;  1HI9 A;  1Y1W K;  1Y1V K;  3H0G A;  1K83 A;  4AYB L;  2RGR A;  2R7Z C;  2FQO A;  3PO2 C;  4OIO A;  1EFW A;  2NVX C;  4C2M C;  3HOZ C;  3BP3 A;  3S17 K;  1JOE A;  4YFN A;  4GTD A;  3BP8 C;  3WOD A;  2YU9 K;  2NVY C;  3S2D C;  1I50 C;  2W7V A;  3CQZ A;  3LAP A;  2E2H C;  2R92 C;  4LQY A;  1C0A A;  1TWG K;  2Y0S L;  1G51 A;  2WAQ L;  3S1R K;  3HOX K;  5IYB K;  2CFA A;  1SMY A;  1O24 A;  3ORE A;  1DCH A;  1ZXO A;  4G7H A;  3GTP C;  4KB2 A;  3ADA C;  3S1N K;  5TMF A;  3GTK K;  4LR2 A;  4M1X A;  4A3C K;  1I6H K;  3I4N C;  3GIR A;  4KDD A;  5IYD K;  2JA5 A;  2BE5 A;  2JA7 A;  4GT9 A;  2JA8 C;  1USO A;  2VUM A;  3H3V L;  4MEY A;  3PO3 K;  2CFA B;  4YFK A;  2PMZ L;  1BS2 A;  1WOS A;  4DDQ A;  3SZZ A;  3S1M K;  4JK1 A;  4OIQ A;  5C4J C;  4XLP A;  1EK8 A;  1USM A;  1UV7 A;  4A3D K;  1WCM K;  1K83 K;  3H0G K;  3S16 C;  4A3B C;  1BJT A;  1VGX A;  4OIR A;  1TWH A;  3GTO A;  1EQR A;  2CW0 A;  3S14 K;  3N3Y A;  4GTL A;  2JA5 C;  4C3I K;  4Y7N K;  1WQF A;  4BBS K;  2B63 K;  3S2H K;  4LOW A;  1B4A A;  3HOW K;  3LAJ A;  3GTJ A;  3CQZ K;  4A3I C;  2O5I A;  4G0V A;  4MEX A;  1F7V A;  3V4G A;  3BUE A;  3RZD K;  1DD5 A;  1I3Q C;  2ZFZ A;  3RZO C;  1Y1W C;  1Y1V C;  2D6F C;  3HOU K;  1DCO A;  5C44 K;  3S0X A;  2V6S A;  4P5A A;  4G0W A;  1WSR A;  3S1Q K;  4G0U A;  2JA7 K;  1TWF K;  3S17 C;  4KAW X;  1JVI A;  4RMF A;  3L4K A;  5L46 A;  2YU9 C;  1IQ0 A;  1O28 A;  3FOE A;  1KQ4 A;  2R93 A;  1O2A A;  4C3H K;  5C4X K;  2WB1 L;  1ZBS A;  2PPB A;  1TWG C;  3S1R C;  3HOX C;  5IYB C;  1TWH K;  1WCM A;  4P9S A;  1EH1 A;  3GTO K;  3HOV K;  4A3F K;  3T01 A;  3S1N C;  3LPX A;  4YFX A;  3GTK C;  1VLO A;  5M5Y K;  4A3C C;  1I6H C;  1IBA A;  3TFH A;  3FKI A;  3HOY K;  1O27 A;  4GTE A;  3A8J A;  5CJ9 A;  5IYD C;  1WQH A;  3GDZ A;  4BBR K;  4AYB D;  3GTJ K;  5M3M K;  2EBB A;  3T00 A;  2B63 A;  4A3K K;  4OIN A;  3PO3 C;  3AD8 C;  4A3M K;  5FJ8 K;  4BXX K;  1F93 A;  1J6W A;  4GZY A;  4OIP A;  3S1M C;  2PA8 L;  4A3D C;  3JST A;  1WCM C;  4LLG A;  5CHP A;  4A3J K;  3GTL K;  1K83 C;  3H0G C;  2GSN A;  4G7O A;  4ILD A;  2PHC B;  1VJE A;  4KMU A;  3MML B;  3S14 C;  5M5X K;  1DCP A;  4QIW L;  2GSU A;  2Y0S D;  2WAQ D;  4C3I C;  4Y7N C;  1TWF A;  5IOT A;  2B63 C;  4BY1 K;  3S2H C;  1TWC A;  3HOW C;  4KMA A;  2R93 K;  4Y52 K;  3CQZ C;  3VA7 A;  5C3E K;  5IOS A;  3RZD C;  3TFI A;  1XXA A;  4WJ3 M;  1INN A;  1SFO A;  1O29 A;  3FOF A;  3H3V D;  4A93 K;  2A69 A;  4Q4Z A;  2XCR B;  2PMZ D;  5IOQ A;  3HOU C;  5C44 C;  5TJ3 A;  1WOP A;  4O2D A;  3GEE A;  5D4D A;  3OEP A;  3FKI K;  5JVO A;  3S1Q C;  3GTM A;  1WQG A;  4GTC A;  2JA7 C;  1TWF C;  3A8K A;  2VUM C;  2NVT K;  1F9N A;  3S15 K;  1XPP A;  3G4C A;  4KAS A;  1TWA A;  4A3L K;  2P5M A;  3NUH A;  1WSV A;  3I4M K;  3GSI A;  4Q5S A;  4GTB A;  4XSX A;  4C3H C;  1WOR A;  2E2I A;  2GSO A;  1TWH C;  4QJV A;  3GTL A;  1O25 A;  3GTO C;  3HOV C;  1X31 C;  1RU0 A;  1ISE A;  3A8I A;  2XCQ A;  3GTQ A;  2JA6 A;  1I6V A;  3K7A K;  2V6T A;  1XZP A;  4NOI A;  4FM9 A;  3HOY C;  1TWC K;  1L0W A;  4BBR C;  3GTJ C;  1BDF A;  4BLB A;  4A3K C;  3GTG A;  5IP9 K;  5FLM K;  3M4O K;  4A3M C;  4QJV B;  4BXX C;  3M3Y K;  1O26 A;  2R7Z A;  1SFO K;  2GAH C;  2NVX A;  4KM8 A;  1XZP B;  4BY7 K;  4X6A K;  4A3J C;  1HQM A;  2XCO A;  1ZQ1 C;  5EGH A; 
#chains in the Genus database with same CATH homology
 5IP7 K;  2O5J A;  3GTM K;  1WCM K;  1K83 K;  3H0G K;  5C4J K;  4G7O A;  3S16 C;  2WB1 D;  4A3B C;  4KMU A;  4OIR A;  4YG2 A;  3S14 C;  1IW7 A;  1TWA C;  3S16 K;  5M5X K;  4A3B K;  4QIW L;  2Y0S D;  2WAQ D;  2CW0 A;  3S14 K;  1TWA K;  4BY1 C;  2NVQ C;  1ZYR A;  2A68 A;  4Y7N C;  2R93 C;  4Y52 C;  4C3J K;  2B63 C;  4BY1 K;  2NVQ K;  2JA5 C;  3S2H C;  4C3I K;  4Y7N K;  3HOW C;  5C3E C;  2E2I C;  2R93 K;  4Y52 K;  5IYC C;  4BBS K;  2B63 K;  3S2H K;  3CQZ C;  2JA5 K;  5M3F K;  3GTL C;  3HOW K;  5C3E K;  2E2I K;  2VUM K;  4LK1 A;  5IYC K;  5TMC A;  3CQZ K;  4XLN A;  4A3I C;  2O5I A;  4A3G C;  3RZD C;  3GTQ C;  2JA6 C;  4MEX A;  4A93 C;  2E2J C;  4KN7 A;  4A3I K;  4A3G K;  3RZD K;  3GTQ K;  4A3E C;  2JA6 K;  2A6H A;  1R9T C;  3H3V D;  4A93 K;  2A69 A;  2E2J K;  4Q4Z A;  1YNJ A;  4LK0 A;  4A3E K;  2PMZ D;  3HOU C;  5M5W K;  1R9T K;  5C44 C;  1I3Q C;  3FKI C;  2PA8 D;  3RZO C;  1Y1W C;  1Y1V C;  3HOU K;  5D4D A;  3GTG C;  5C44 K;  1I3Q K;  3FKI K;  3RZO K;  3S1Q C;  1Y1W K;  1Y1V K;  3HKZ L;  3DXJ A;  2NVT C;  4G7Z A;  4BBS C;  4AYB L;  3GTG K;  2JA7 C;  1TWF C;  3S1Q K;  2VUM C;  3S15 C;  2NVT K;  2R7Z C;  4A3L C;  2JA7 K;  1TWF K;  5C4J C;  3PO2 C;  3I4M C;  4OIO A;  2NVX C;  3S15 K;  3S17 C;  4QIW D;  1XPP A;  2R7Z K;  4XSZ A;  4A3L K;  3PO2 K;  3I4M K;  3HOZ C;  4KN4 A;  2YU9 C;  2NVX K;  3S17 K;  4Q5S A;  4C2M K;  4YFN A;  3HKZ D;  3WOD A;  3HOZ K;  2YU9 K;  4XSX A;  2NVY C;  4LJZ A;  3S2D C;  1I50 C;  2NVY K;  2A6E A;  4C3H K;  3S2D K;  5C4X K;  1TWH C;  2WB1 L;  4QJV A;  2PPB A;  1TWG C;  1I50 K;  2E2H C;  3GTO C;  3S1R C;  3HOV C;  3HOX C;  2R92 C;  5IYB C;  3K7A C;  1TWH K;  1TWG K;  2Y0S L;  2E2H K;  2WAQ L;  3GTO K;  3S1R K;  3HOV K;  3HOX K;  4ZH4 A;  5IYB K;  4A3F K;  1I6V A;  3K7A K;  1SMY A;  4NOI A;  4G7H A;  2R92 K;  3GTP C;  3S1N C;  1YNN A;  4YFX A;  1TWC C;  3GTK C;  3S1N K;  5M5Y K;  3GTP K;  4A3C C;  3HOY C;  4MQ9 A;  5TMF A;  1TWC K;  3GTK K;  1I6H C;  4BBR C;  4A3C K;  5IP9 C;  5FLM C;  3GTJ C;  1BDF A;  3HOY K;  3M4O C;  1I6H K;  5IYD C;  4A3K C;  3I4N C;  3M3Y C;  4BBR K;  5IP9 K;  4AYB D;  5FLM K;  5M3M K;  3GTJ K;  3M4O K;  4A3M C;  4QJV B;  5C4X C;  4A3K K;  4OIN A;  3I4N K;  1SFO C;  3M3Y K;  4BXX C;  2BE5 A;  3PO3 C;  3EQL A;  5IYD K;  2JA8 C;  4A3M K;  4BY7 C;  5FJ8 K;  3H3V L;  1SFO K;  4BXX K;  4X6A C;  4MEY A;  3PO3 K;  2JA8 K;  4A3F C;  4GZY A;  4BY7 K;  4YFK A;  2PMZ L;  4OIP A;  4X6A K;  4A3J C;  3S1M C;  2PA8 L;  1HQM A;  4A3D C;  5IP7 C;  3GTM C;  1WCM C;  4LLG A;  4A3J K;  3GTL K;  4JK1 A;  1K83 C;  3H0G C;  4XLP A;  4OIQ A;  3S1M K;  4A3D K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...