1I6HK

Rna polymerase ii elongation complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6hK00
3S17C 3RZDK 4Y52C 4BBRK 3HKZL 4YFNA 2NVTK 2R7ZK 4A3JC 3I4NC 4YG2A 4X6AK 3S1RC 3FKIC 4G7ZA 4KMUA 4MEXA 4C3IK 1Y1WK 3K7AC 4GZYA 1XPPA 3GTMK 2WB1L 4XLPA 4OIOA 5C4JC 4OIRA 3GTQK 4AYBL 4XSXA 3S1RK 3FKIK 3H0GC 3S16C 3K7AK 4A3MK 1I50C 2WAQD 4Y7NC 2PPBA 5TMCA 4OIPA 2R7ZC 2PMZL 4A3LK 4MEYA 4MQ9A 4QJVB 5IP7C 3RZDC 3S1NC 4Q5SA 4BY7K 1HQMA 1BDFA 4XSZA 2B63C 1I50K 2BE5A 4Y7NK 2NVXK 4OINA 2PA8L 2NVQK 3HOYC 4A3DK 2R93K 2Y0SD 4LLGA 1Y1WC 4BY1K 3S15K 3GTMC 3S1NK 3S1QK 3HOVK 4LK1A 3S2HK 3GTQC 4XLNA 5FJ8K 2B63K 3H3VD 4BBSC 3HOWK 3HOYK 4YFKA 5C44K 4C3JK 4A3MC 4A3LC 4NOIA 4G7HA 1I6HK 4BY7C 4BBSK 2WAQL 4A3EK 2A6EA 4JK1A 3GTJK 2E2HK 4X6AC 1TWHK 2NVYK 4YFXA 2R92K 4QIWL 2NVXC 2JA8C 2NVQC 4A3DC 4BXXC 2R93C 5FLMK 1R9TC 2YU9K 4BY1C 3S15C 1TWCK 1Y1VK 3S1QC 3HOVC 3EQLA 3S2HC 5M5YK 3GTOK 3RZOK 3PO2K 4A3GC 2Y0SL 2E2IK 1I6VA 3PO3K 2JA8K 3HOZK 3HOWC 5M5WK 3S1MK 2JA6K 4BXXK 1R9TK 4LK0A 5IYDK 1K83K 3HKZD 5C44C 4ZH4A 4KN7A 5IYBC 5IP9K 1I6HC 3GTKK 2VUMK 4A3IC 1WCMK 4A3EC 3HOUK 3GTJC 1SMYA 2E2HC 1TWHC 2NVYC 2R92C 3GTLK 1I3QC 2JA7C 5M5XK 5IYBK 5C3EC 2O5IA 5FLMC 1ZYRA 1SFOK 2YU9C 1TWCC 1Y1VC 5IYCK 4A93K 4A3IK 3GTGK 3GTOC 3RZOC 3PO2C 4A3BK 2E2IC 1TWAK 3PO3C 1I3QK 2JA7K 3HOZC 3S1MC 5C3EK 2JA6C 3GTPK 3S2DK 1YNNA 5IYDC 1K83C 4A3FK 5C4XC 5TMFA 5M3FK 3I4MC 2O5JA 2E2JK 5IP9C 2PA8D 5M3MK 4A3CK 3GTKC 1TWGK 4KN4A 2VUMC 2JA5C 3HOXC 1WCMC 2A69A 3HOUC 4OIQA 1TWFC 3S14C 5C4XK 4A3GK 1YNJA 3CQZK 2A68A 3GTLC 3WODA 3M4OK 3H3VL 3I4MK 3S17K 3M4OC 1SFOC 4Y52K 5IYCC 4A93C 2JA5K 3HOXK 4A3KC 3GTGC 2WB1D 4A3JK 1TWFK 3I4NK 3M3YC 3S14K 4A3BC 4G7OA 1TWAC 4AYBD 4QJVA 5D4DA 3GTPC 3S2DC 4A3FC 4Q4ZA 5C4JK 4A3KK 4QIWD 4C3HK 2E2JC 3M3YK 2PMZD 4A3CC 1TWGC 4BBRC 3H0GK 4LJZA 4C2MK 3S16K 2NVTC 2A6HA 2CW0A 3DXJA 3CQZC 1IW7A 5IP7K
chains in the Genus database with same CATH superfamily
1VRQC 3S17C 4Y52C 1VJEA 1O27A 3HKZL 2JA6A 1R9TA 1JOEA 4PAAA 4WILA 3I4NC 3FKIC 3L4JA 1XPPA 4AYBL 1AB4A 4XSXA 3GTLA 3FKIK 3A8KA 3N0BA 1I50C 1EK8A 4OIPA 2PMZL 1ZVUA 3GTGA 1INNA 3RZDC 3S1NC 4Q5SA 3GEHA 4BY7K 1EQRA 1BDFA 4DDQA 4FM9A 1I50K 4OINA 2B63C 2NVQK 3AD8C 4LLGA 4C3IC 4BY1K 3GTMC 3S1NK 5FJ8K 4WJ3M 3AD9C 1VLOA 2B63K 3HOWK 3CQZA 3T02A 4KB2A 4NOIA 1O28A 2W7VA 1WORA 4A3EK 1EI6A 1TWHK 1F9NA 2NVYK 2R93C 1Y1VK 1XZPB 5M5YK 1JVIA 3RZOK 2E2IK 2R7ZA 5EGHA 4C3JC 4ZH4A 5IYBC 4GFQA 1I6HC 1XZQA 1ISEA 1SMYA 3BUEA 5IYBK 1EH1A 5FLMC 1SFOK 1TWCC 1WSRA 3GTOC 1BS2A 1TWAK 2JA6C 1KQ4A 5CHPA 1IS1A 5IP9C 2PA8D 4A3CK 1I50A 4KN4A 1WQGA 2A69A 3Q3QA 3HOUC 5EGEA 4A3GK 1XXCA 4M1XA 3GTLC 1VH2A 4KMDA 1IL2A 1USOA 1B4BA 1PJ7A 4A93C 3GTGC 4C3HC 2WB1D 4A3BC 4G7OA 5HL8A 3ADAC 4QJVA 3SZZA 4A3FC 3T01A 4C3HK 2E2JC 1TWHA 2NVYA 1I3QA 2V6SA 3NUHA 4O2DA 1DCPA 1Y1VA 2CW0A 3CQZC 3G4CA 4G0VA 1WSVA 2E2IA 4YFNA 1O24A 4YG2A 3FHZA 3TFIA 3FOFA 4P5BA 4KMUA 1Y1WK 4GZYA 2WB1L 4XLPA 5CJ9A 3BP8C 5C4JC 4OIRA 3GTQK 1TWFA 4GTFA 3JSTA 1SFOA 3TFHA 4Y7NC 2PPBA 2R7ZC 3LAJA 4LR2A 4MEYA 4BLBA 1TWAA 2ZFZA 4XSZA 4Y7NK 1JQWA 2GAHC 1IBAA 2GSNA 1O2AA 3N3YA 4RMFA 1ZXOA 4BY7C 1O26A 2E2HK 4YFXA 1J6XA 2R92K 4QIWL 2JA8C 2NVQC 4BY1C 1O2FB 3EQLA 4KM8A 2V6UA 3PO3K 2JA8K 3S1MK 3HOWC 4GTAA 4J3NA 5IYDK 4KN7A 4LOWA 3SZYA 4A3IC 4A3EC 1Y1WA 1TWHC 2NVYC 3TTGA 1I3QC 3GTQA 5M5XK 1Y1VC 5IYCK 4A3IK 3RZOC 1ZQ1C 2E2IC 1I3QK 3GTPK 3A8JA 3S2DK 1IQ0A 1RU0A 3V4GA 3LAPA 5C4XC 5TMFA 3I4MC 1WOOA 1TWGK 4GT9A 2ZUEA 1VGXA 4OIQA 1TWFC 3S14C 1C0AA 5C4XK 3AH5A 2A68A 3M4OK 3AQOA 3I4MK 1SFOC 1BJTA 4ILDA 3GDZA 4A3KC 4A3JK 1TWFK 3S14K 3M3YC 1TWAC 1XZQB 4Q4ZA 4A3KK 2E2HA 3M3YK 2R92A 4A3CC 2JA7A 3H0GK 1X31C 3S16K 3TFJA 3DXJA 1J98A 4A3GC 1IW7A 5IP7K 3OPFA 1EFWA 2RGRA 1GE9A 3GIRA 1YCLA 4X6AK 3S1RC 4G0UA 3FOEA 4G7ZA 3K7AC 2XCOA 1WQFA 2JA5A 3S1RK 4G0WA 3N0CA 2FQOA 3K7AK 4A3MK 2WAQD 4PABA 4A3LK 1O25A 4QJVB 3HXAA 3S0XA 3GTPA 2NVXK 2BE5A 4C45A 4A3DK 4WJ4A 2PA8L 1F7UA 2ZUFA 2Y0SD 1Y1WC 1DCOA 3S15K 4KATA 3S1QK 3HOVK 1TWGA 4LK1A 3S2HK 3GTQC 4KAWX 4XLNA 2FQTA 4GTLA 5IOQA 3H3VD 4BBSC 5C44K 2GSUA 4G7HA 1BGWA 4BBSK 2P5MA 1PJ6A 2WAQL 4JK1A 3GTJK 2CFAA 3AD7C 5E68A 2XCQA 3MMLB 1F7VA 2YU9K 4BKWA 3H0GA 2RH6A 3PO2K 2Y0SL 3HOZK 3OEPA 4KASA 5IOTA 4LK0A 1K83K 3HKZD 3ERED 2EBBA 3GTKK 2VUMK 3GTOA 1WCMK 1YX2A 2E2HC 2R92C 4LQYA 2JA7C 2O5IA 1ZYRA 4P5AA 1O29A 2Y3PA 3PO3C 2JA7K 3S1MC 5IYDC 1G51A 5M3FK 5M3MK 3LPXA 2NVXA 2JA5C 3QX3A 5JVOA 3S17K 4Y52K 5IOSA 2V6TA 5IYCC 2JA5K 3I4NK 4GTCA 1XXAA 3L4KA 4FZBA 4C2MC 3CAGA 2GSOA 3GTPC 3S2DC 5L46A 3GSIA 3T00A 3BP3A 4KC6A 3GTJA 1V5VA 1TWGC 4BBRC 4C2MK 2NVTC 2YU9A 2A6HA 5M5WK 3M4OC 3RZDK 4BLAA 4BBRK 2NVTK 4A3JC 1K83A 2GAGC 4MEXA 4C3IK 1USMA 3GTMK 3GTKA 4OIOA 2VUMA 1HI9A 1WCMA 3H0GC 1O2BA 3S16C 1IE0A 4KARA 1XZPA 3GEIA 2PHCB 4KMHA 5TMCA 4MQ9A 5IP7C 1J6VA 3GEEA 1HQMA 2JH3A 4X6AC 3HOYC 2R93K 4KB4A 4KM9A 1UV7A 3HOYK 2XCRB 4YFKA 4C3JK 4A3MC 1WIHA 4A3LC 1I6HK 3FKIA 4XCHA 2A6EA 3G4AA 5TJ3A 1XXBA 2NVXC 4A3DC 4BXXC 5FLMK 1R9TC 3S15C 1TWCK 3S1QC 3HOVC 3S2HC 4AH6A 3GTOK 1WQHA 2P8TA 1I6VA 2JA6K 4BXXK 1R9TK 4GTBA 5C44C 3IPJA 1WOPA 2D6FC 5IP9K 1DD5A 2B63A 5IORA 3A8IA 3HOUK 3GTJC 1B4AA 3GTMA 1F93A 3GTLK 3OREA 5C3EC 2YU9C 4A93K 3GTGK 3PO2C 4A3BK 2KWAA 3HOZC 1WOSA 5C3EK 2CFAB 1YNNA 3VA7A 4A3FK 1K83C 4GTEA 4KDDA 2O5JA 1ZBSA 2E2JK 5JFEA 3GTKC 2VUMC 3HOXC 1WCMC 2R93A 1YNJA 3CQZK 3WODA 3H3VL 1L0WA 4GTDA 3HOXK 1DCHA 1J6WA 4P9SA 4AYBD 5D4DA 5C4JK 4QIWD 2PMZD 4KMAA 1PJ5A 4LJZA 1TWCA 2R7ZK 3AQPA
chains in the Genus database with same CATH topology
3S17C 3RZDK 4Y52C 4BBRK 3HKZL 4YFNA 2NVTK 2R7ZK 4A3JC 3I4NC 4YG2A 4X6AK 3S1RC 3FKIC 4G7ZA 4KMUA 4MEXA 4C3IK 1Y1WK 3K7AC 4GZYA 1XPPA 3GTMK 2WB1L 4XLPA 4OIOA 5C4JC 4OIRA 3GTQK 4AYBL 4XSXA 3S1RK 3FKIK 3H0GC 3S16C 3K7AK 4A3MK 1I50C 2WAQD 4Y7NC 2PPBA 5TMCA 4OIPA 2R7ZC 2PMZL 4A3LK 4MEYA 4MQ9A 4QJVB 5IP7C 3RZDC 3S1NC 4Q5SA 4BY7K 1HQMA 1BDFA 4XSZA 2B63C 1I50K 2BE5A 4Y7NK 2NVXK 4OINA 2PA8L 2NVQK 3HOYC 4A3DK 2R93K 2Y0SD 4LLGA 1Y1WC 4BY1K 3S15K 3GTMC 3S1NK 3S1QK 3HOVK 4LK1A 3S2HK 3GTQC 4XLNA 5FJ8K 2B63K 3H3VD 4BBSC 3HOWK 3HOYK 4YFKA 5C44K 4C3JK 4A3MC 4A3LC 4NOIA 4G7HA 1I6HK 4BY7C 4BBSK 2WAQL 4A3EK 2A6EA 4JK1A 3GTJK 2E2HK 4X6AC 1TWHK 2NVYK 4YFXA 2R92K 4QIWL 2NVXC 2JA8C 2NVQC 4A3DC 4BXXC 2R93C 5FLMK 1R9TC 2YU9K 4BY1C 3S15C 1TWCK 1Y1VK 3S1QC 3HOVC 3EQLA 3S2HC 5M5YK 3GTOK 3RZOK 3PO2K 4A3GC 2Y0SL 2E2IK 1I6VA 3PO3K 2JA8K 3HOZK 3HOWC 5M5WK 3S1MK 2JA6K 4BXXK 1R9TK 4LK0A 5IYDK 1K83K 3HKZD 5C44C 4ZH4A 4KN7A 5IYBC 5IP9K 1I6HC 3GTKK 2VUMK 4A3IC 1WCMK 4A3EC 3HOUK 3GTJC 1SMYA 2E2HC 1TWHC 2NVYC 2R92C 3GTLK 1I3QC 2JA7C 5M5XK 5IYBK 5C3EC 2O5IA 5FLMC 1ZYRA 1SFOK 2YU9C 1TWCC 1Y1VC 5IYCK 4A93K 4A3IK 3GTGK 3GTOC 3RZOC 3PO2C 4A3BK 2E2IC 1TWAK 3PO3C 1I3QK 2JA7K 3HOZC 3S1MC 5C3EK 2JA6C 3GTPK 3S2DK 1YNNA 5IYDC 1K83C 4A3FK 5C4XC 5TMFA 5M3FK 3I4MC 2O5JA 2E2JK 5IP9C 2PA8D 5M3MK 4A3CK 3GTKC 1TWGK 4KN4A 2VUMC 2JA5C 3HOXC 1WCMC 2A69A 3HOUC 4OIQA 1TWFC 3S14C 5C4XK 4A3GK 1YNJA 3CQZK 2A68A 3GTLC 3WODA 3M4OK 3H3VL 3I4MK 3S17K 3M4OC 1SFOC 4Y52K 5IYCC 4A93C 2JA5K 3HOXK 4A3KC 3GTGC 2WB1D 4A3JK 1TWFK 3I4NK 3M3YC 3S14K 4A3BC 4G7OA 1TWAC 4AYBD 4QJVA 5D4DA 3GTPC 3S2DC 4A3FC 4Q4ZA 5C4JK 4A3KK 4QIWD 4C3HK 2E2JC 3M3YK 2PMZD 4A3CC 1TWGC 4BBRC 3H0GK 4LJZA 4C2MK 3S16K 2NVTC 2A6HA 2CW0A 3DXJA 3CQZC 1IW7A 5IP7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 C;  3RZD K;  4Y52 C;  4BBR K;  3HKZ L;  4YFN A;  2NVT K;  2R7Z K;  4A3J C;  3I4N C;  4YG2 A;  4X6A K;  3S1R C;  3FKI C;  4G7Z A;  4KMU A;  4MEX A;  4C3I K;  1Y1W K;  3K7A C;  4GZY A;  1XPP A;  3GTM K;  2WB1 L;  4XLP A;  4OIO A;  5C4J C;  4OIR A;  3GTQ K;  4AYB L;  4XSX A;  3S1R K;  3FKI K;  3H0G C;  3S16 C;  3K7A K;  4A3M K;  1I50 C;  2WAQ D;  4Y7N C;  2PPB A;  5TMC A;  4OIP A;  2R7Z C;  2PMZ L;  4A3L K;  4MEY A;  4MQ9 A;  4QJV B;  5IP7 C;  3RZD C;  3S1N C;  4Q5S A;  4BY7 K;  1HQM A;  1BDF A;  4XSZ A;  2B63 C;  1I50 K;  2BE5 A;  4Y7N K;  2NVX K;  4OIN A;  2PA8 L;  2NVQ K;  3HOY C;  4A3D K;  2R93 K;  2Y0S D;  4LLG A;  1Y1W C;  4BY1 K;  3S15 K;  3GTM C;  3S1N K;  3S1Q K;  3HOV K;  4LK1 A;  3S2H K;  3GTQ C;  4XLN A;  5FJ8 K;  2B63 K;  3H3V D;  4BBS C;  3HOW K;  3HOY K;  4YFK A;  5C44 K;  4C3J K;  4A3M C;  4A3L C;  4NOI A;  4G7H A;  1I6H K;  4BY7 C;  4BBS K;  2WAQ L;  4A3E K;  2A6E A;  4JK1 A;  3GTJ K;  2E2H K;  4X6A C;  1TWH K;  2NVY K;  4YFX A;  2R92 K;  4QIW L;  2NVX C;  2JA8 C;  2NVQ C;  4A3D C;  4BXX C;  2R93 C;  5FLM K;  1R9T C;  2YU9 K;  4BY1 C;  3S15 C;  1TWC K;  1Y1V K;  3S1Q C;  3HOV C;  3EQL A;  3S2H C;  5M5Y K;  3GTO K;  3RZO K;  3PO2 K;  4A3G C;  2Y0S L;  2E2I K;  1I6V A;  3PO3 K;  2JA8 K;  3HOZ K;  3HOW C;  5M5W K;  3S1M K;  2JA6 K;  4BXX K;  1R9T K;  4LK0 A;  5IYD K;  1K83 K;  3HKZ D;  5C44 C;  4ZH4 A;  4KN7 A;  5IYB C;  5IP9 K;  1I6H C;  3GTK K;  2VUM K;  4A3I C;  1WCM K;  4A3E C;  3HOU K;  3GTJ C;  1SMY A;  2E2H C;  1TWH C;  2NVY C;  2R92 C;  3GTL K;  1I3Q C;  2JA7 C;  5M5X K;  5IYB K;  5C3E C;  2O5I A;  5FLM C;  1ZYR A;  1SFO K;  2YU9 C;  1TWC C;  1Y1V C;  5IYC K;  4A93 K;  4A3I K;  3GTG K;  3GTO C;  3RZO C;  3PO2 C;  4A3B K;  2E2I C;  1TWA K;  3PO3 C;  1I3Q K;  2JA7 K;  3HOZ C;  3S1M C;  5C3E K;  2JA6 C;  3GTP K;  3S2D K;  1YNN A;  5IYD C;  1K83 C;  4A3F K;  5C4X C;  5TMF A;  5M3F K;  3I4M C;  2O5J A;  2E2J K;  5IP9 C;  2PA8 D;  5M3M K;  4A3C K;  3GTK C;  1TWG K;  4KN4 A;  2VUM C;  2JA5 C;  3HOX C;  1WCM C;  2A69 A;  3HOU C;  4OIQ A;  1TWF C;  3S14 C;  5C4X K;  4A3G K;  1YNJ A;  3CQZ K;  2A68 A;  3GTL C;  3WOD A;  3M4O K;  3H3V L;  3I4M K;  3S17 K;  3M4O C;  1SFO C;  4Y52 K;  5IYC C;  4A93 C;  2JA5 K;  3HOX K;  4A3K C;  3GTG C;  2WB1 D;  4A3J K;  1TWF K;  3I4N K;  3M3Y C;  3S14 K;  4A3B C;  4G7O A;  1TWA C;  4AYB D;  4QJV A;  5D4D A;  3GTP C;  3S2D C;  4A3F C;  4Q4Z A;  5C4J K;  4A3K K;  4QIW D;  4C3H K;  2E2J C;  3M3Y K;  2PMZ D;  4A3C C;  1TWG C;  4BBR C;  3H0G K;  4LJZ A;  4C2M K;  3S16 K;  2NVT C;  2A6H A;  2CW0 A;  3DXJ A;  3CQZ C;  1IW7 A;  5IP7 K; 
#chains in the Genus database with same CATH topology
 1VRQ C;  3S17 C;  4Y52 C;  1VJE A;  1O27 A;  3HKZ L;  2JA6 A;  1R9T A;  1JOE A;  4PAA A;  4WIL A;  3I4N C;  3FKI C;  3L4J A;  1XPP A;  4AYB L;  1AB4 A;  4XSX A;  3GTL A;  3FKI K;  3A8K A;  3N0B A;  1I50 C;  1EK8 A;  4OIP A;  2PMZ L;  1ZVU A;  3GTG A;  1INN A;  3RZD C;  3S1N C;  4Q5S A;  3GEH A;  4BY7 K;  1EQR A;  1BDF A;  4DDQ A;  4FM9 A;  1I50 K;  4OIN A;  2B63 C;  2NVQ K;  3AD8 C;  4LLG A;  4C3I C;  4BY1 K;  3GTM C;  3S1N K;  5FJ8 K;  4WJ3 M;  3AD9 C;  1VLO A;  2B63 K;  3HOW K;  3CQZ A;  3T02 A;  4KB2 A;  4NOI A;  1O28 A;  2W7V A;  1WOR A;  4A3E K;  1EI6 A;  1TWH K;  1F9N A;  2NVY K;  2R93 C;  1Y1V K;  1XZP B;  5M5Y K;  1JVI A;  3RZO K;  2E2I K;  2R7Z A;  5EGH A;  4C3J C;  4ZH4 A;  5IYB C;  4GFQ A;  1I6H C;  1XZQ A;  1ISE A;  1SMY A;  3BUE A;  5IYB K;  1EH1 A;  5FLM C;  1SFO K;  1TWC C;  1WSR A;  3GTO C;  1BS2 A;  1TWA K;  2JA6 C;  1KQ4 A;  5CHP A;  1IS1 A;  5IP9 C;  2PA8 D;  4A3C K;  1I50 A;  4KN4 A;  1WQG A;  2A69 A;  3Q3Q A;  3HOU C;  5EGE A;  4A3G K;  1XXC A;  4M1X A;  3GTL C;  1VH2 A;  4KMD A;  1IL2 A;  1USO A;  1B4B A;  1PJ7 A;  4A93 C;  3GTG C;  4C3H C;  2WB1 D;  4A3B C;  4G7O A;  5HL8 A;  3ADA C;  4QJV A;  3SZZ A;  4A3F C;  3T01 A;  4C3H K;  2E2J C;  1TWH A;  2NVY A;  1I3Q A;  2V6S A;  3NUH A;  4O2D A;  1DCP A;  1Y1V A;  2CW0 A;  3CQZ C;  3G4C A;  4G0V A;  1WSV A;  2E2I A;  4YFN A;  1O24 A;  4YG2 A;  3FHZ A;  3TFI A;  3FOF A;  4P5B A;  4KMU A;  1Y1W K;  4GZY A;  2WB1 L;  4XLP A;  5CJ9 A;  3BP8 C;  5C4J C;  4OIR A;  3GTQ K;  1TWF A;  4GTF A;  3JST A;  1SFO A;  3TFH A;  4Y7N C;  2PPB A;  2R7Z C;  3LAJ A;  4LR2 A;  4MEY A;  4BLB A;  1TWA A;  2ZFZ A;  4XSZ A;  4Y7N K;  1JQW A;  2GAH C;  1IBA A;  2GSN A;  1O2A A;  3N3Y A;  4RMF A;  1ZXO A;  4BY7 C;  1O26 A;  2E2H K;  4YFX A;  1J6X A;  2R92 K;  4QIW L;  2JA8 C;  2NVQ C;  4BY1 C;  1O2F B;  3EQL A;  4KM8 A;  2V6U A;  3PO3 K;  2JA8 K;  3S1M K;  3HOW C;  4GTA A;  4J3N A;  5IYD K;  4KN7 A;  4LOW A;  3SZY A;  4A3I C;  4A3E C;  1Y1W A;  1TWH C;  2NVY C;  3TTG A;  1I3Q C;  3GTQ A;  5M5X K;  1Y1V C;  5IYC K;  4A3I K;  3RZO C;  1ZQ1 C;  2E2I C;  1I3Q K;  3GTP K;  3A8J A;  3S2D K;  1IQ0 A;  1RU0 A;  3V4G A;  3LAP A;  5C4X C;  5TMF A;  3I4M C;  1WOO A;  1TWG K;  4GT9 A;  2ZUE A;  1VGX A;  4OIQ A;  1TWF C;  3S14 C;  1C0A A;  5C4X K;  3AH5 A;  2A68 A;  3M4O K;  3AQO A;  3I4M K;  1SFO C;  1BJT A;  4ILD A;  3GDZ A;  4A3K C;  4A3J K;  1TWF K;  3S14 K;  3M3Y C;  1TWA C;  1XZQ B;  4Q4Z A;  4A3K K;  2E2H A;  3M3Y K;  2R92 A;  4A3C C;  2JA7 A;  3H0G K;  1X31 C;  3S16 K;  3TFJ A;  3DXJ A;  1J98 A;  4A3G C;  1IW7 A;  5IP7 K;  3OPF A;  1EFW A;  2RGR A;  1GE9 A;  3GIR A;  1YCL A;  4X6A K;  3S1R C;  4G0U A;  3FOE A;  4G7Z A;  3K7A C;  2XCO A;  1WQF A;  2JA5 A;  3S1R K;  4G0W A;  3N0C A;  2FQO A;  3K7A K;  4A3M K;  2WAQ D;  4PAB A;  4A3L K;  1O25 A;  4QJV B;  3HXA A;  3S0X A;  3GTP A;  2NVX K;  2BE5 A;  4C45 A;  4A3D K;  4WJ4 A;  2PA8 L;  1F7U A;  2ZUF A;  2Y0S D;  1Y1W C;  1DCO A;  3S15 K;  4KAT A;  3S1Q K;  3HOV K;  1TWG A;  4LK1 A;  3S2H K;  3GTQ C;  4KAW X;  4XLN A;  2FQT A;  4GTL A;  5IOQ A;  3H3V D;  4BBS C;  5C44 K;  2GSU A;  4G7H A;  1BGW A;  4BBS K;  2P5M A;  1PJ6 A;  2WAQ L;  4JK1 A;  3GTJ K;  2CFA A;  3AD7 C;  5E68 A;  2XCQ A;  3MML B;  1F7V A;  2YU9 K;  4BKW A;  3H0G A;  2RH6 A;  3PO2 K;  2Y0S L;  3HOZ K;  3OEP A;  4KAS A;  5IOT A;  4LK0 A;  1K83 K;  3HKZ D;  3ERE D;  2EBB A;  3GTK K;  2VUM K;  3GTO A;  1WCM K;  1YX2 A;  2E2H C;  2R92 C;  4LQY A;  2JA7 C;  2O5I A;  1ZYR A;  4P5A A;  1O29 A;  2Y3P A;  3PO3 C;  2JA7 K;  3S1M C;  5IYD C;  1G51 A;  5M3F K;  5M3M K;  3LPX A;  2NVX A;  2JA5 C;  3QX3 A;  5JVO A;  3S17 K;  4Y52 K;  5IOS A;  2V6T A;  5IYC C;  2JA5 K;  3I4N K;  4GTC A;  1XXA A;  3L4K A;  4FZB A;  4C2M C;  3CAG A;  2GSO A;  3GTP C;  3S2D C;  5L46 A;  3GSI A;  3T00 A;  3BP3 A;  4KC6 A;  3GTJ A;  1V5V A;  1TWG C;  4BBR C;  4C2M K;  2NVT C;  2YU9 A;  2A6H A;  5M5W K;  3M4O C;  3RZD K;  4BLA A;  4BBR K;  2NVT K;  4A3J C;  1K83 A;  2GAG C;  4MEX A;  4C3I K;  1USM A;  3GTM K;  3GTK A;  4OIO A;  2VUM A;  1HI9 A;  1WCM A;  3H0G C;  1O2B A;  3S16 C;  1IE0 A;  4KAR A;  1XZP A;  3GEI A;  2PHC B;  4KMH A;  5TMC A;  4MQ9 A;  5IP7 C;  1J6V A;  3GEE A;  1HQM A;  2JH3 A;  4X6A C;  3HOY C;  2R93 K;  4KB4 A;  4KM9 A;  1UV7 A;  3HOY K;  2XCR B;  4YFK A;  4C3J K;  4A3M C;  1WIH A;  4A3L C;  1I6H K;  3FKI A;  4XCH A;  2A6E A;  3G4A A;  5TJ3 A;  1XXB A;  2NVX C;  4A3D C;  4BXX C;  5FLM K;  1R9T C;  3S15 C;  1TWC K;  3S1Q C;  3HOV C;  3S2H C;  4AH6 A;  3GTO K;  1WQH A;  2P8T A;  1I6V A;  2JA6 K;  4BXX K;  1R9T K;  4GTB A;  5C44 C;  3IPJ A;  1WOP A;  2D6F C;  5IP9 K;  1DD5 A;  2B63 A;  5IOR A;  3A8I A;  3HOU K;  3GTJ C;  1B4A A;  3GTM A;  1F93 A;  3GTL K;  3ORE A;  5C3E C;  2YU9 C;  4A93 K;  3GTG K;  3PO2 C;  4A3B K;  2KWA A;  3HOZ C;  1WOS A;  5C3E K;  2CFA B;  1YNN A;  3VA7 A;  4A3F K;  1K83 C;  4GTE A;  4KDD A;  2O5J A;  1ZBS A;  2E2J K;  5JFE A;  3GTK C;  2VUM C;  3HOX C;  1WCM C;  2R93 A;  1YNJ A;  3CQZ K;  3WOD A;  3H3V L;  1L0W A;  4GTD A;  3HOX K;  1DCH A;  1J6W A;  4P9S A;  4AYB D;  5D4D A;  5C4J K;  4QIW D;  2PMZ D;  4KMA A;  1PJ5 A;  4LJZ A;  1TWC A;  2R7Z K;  3AQP A; 
#chains in the Genus database with same CATH homology
 3S17 C;  3RZD K;  4Y52 C;  4BBR K;  3HKZ L;  4YFN A;  2NVT K;  2R7Z K;  4A3J C;  3I4N C;  4YG2 A;  4X6A K;  3S1R C;  3FKI C;  4G7Z A;  4KMU A;  4MEX A;  4C3I K;  1Y1W K;  3K7A C;  4GZY A;  1XPP A;  3GTM K;  2WB1 L;  4XLP A;  4OIO A;  5C4J C;  4OIR A;  3GTQ K;  4AYB L;  4XSX A;  3S1R K;  3FKI K;  3H0G C;  3S16 C;  3K7A K;  4A3M K;  1I50 C;  2WAQ D;  4Y7N C;  2PPB A;  5TMC A;  4OIP A;  2R7Z C;  2PMZ L;  4A3L K;  4MEY A;  4MQ9 A;  4QJV B;  5IP7 C;  3RZD C;  3S1N C;  4Q5S A;  4BY7 K;  1HQM A;  1BDF A;  4XSZ A;  2B63 C;  1I50 K;  2BE5 A;  4Y7N K;  2NVX K;  4OIN A;  2PA8 L;  2NVQ K;  3HOY C;  4A3D K;  2R93 K;  2Y0S D;  4LLG A;  1Y1W C;  4BY1 K;  3S15 K;  3GTM C;  3S1N K;  3S1Q K;  3HOV K;  4LK1 A;  3S2H K;  3GTQ C;  4XLN A;  5FJ8 K;  2B63 K;  3H3V D;  4BBS C;  3HOW K;  3HOY K;  4YFK A;  5C44 K;  4C3J K;  4A3M C;  4A3L C;  4NOI A;  4G7H A;  1I6H K;  4BY7 C;  4BBS K;  2WAQ L;  4A3E K;  2A6E A;  4JK1 A;  3GTJ K;  2E2H K;  4X6A C;  1TWH K;  2NVY K;  4YFX A;  2R92 K;  4QIW L;  2NVX C;  2JA8 C;  2NVQ C;  4A3D C;  4BXX C;  2R93 C;  5FLM K;  1R9T C;  2YU9 K;  4BY1 C;  3S15 C;  1TWC K;  1Y1V K;  3S1Q C;  3HOV C;  3EQL A;  3S2H C;  5M5Y K;  3GTO K;  3RZO K;  3PO2 K;  4A3G C;  2Y0S L;  2E2I K;  1I6V A;  3PO3 K;  2JA8 K;  3HOZ K;  3HOW C;  5M5W K;  3S1M K;  2JA6 K;  4BXX K;  1R9T K;  4LK0 A;  5IYD K;  1K83 K;  3HKZ D;  5C44 C;  4ZH4 A;  4KN7 A;  5IYB C;  5IP9 K;  1I6H C;  3GTK K;  2VUM K;  4A3I C;  1WCM K;  4A3E C;  3HOU K;  3GTJ C;  1SMY A;  2E2H C;  1TWH C;  2NVY C;  2R92 C;  3GTL K;  1I3Q C;  2JA7 C;  5M5X K;  5IYB K;  5C3E C;  2O5I A;  5FLM C;  1ZYR A;  1SFO K;  2YU9 C;  1TWC C;  1Y1V C;  5IYC K;  4A93 K;  4A3I K;  3GTG K;  3GTO C;  3RZO C;  3PO2 C;  4A3B K;  2E2I C;  1TWA K;  3PO3 C;  1I3Q K;  2JA7 K;  3HOZ C;  3S1M C;  5C3E K;  2JA6 C;  3GTP K;  3S2D K;  1YNN A;  5IYD C;  1K83 C;  4A3F K;  5C4X C;  5TMF A;  5M3F K;  3I4M C;  2O5J A;  2E2J K;  5IP9 C;  2PA8 D;  5M3M K;  4A3C K;  3GTK C;  1TWG K;  4KN4 A;  2VUM C;  2JA5 C;  3HOX C;  1WCM C;  2A69 A;  3HOU C;  4OIQ A;  1TWF C;  3S14 C;  5C4X K;  4A3G K;  1YNJ A;  3CQZ K;  2A68 A;  3GTL C;  3WOD A;  3M4O K;  3H3V L;  3I4M K;  3S17 K;  3M4O C;  1SFO C;  4Y52 K;  5IYC C;  4A93 C;  2JA5 K;  3HOX K;  4A3K C;  3GTG C;  2WB1 D;  4A3J K;  1TWF K;  3I4N K;  3M3Y C;  3S14 K;  4A3B C;  4G7O A;  1TWA C;  4AYB D;  4QJV A;  5D4D A;  3GTP C;  3S2D C;  4A3F C;  4Q4Z A;  5C4J K;  4A3K K;  4QIW D;  4C3H K;  2E2J C;  3M3Y K;  2PMZ D;  4A3C C;  1TWG C;  4BBR C;  3H0G K;  4LJZ A;  4C2M K;  3S16 K;  2NVT C;  2A6H A;  2CW0 A;  3DXJ A;  3CQZ C;  1IW7 A;  5IP7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...