3I4MK

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4mK00
5IP7C 3S2HC 3HOXC 3HOVC 4GZYA 1IW7A 2Y0SD 4YFNA 5IYBK 4Y7NC 4A3MK 4KN4A 3S1RC 3S14C 4BBRC 1I6HK 3HKZL 4ZH4A 4X6AK 4A3IK 3GTLC 5M3FK 4BY7C 5IYCC 2YU9K 1YNNA 2A6EA 2E2HK 2WB1L 2R92C 4A3IC 1WCMC 3HOZC 4A3BK 3H3VL 2A69A 3GTMK 3GTJC 1Y1WC 5C4JC 2VUMK 1YNJA 3H0GK 4AYBD 4A3BC 5C4XK 3S15C 4YFKA 4Q5SA 5TMFA 2E2IK 3S16C 3H0GC 5C4XC 1XPPA 4A3DC 1HQMA 4A93K 2JA6C 4OIRA 3M3YK 1TWFC 2BE5A 4A3EK 1Y1VC 4A93C 3GTGK 3M3YC 2JA7K 3GTQC 3PO3K 2E2JK 4LK1A 4BBSK 2JA8K 1ZYRA 3RZOK 4A3CC 3GTGC 3I4NK 1TWCC 4YFXA 2NVXK 3PO2K 3PO3C 2E2JC 4BBSC 4QJVB 2JA8C 2PMZD 5IYBC 3FKIK 5FJ8K 4XSXA 5D4DA 4MEXA 4KN7A 3CQZK 4A3MC 2NVXC 3S1NK 3I4NC 2R93K 4A3LK 2WB1D 4QJVA 2JA5K 2PPBA 5C44K 3CQZC 4OIQA 4OINA 3S1NC 4A3FK 1I6HC 3S1QK 4X6AC 4OIOA 4C3JK 2JA5C 4QIWL 3HOWK 5C44C 2B63K 2YU9C 2A6HA 2NVYK 2E2HC 4A3JK 3M4OK 3GTMC 2NVYC 2VUMC 3S17K 3K7AK 1SFOK 4A3JC 2PA8L 4MEYA 3DXJA 3I4MK 2E2IC 3S17C 1K83K 5TMCA 2Y0SL 3RZOC 2O5JA 1K83C 5FLMK 4XLPA 4A3EC 1R9TK 2NVQK 1TWHK 2JA7C 3HOYK 5FLMC 3HKZD 2NVQC 1TWGK 4MQ9A 1TWAK 5IP9K 1I50K 5M3MK 3PO2C 3GTOK 5IYDK 4XLNA 4G7ZA 1TWGC 3S2DK 3FKIC 4NOIA 4A3GK 4YG2A 3HOUK 1TWAC 3H3VD 2R93C 3GTOC 4A3LC 2WAQL 4OIPA 1I6VA 5M5YK 3RZDK 4AYBL 4A3GC 4A3KK 4A3FC 2CW0A 3S1QC 4G7OA 3S1MK 5M5XK 3HOWC 5IP7K 4Q4ZA 4A3KC 2A68A 2B63C 3HOVK 4BY1K 3S1MC 4Y52K 4Y7NK 4BXXK 3M4OC 3S1RK 3S14K 1SMYA 4BY1C 4C3IK 3K7AC 4Y52C 1SFOC 4BBRK 4BXXC 4XSZA 3GTPK 3I4MC 3GTLK 4JK1A 4BY7K 5IYCK 2R92K 3EQLA 3GTPC 1I3QK 2PMZL 3HOZK 1WCMK 4LLGA 1R9TC 2R7ZK 4LK0A 3GTJK 1I3QC 1Y1WK 5C4JK 1TWHC 3HOYC 3S15K 2R7ZC 1BDFA 4C2MK 5M5WK 2O5IA 2WAQD 4KMUA 4QIWD 5IP9C 1I50C 2NVTK 5IYDC 4G7HA 3S16K 4A3DK 3GTKK 3S2DC 2JA6K 5C3EK 3HOUC 3WODA 1TWFK 4C3HK 2NVTC 1Y1VK 3GTKC 3RZDC 5C3EC 4LJZA 3S2HK 3GTQK 2PA8D 3HOXK 4A3CK 1TWCK
chains in the Genus database with same CATH superfamily
5IP7C 3S2HC 3GSIA 2Y0SD 1O24A 3S14C 3LPXA 3HKZL 4GTFA 5M3FK 1PJ6A 4BY7C 4KB2A 1J6XA 3HOZC 2WB1L 1G51A 2A69A 3GDZA 2XCOA 1Y1WC 3V4GA 1YNJA 4A3BC 4GTCA 2E2IK 3CAGA 5C4XC 5IOTA 1O2FB 2JA6C 1TWFC 3GTQA 5IOQA 4KC6A 2XCRB 1ZQ1C 1TWCA 4LK1A 4A3CC 3GTGC 4YFXA 2JA8C 3BUEA 3FKIK 3GTLA 4MEXA 4PABA 2NVXC 2R93K 4A3LK 2WB1D 1XZPB 2Y3PA 4OIQA 2YU9A 4QIWL 2A6HA 4A3JK 3S17K 1IS1A 2PA8L 4RMFA 3DXJA 4GTBA 2E2IC 1ZBSA 1K83K 2FQTA 2JH3A 2NVQK 1O25A 4BKWA 3HOYK 3CQZA 4G0UA 4XLNA 4G7ZA 1TWGC 1J6VA 3FKIC 4NOIA 2GSOA 2R93C 5L46A 2GAGC 4A3LC 2WAQL 4OIPA 5M5YK 3FHZA 3RZDK 4AYBL 3BP8C 1X31C 4A3KK 2B63A 5JFEA 2VUMA 5M5XK 5HL8A 3L4KA 4BY1C 5IORA 4C3IK 4BXXC 1VH2A 4KDDA 1F7VA 3GTLK 1O26A 1J6WA 5EGHA 5IYCK 1WQGA 1WCMK 3AD9C 2R7ZK 3AQPA 5C4JK 4KASA 3HOYC 3GTOA 1BDFA 1USMA 3VA7A 2O5IA 2WAQD 3S16K 1WQHA 1EI6A 3RZDC 3S2HK 4GTDA 3FOFA 3GIRA 1IQ0A 5JVOA 4GZYA 3TTGA 4A3MK 3A8KA 4LOWA 3GTPA 3Q3QA 1B4AA 3TFHA 1O27A 1L0WA 1IE0A 4X6AK 3GTLC 3OREA 1TWHA 5IYCC 1EK8A 3GTJA 1WCMC 4A3BK 1WSRA 1XZPA 2FQOA 3OPFA 1KQ4A 5C4JC 2VUMK 5C4XK 1O2BA 4YFKA 4Q5SA 5TMFA 1WORA 4BLAA 3S16C 1HQMA 1Y1VA 4AH6A 4ILDA 3GTGK 1IL2A 2V6SA 2JA8K 1ZYRA 1INNA 2NVXK 1JQWA 2CFAB 4QJVB 2PMZD 4O2DA 4KN7A 4A3MC 2ZUEA 2PPBA 3CQZC 4GTAA 2RGRA 1F7UA 3S1QK 2E2HA 4X6AC 4WJ4A 4GTEA 3H0GA 1JVIA 2VUMC 1SFOK 4XCHA 2ZFZA 1F93A 4XLPA 2ZUFA 1TWHK 3HKZD 1JOEA 1TWGK 4KMHA 5M3MK 5IYDK 1F9NA 3S2DK 2JA5A 3HOUK 3SZYA 3GTOC 1EFWA 4A3GC 4KM8A 2CW0A 3S1QC 2NVYA 3N0BA 1B4BA 4Q4ZA 4BY1K 5CHPA 4Y7NK 3TFJA 3LAPA 4BXXK 1SFOC 2W7VA 4BBRK 1YCLA 1VLOA 2JA7A 3GTPC 2D6FC 4LK0A 4KMDA 2EBBA 1TWHC 1TWAA 2V6TA 1I50A 4C2MK 4QIWD 5IYDC 3S2DC 3HOUC 4C3HK 2NVTC 1WQFA 1WOSA 5C3EC 3GTQK 2PA8D 3IPJA 1TWCK 4BLBA 1IW7A 4Y7NC 4FM9A 4KN4A 4M1XA 1EQRA 2P8TA 4BBRC 1R9TA 3T02A 4ZH4A 1I3QA 2CFAA 4G0WA 2YU9K 1YNNA 2A6EA 4A3IC 3H3VL 1DCHA 1XZQB 4AYBD 4C2MC 3GTKA 2JA6A 1VJEA 3H0GC 4C3HC 4A3EK 4A93C 3M3YC 2JA7K 3GTQC 3JSTA 1TWCC 3PO3C 2E2JC 4BBSC 3RZOC 3A8IA 4XSXA 3I4NC 3CQZK 2R92A 4OINA 3S1NC 4A3FK 4OIOA 2JA5C 3G4AA 5C44C 4WILA 2YU9C 2B63K 4C3JC 3M4OK 1YX2A 2NVYC 3K7AK 1VRQC 4MEYA 4KATA 1BJTA 3N0CA 2Y0SL 3NUHA 4WJ3M 4A3EC 1R9TK 2JA7C 5FLMC 4KMAA 4MQ9A 2R93A 4G0VA 3GTOK 3GEIA 4A3GK 4YG2A 1TWAC 4FZBA 3GTMA 4A3FC 1O2AA 1ZVUA 2B63C 2A68A 3HOVK 3S1MC 2KWAA 3M4OC 1PJ5A 1DCPA 3S1RK 1SMYA 4PAAA 3K7AC 4Y52C 1K83A 3GTPK 1XXAA 4JK1A 1V5VA 2R92K 4LLGA 1R9TC 3GTJK 3S0XA 1I3QC 3S15K 3AD8C 3SZZA 4KMUA 3AQOA 1RU0A 2NVTK 3G4CA 3FOEA 1C0AA 4A3DK 5C3EK 1XXCA 2GSUA 1XZQA 1Y1VK 3GTKC 3A8JA 4LJZA 3HOXC 3HOVC 1WOPA 5IYBK 4YFNA 3S1RC 4P5AA 4GFQA 1UV7A 1I6HK 1WSVA 1XXBA 4A3IK 1WCMA 3QX3A 1O29A 2R92C 2R7ZA 1DCOA 4GTLA 2E2HK 3GTMK 3GTJC 3H0GK 3S15C 2XCQA 1XPPA 4A3DC 4A93K 5EGEA 5CJ9A 4OIRA 3M3YK 3T00A 2BE5A 3HXAA 1PJ7A 1EH1A 1Y1VC 3ADAC 5IOSA 3PO3K 2E2JK 4BBSK 3RZOK 3I4NK 3L4JA 3PO2K 5FJ8K 5IYBC 5D4DA 3BP3A 1J98A 4LR2A 3S1NK 1DD5A 4QJVA 2JA5K 2P5MA 1ZXOA 4KAWX 5C44K 4LQYA 1I6HC 3ERED 4C45A 4C3JK 1Y1WA 3HOWK 1O28A 1GE9A 2NVYK 2V6UA 1HI9A 2E2HC 1BGWA 4KB4A 3GTMC 4P5BA 1TWFA 4A3JC 3I4MK 4GT9A 3MMLB 3S17C 1BS2A 4DDQA 5TMCA 1WIHA 3GTGA 3AD7C 2O5JA 1K83C 5FLMK 3TFIA 3LAJA 4J3NA 2NVXA 2NVQC 4P9SA 1AB4A 1TWAK 1I50K 5IP9K 3PO2C 3GEEA 3AH5A 3H3VD 2PHCB 1I6VA 4G7OA 3S1MK 3HOWC 5IP7K 4A3KC 3GEHA 2E2IA 4Y52K 1SFOA 5TJ3A 2GSNA 3S14K 1WOOA 2GAHC 4XSZA 3I4MC 1IBAA 2RH6A 4C3IC 4BY7K 1VGXA 4KARA 3EQLA 3HOZK 1I3QK 2PMZL 5E68A 1TWGA 3T01A 3FKIA 1Y1WK 4KM9A 2R7ZC 5M5WK 5IP9C 1I50C 4G7HA 3GTKK 2JA6K 3WODA 1TWFK 3OEPA 3HOXK 1ISEA 3N3YA 4A3CK 1USOA
chains in the Genus database with same CATH topology
5IP7C 3S2HC 3HOXC 3HOVC 4GZYA 1IW7A 2Y0SD 4YFNA 5IYBK 4Y7NC 4A3MK 4KN4A 3S1RC 3S14C 4BBRC 1I6HK 3HKZL 4ZH4A 4X6AK 4A3IK 3GTLC 5M3FK 4BY7C 5IYCC 2YU9K 1YNNA 2A6EA 2E2HK 2WB1L 2R92C 4A3IC 1WCMC 3HOZC 4A3BK 3H3VL 2A69A 3GTMK 3GTJC 1Y1WC 5C4JC 2VUMK 1YNJA 3H0GK 4AYBD 4A3BC 5C4XK 3S15C 4YFKA 4Q5SA 5TMFA 2E2IK 3S16C 3H0GC 5C4XC 1XPPA 4A3DC 1HQMA 4A93K 2JA6C 4OIRA 3M3YK 1TWFC 2BE5A 4A3EK 1Y1VC 4A93C 3GTGK 3M3YC 2JA7K 3GTQC 3PO3K 2E2JK 4LK1A 4BBSK 2JA8K 1ZYRA 3RZOK 4A3CC 3GTGC 3I4NK 1TWCC 4YFXA 2NVXK 3PO2K 3PO3C 2E2JC 4BBSC 4QJVB 2JA8C 2PMZD 5IYBC 3FKIK 5FJ8K 4XSXA 5D4DA 4MEXA 4KN7A 3CQZK 4A3MC 2NVXC 3S1NK 3I4NC 2R93K 4A3LK 2WB1D 4QJVA 2JA5K 2PPBA 5C44K 3CQZC 4OIQA 4OINA 3S1NC 4A3FK 1I6HC 3S1QK 4X6AC 4OIOA 4C3JK 2JA5C 4QIWL 3HOWK 5C44C 2B63K 2YU9C 2A6HA 2NVYK 2E2HC 4A3JK 3M4OK 3GTMC 2NVYC 2VUMC 3S17K 3K7AK 1SFOK 4A3JC 2PA8L 4MEYA 3DXJA 3I4MK 2E2IC 3S17C 1K83K 5TMCA 2Y0SL 3RZOC 2O5JA 1K83C 5FLMK 4XLPA 4A3EC 1R9TK 2NVQK 1TWHK 2JA7C 3HOYK 5FLMC 3HKZD 2NVQC 1TWGK 4MQ9A 1TWAK 5IP9K 1I50K 5M3MK 3PO2C 3GTOK 5IYDK 4XLNA 4G7ZA 1TWGC 3S2DK 3FKIC 4NOIA 4A3GK 4YG2A 3HOUK 1TWAC 3H3VD 2R93C 3GTOC 4A3LC 2WAQL 4OIPA 1I6VA 5M5YK 3RZDK 4AYBL 4A3GC 4A3KK 4A3FC 2CW0A 3S1QC 4G7OA 3S1MK 5M5XK 3HOWC 5IP7K 4Q4ZA 4A3KC 2A68A 2B63C 3HOVK 4BY1K 3S1MC 4Y52K 4Y7NK 4BXXK 3M4OC 3S1RK 3S14K 1SMYA 4BY1C 4C3IK 3K7AC 4Y52C 1SFOC 4BBRK 4BXXC 4XSZA 3GTPK 3I4MC 3GTLK 4JK1A 4BY7K 5IYCK 2R92K 3EQLA 3GTPC 1I3QK 2PMZL 3HOZK 1WCMK 4LLGA 1R9TC 2R7ZK 4LK0A 3GTJK 1I3QC 1Y1WK 5C4JK 1TWHC 3HOYC 3S15K 2R7ZC 1BDFA 4C2MK 5M5WK 2O5IA 2WAQD 4KMUA 4QIWD 5IP9C 1I50C 2NVTK 5IYDC 4G7HA 3S16K 4A3DK 3GTKK 3S2DC 2JA6K 5C3EK 3HOUC 3WODA 1TWFK 4C3HK 2NVTC 1Y1VK 3GTKC 3RZDC 5C3EC 4LJZA 3S2HK 3GTQK 2PA8D 3HOXK 4A3CK 1TWCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 C;  3S2H C;  3HOX C;  3HOV C;  4GZY A;  1IW7 A;  2Y0S D;  4YFN A;  5IYB K;  4Y7N C;  4A3M K;  4KN4 A;  3S1R C;  3S14 C;  4BBR C;  1I6H K;  3HKZ L;  4ZH4 A;  4X6A K;  4A3I K;  3GTL C;  5M3F K;  4BY7 C;  5IYC C;  2YU9 K;  1YNN A;  2A6E A;  2E2H K;  2WB1 L;  2R92 C;  4A3I C;  1WCM C;  3HOZ C;  4A3B K;  3H3V L;  2A69 A;  3GTM K;  3GTJ C;  1Y1W C;  5C4J C;  2VUM K;  1YNJ A;  3H0G K;  4AYB D;  4A3B C;  5C4X K;  3S15 C;  4YFK A;  4Q5S A;  5TMF A;  2E2I K;  3S16 C;  3H0G C;  5C4X C;  1XPP A;  4A3D C;  1HQM A;  4A93 K;  2JA6 C;  4OIR A;  3M3Y K;  1TWF C;  2BE5 A;  4A3E K;  1Y1V C;  4A93 C;  3GTG K;  3M3Y C;  2JA7 K;  3GTQ C;  3PO3 K;  2E2J K;  4LK1 A;  4BBS K;  2JA8 K;  1ZYR A;  3RZO K;  4A3C C;  3GTG C;  3I4N K;  1TWC C;  4YFX A;  2NVX K;  3PO2 K;  3PO3 C;  2E2J C;  4BBS C;  4QJV B;  2JA8 C;  2PMZ D;  5IYB C;  3FKI K;  5FJ8 K;  4XSX A;  5D4D A;  4MEX A;  4KN7 A;  3CQZ K;  4A3M C;  2NVX C;  3S1N K;  3I4N C;  2R93 K;  4A3L K;  2WB1 D;  4QJV A;  2JA5 K;  2PPB A;  5C44 K;  3CQZ C;  4OIQ A;  4OIN A;  3S1N C;  4A3F K;  1I6H C;  3S1Q K;  4X6A C;  4OIO A;  4C3J K;  2JA5 C;  4QIW L;  3HOW K;  5C44 C;  2B63 K;  2YU9 C;  2A6H A;  2NVY K;  2E2H C;  4A3J K;  3M4O K;  3GTM C;  2NVY C;  2VUM C;  3S17 K;  3K7A K;  1SFO K;  4A3J C;  2PA8 L;  4MEY A;  3DXJ A;  3I4M K;  2E2I C;  3S17 C;  1K83 K;  5TMC A;  2Y0S L;  3RZO C;  2O5J A;  1K83 C;  5FLM K;  4XLP A;  4A3E C;  1R9T K;  2NVQ K;  1TWH K;  2JA7 C;  3HOY K;  5FLM C;  3HKZ D;  2NVQ C;  1TWG K;  4MQ9 A;  1TWA K;  5IP9 K;  1I50 K;  5M3M K;  3PO2 C;  3GTO K;  5IYD K;  4XLN A;  4G7Z A;  1TWG C;  3S2D K;  3FKI C;  4NOI A;  4A3G K;  4YG2 A;  3HOU K;  1TWA C;  3H3V D;  2R93 C;  3GTO C;  4A3L C;  2WAQ L;  4OIP A;  1I6V A;  5M5Y K;  3RZD K;  4AYB L;  4A3G C;  4A3K K;  4A3F C;  2CW0 A;  3S1Q C;  4G7O A;  3S1M K;  5M5X K;  3HOW C;  5IP7 K;  4Q4Z A;  4A3K C;  2A68 A;  2B63 C;  3HOV K;  4BY1 K;  3S1M C;  4Y52 K;  4Y7N K;  4BXX K;  3M4O C;  3S1R K;  3S14 K;  1SMY A;  4BY1 C;  4C3I K;  3K7A C;  4Y52 C;  1SFO C;  4BBR K;  4BXX C;  4XSZ A;  3GTP K;  3I4M C;  3GTL K;  4JK1 A;  4BY7 K;  5IYC K;  2R92 K;  3EQL A;  3GTP C;  1I3Q K;  2PMZ L;  3HOZ K;  1WCM K;  4LLG A;  1R9T C;  2R7Z K;  4LK0 A;  3GTJ K;  1I3Q C;  1Y1W K;  5C4J K;  1TWH C;  3HOY C;  3S15 K;  2R7Z C;  1BDF A;  4C2M K;  5M5W K;  2O5I A;  2WAQ D;  4KMU A;  4QIW D;  5IP9 C;  1I50 C;  2NVT K;  5IYD C;  4G7H A;  3S16 K;  4A3D K;  3GTK K;  3S2D C;  2JA6 K;  5C3E K;  3HOU C;  3WOD A;  1TWF K;  4C3H K;  2NVT C;  1Y1V K;  3GTK C;  3RZD C;  5C3E C;  4LJZ A;  3S2H K;  3GTQ K;  2PA8 D;  3HOX K;  4A3C K;  1TWC K; 
#chains in the Genus database with same CATH topology
 5IP7 C;  3S2H C;  3GSI A;  2Y0S D;  1O24 A;  3S14 C;  3LPX A;  3HKZ L;  4GTF A;  5M3F K;  1PJ6 A;  4BY7 C;  4KB2 A;  1J6X A;  3HOZ C;  2WB1 L;  1G51 A;  2A69 A;  3GDZ A;  2XCO A;  1Y1W C;  3V4G A;  1YNJ A;  4A3B C;  4GTC A;  2E2I K;  3CAG A;  5C4X C;  5IOT A;  1O2F B;  2JA6 C;  1TWF C;  3GTQ A;  5IOQ A;  4KC6 A;  2XCR B;  1ZQ1 C;  1TWC A;  4LK1 A;  4A3C C;  3GTG C;  4YFX A;  2JA8 C;  3BUE A;  3FKI K;  3GTL A;  4MEX A;  4PAB A;  2NVX C;  2R93 K;  4A3L K;  2WB1 D;  1XZP B;  2Y3P A;  4OIQ A;  2YU9 A;  4QIW L;  2A6H A;  4A3J K;  3S17 K;  1IS1 A;  2PA8 L;  4RMF A;  3DXJ A;  4GTB A;  2E2I C;  1ZBS A;  1K83 K;  2FQT A;  2JH3 A;  2NVQ K;  1O25 A;  4BKW A;  3HOY K;  3CQZ A;  4G0U A;  4XLN A;  4G7Z A;  1TWG C;  1J6V A;  3FKI C;  4NOI A;  2GSO A;  2R93 C;  5L46 A;  2GAG C;  4A3L C;  2WAQ L;  4OIP A;  5M5Y K;  3FHZ A;  3RZD K;  4AYB L;  3BP8 C;  1X31 C;  4A3K K;  2B63 A;  5JFE A;  2VUM A;  5M5X K;  5HL8 A;  3L4K A;  4BY1 C;  5IOR A;  4C3I K;  4BXX C;  1VH2 A;  4KDD A;  1F7V A;  3GTL K;  1O26 A;  1J6W A;  5EGH A;  5IYC K;  1WQG A;  1WCM K;  3AD9 C;  2R7Z K;  3AQP A;  5C4J K;  4KAS A;  3HOY C;  3GTO A;  1BDF A;  1USM A;  3VA7 A;  2O5I A;  2WAQ D;  3S16 K;  1WQH A;  1EI6 A;  3RZD C;  3S2H K;  4GTD A;  3FOF A;  3GIR A;  1IQ0 A;  5JVO A;  4GZY A;  3TTG A;  4A3M K;  3A8K A;  4LOW A;  3GTP A;  3Q3Q A;  1B4A A;  3TFH A;  1O27 A;  1L0W A;  1IE0 A;  4X6A K;  3GTL C;  3ORE A;  1TWH A;  5IYC C;  1EK8 A;  3GTJ A;  1WCM C;  4A3B K;  1WSR A;  1XZP A;  2FQO A;  3OPF A;  1KQ4 A;  5C4J C;  2VUM K;  5C4X K;  1O2B A;  4YFK A;  4Q5S A;  5TMF A;  1WOR A;  4BLA A;  3S16 C;  1HQM A;  1Y1V A;  4AH6 A;  4ILD A;  3GTG K;  1IL2 A;  2V6S A;  2JA8 K;  1ZYR A;  1INN A;  2NVX K;  1JQW A;  2CFA B;  4QJV B;  2PMZ D;  4O2D A;  4KN7 A;  4A3M C;  2ZUE A;  2PPB A;  3CQZ C;  4GTA A;  2RGR A;  1F7U A;  3S1Q K;  2E2H A;  4X6A C;  4WJ4 A;  4GTE A;  3H0G A;  1JVI A;  2VUM C;  1SFO K;  4XCH A;  2ZFZ A;  1F93 A;  4XLP A;  2ZUF A;  1TWH K;  3HKZ D;  1JOE A;  1TWG K;  4KMH A;  5M3M K;  5IYD K;  1F9N A;  3S2D K;  2JA5 A;  3HOU K;  3SZY A;  3GTO C;  1EFW A;  4A3G C;  4KM8 A;  2CW0 A;  3S1Q C;  2NVY A;  3N0B A;  1B4B A;  4Q4Z A;  4BY1 K;  5CHP A;  4Y7N K;  3TFJ A;  3LAP A;  4BXX K;  1SFO C;  2W7V A;  4BBR K;  1YCL A;  1VLO A;  2JA7 A;  3GTP C;  2D6F C;  4LK0 A;  4KMD A;  2EBB A;  1TWH C;  1TWA A;  2V6T A;  1I50 A;  4C2M K;  4QIW D;  5IYD C;  3S2D C;  3HOU C;  4C3H K;  2NVT C;  1WQF A;  1WOS A;  5C3E C;  3GTQ K;  2PA8 D;  3IPJ A;  1TWC K;  4BLB A;  1IW7 A;  4Y7N C;  4FM9 A;  4KN4 A;  4M1X A;  1EQR A;  2P8T A;  4BBR C;  1R9T A;  3T02 A;  4ZH4 A;  1I3Q A;  2CFA A;  4G0W A;  2YU9 K;  1YNN A;  2A6E A;  4A3I C;  3H3V L;  1DCH A;  1XZQ B;  4AYB D;  4C2M C;  3GTK A;  2JA6 A;  1VJE A;  3H0G C;  4C3H C;  4A3E K;  4A93 C;  3M3Y C;  2JA7 K;  3GTQ C;  3JST A;  1TWC C;  3PO3 C;  2E2J C;  4BBS C;  3RZO C;  3A8I A;  4XSX A;  3I4N C;  3CQZ K;  2R92 A;  4OIN A;  3S1N C;  4A3F K;  4OIO A;  2JA5 C;  3G4A A;  5C44 C;  4WIL A;  2YU9 C;  2B63 K;  4C3J C;  3M4O K;  1YX2 A;  2NVY C;  3K7A K;  1VRQ C;  4MEY A;  4KAT A;  1BJT A;  3N0C A;  2Y0S L;  3NUH A;  4WJ3 M;  4A3E C;  1R9T K;  2JA7 C;  5FLM C;  4KMA A;  4MQ9 A;  2R93 A;  4G0V A;  3GTO K;  3GEI A;  4A3G K;  4YG2 A;  1TWA C;  4FZB A;  3GTM A;  4A3F C;  1O2A A;  1ZVU A;  2B63 C;  2A68 A;  3HOV K;  3S1M C;  2KWA A;  3M4O C;  1PJ5 A;  1DCP A;  3S1R K;  1SMY A;  4PAA A;  3K7A C;  4Y52 C;  1K83 A;  3GTP K;  1XXA A;  4JK1 A;  1V5V A;  2R92 K;  4LLG A;  1R9T C;  3GTJ K;  3S0X A;  1I3Q C;  3S15 K;  3AD8 C;  3SZZ A;  4KMU A;  3AQO A;  1RU0 A;  2NVT K;  3G4C A;  3FOE A;  1C0A A;  4A3D K;  5C3E K;  1XXC A;  2GSU A;  1XZQ A;  1Y1V K;  3GTK C;  3A8J A;  4LJZ A;  3HOX C;  3HOV C;  1WOP A;  5IYB K;  4YFN A;  3S1R C;  4P5A A;  4GFQ A;  1UV7 A;  1I6H K;  1WSV A;  1XXB A;  4A3I K;  1WCM A;  3QX3 A;  1O29 A;  2R92 C;  2R7Z A;  1DCO A;  4GTL A;  2E2H K;  3GTM K;  3GTJ C;  3H0G K;  3S15 C;  2XCQ A;  1XPP A;  4A3D C;  4A93 K;  5EGE A;  5CJ9 A;  4OIR A;  3M3Y K;  3T00 A;  2BE5 A;  3HXA A;  1PJ7 A;  1EH1 A;  1Y1V C;  3ADA C;  5IOS A;  3PO3 K;  2E2J K;  4BBS K;  3RZO K;  3I4N K;  3L4J A;  3PO2 K;  5FJ8 K;  5IYB C;  5D4D A;  3BP3 A;  1J98 A;  4LR2 A;  3S1N K;  1DD5 A;  4QJV A;  2JA5 K;  2P5M A;  1ZXO A;  4KAW X;  5C44 K;  4LQY A;  1I6H C;  3ERE D;  4C45 A;  4C3J K;  1Y1W A;  3HOW K;  1O28 A;  1GE9 A;  2NVY K;  2V6U A;  1HI9 A;  2E2H C;  1BGW A;  4KB4 A;  3GTM C;  4P5B A;  1TWF A;  4A3J C;  3I4M K;  4GT9 A;  3MML B;  3S17 C;  1BS2 A;  4DDQ A;  5TMC A;  1WIH A;  3GTG A;  3AD7 C;  2O5J A;  1K83 C;  5FLM K;  3TFI A;  3LAJ A;  4J3N A;  2NVX A;  2NVQ C;  4P9S A;  1AB4 A;  1TWA K;  1I50 K;  5IP9 K;  3PO2 C;  3GEE A;  3AH5 A;  3H3V D;  2PHC B;  1I6V A;  4G7O A;  3S1M K;  3HOW C;  5IP7 K;  4A3K C;  3GEH A;  2E2I A;  4Y52 K;  1SFO A;  5TJ3 A;  2GSN A;  3S14 K;  1WOO A;  2GAH C;  4XSZ A;  3I4M C;  1IBA A;  2RH6 A;  4C3I C;  4BY7 K;  1VGX A;  4KAR A;  3EQL A;  3HOZ K;  1I3Q K;  2PMZ L;  5E68 A;  1TWG A;  3T01 A;  3FKI A;  1Y1W K;  4KM9 A;  2R7Z C;  5M5W K;  5IP9 C;  1I50 C;  4G7H A;  3GTK K;  2JA6 K;  3WOD A;  1TWF K;  3OEP A;  3HOX K;  1ISE A;  3N3Y A;  4A3C K;  1USO A; 
#chains in the Genus database with same CATH homology
 5IP7 C;  3S2H C;  3HOX C;  3HOV C;  4GZY A;  1IW7 A;  2Y0S D;  4YFN A;  5IYB K;  4Y7N C;  4A3M K;  4KN4 A;  3S1R C;  3S14 C;  4BBR C;  1I6H K;  3HKZ L;  4ZH4 A;  4X6A K;  4A3I K;  3GTL C;  5M3F K;  4BY7 C;  5IYC C;  2YU9 K;  1YNN A;  2A6E A;  2E2H K;  2WB1 L;  2R92 C;  4A3I C;  1WCM C;  3HOZ C;  4A3B K;  3H3V L;  2A69 A;  3GTM K;  3GTJ C;  1Y1W C;  5C4J C;  2VUM K;  1YNJ A;  3H0G K;  4AYB D;  4A3B C;  5C4X K;  3S15 C;  4YFK A;  4Q5S A;  5TMF A;  2E2I K;  3S16 C;  3H0G C;  5C4X C;  1XPP A;  4A3D C;  1HQM A;  4A93 K;  2JA6 C;  4OIR A;  3M3Y K;  1TWF C;  2BE5 A;  4A3E K;  1Y1V C;  4A93 C;  3GTG K;  3M3Y C;  2JA7 K;  3GTQ C;  3PO3 K;  2E2J K;  4LK1 A;  4BBS K;  2JA8 K;  1ZYR A;  3RZO K;  4A3C C;  3GTG C;  3I4N K;  1TWC C;  4YFX A;  2NVX K;  3PO2 K;  3PO3 C;  2E2J C;  4BBS C;  4QJV B;  2JA8 C;  2PMZ D;  5IYB C;  3FKI K;  5FJ8 K;  4XSX A;  5D4D A;  4MEX A;  4KN7 A;  3CQZ K;  4A3M C;  2NVX C;  3S1N K;  3I4N C;  2R93 K;  4A3L K;  2WB1 D;  4QJV A;  2JA5 K;  2PPB A;  5C44 K;  3CQZ C;  4OIQ A;  4OIN A;  3S1N C;  4A3F K;  1I6H C;  3S1Q K;  4X6A C;  4OIO A;  4C3J K;  2JA5 C;  4QIW L;  3HOW K;  5C44 C;  2B63 K;  2YU9 C;  2A6H A;  2NVY K;  2E2H C;  4A3J K;  3M4O K;  3GTM C;  2NVY C;  2VUM C;  3S17 K;  3K7A K;  1SFO K;  4A3J C;  2PA8 L;  4MEY A;  3DXJ A;  3I4M K;  2E2I C;  3S17 C;  1K83 K;  5TMC A;  2Y0S L;  3RZO C;  2O5J A;  1K83 C;  5FLM K;  4XLP A;  4A3E C;  1R9T K;  2NVQ K;  1TWH K;  2JA7 C;  3HOY K;  5FLM C;  3HKZ D;  2NVQ C;  1TWG K;  4MQ9 A;  1TWA K;  5IP9 K;  1I50 K;  5M3M K;  3PO2 C;  3GTO K;  5IYD K;  4XLN A;  4G7Z A;  1TWG C;  3S2D K;  3FKI C;  4NOI A;  4A3G K;  4YG2 A;  3HOU K;  1TWA C;  3H3V D;  2R93 C;  3GTO C;  4A3L C;  2WAQ L;  4OIP A;  1I6V A;  5M5Y K;  3RZD K;  4AYB L;  4A3G C;  4A3K K;  4A3F C;  2CW0 A;  3S1Q C;  4G7O A;  3S1M K;  5M5X K;  3HOW C;  5IP7 K;  4Q4Z A;  4A3K C;  2A68 A;  2B63 C;  3HOV K;  4BY1 K;  3S1M C;  4Y52 K;  4Y7N K;  4BXX K;  3M4O C;  3S1R K;  3S14 K;  1SMY A;  4BY1 C;  4C3I K;  3K7A C;  4Y52 C;  1SFO C;  4BBR K;  4BXX C;  4XSZ A;  3GTP K;  3I4M C;  3GTL K;  4JK1 A;  4BY7 K;  5IYC K;  2R92 K;  3EQL A;  3GTP C;  1I3Q K;  2PMZ L;  3HOZ K;  1WCM K;  4LLG A;  1R9T C;  2R7Z K;  4LK0 A;  3GTJ K;  1I3Q C;  1Y1W K;  5C4J K;  1TWH C;  3HOY C;  3S15 K;  2R7Z C;  1BDF A;  4C2M K;  5M5W K;  2O5I A;  2WAQ D;  4KMU A;  4QIW D;  5IP9 C;  1I50 C;  2NVT K;  5IYD C;  4G7H A;  3S16 K;  4A3D K;  3GTK K;  3S2D C;  2JA6 K;  5C3E K;  3HOU C;  3WOD A;  1TWF K;  4C3H K;  2NVT C;  1Y1V K;  3GTK C;  3RZD C;  5C3E C;  4LJZ A;  3S2H K;  3GTQ K;  2PA8 D;  3HOX K;  4A3C K;  1TWC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...