1I6HK

Rna polymerase ii elongation complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6hK00
3GTKC 1IW7A 5IYCC 1TWHK 3RZDC 1SFOC 2E2JK 4ZH4A 1K83K 4A3FK 3M3YK 3S16C 1Y1VC 4A3GK 4C3HK 4A3FC 2E2IK 2Y0SD 3M3YC 4A3GC 5M5XK 2E2IC 3EQLA 3HOXK 2R7ZC 5M5WK 2NVQC 3S1QC 4MQ9A 4LK1A 4NOIA 5FJ8K 4A3IC 2PA8D 2WB1L 2JA5K 5M5YK 4OIRA 4BXXK 2JA5C 5IP9K 3RZOK 4BXXC 4A3LK 4QIWD 3S15C 3H3VD 5IP9C 4OIPA 4BBRK 3HOYK 4A3EK 3I4MC 3RZOC 3S17K 4AYBD 1XPPA 4BBRC 4A3LC 4A3EC 3S17C 3S1NC 5IYDK 3K7AK 4QJVA 3M4OK 2A6HA 5IYDC 2JA8K 2VUMK 3PO3C 2PMZD 4X6AK 3GTLK 3M4OC 1WCMK 4G7HA 1I3QC 2NVXK 2JA8C 2YU9K 1WCMC 4XSZA 4MEYA 3HOVK 4JK1A 4BY7K 1I6HC 3HKZL 3GTJK 3HOVC 1I6VA 3GTJC 1TWHC 1SMYA 2WAQL 2R93K 5IYBK 2E2JC 3DXJA 1K83C 4A93K 2R93C 5IYBC 4XLPA 2A69A 2O5IA 3S1MK 2R92K 3HOXC 3S2HK 1R9TK 2R92C 3S1MC 4YFXA 5C4JK 3GTOK 4BY1K 3HOZK 4A3CK 1TWCK 4LLGA 2A6EA 5C4JC 3GTOC 4A3CC 4C2MK 3S2DK 2BE5A 1TWFK 4YFNA 2A68A 5FLMK 3HOYC 3CQZK 3H0GK 4C3JK 4XLNA 3FKIK 3WODA 4Y7NK 4A3BK 3K7AC 2WB1D 5C3EK 3FKIC 5IP7K 4Y7NC 3S1RK 2VUMC 3GTPK 4A3BC 4X6AC 4G7OA 5IP7C 4XSXA 1TWGK 3S1RC 2NVXC 1I50K 2JA7K 2NVTK 3GTLC 1TWAK 4Y52K 4LK0A 2YU9C 3PO2K 2JA7C 4BBSK 4Y52C 2B63K 4BY7C 3PO2C 1HQMA 3GTQK 5C44K 3S14K 1YNJA 4A93C 4QJVB 3HOWK 3HKZD 3HOWC 3S2HC 1R9TC 2WAQD 5M3FK 4Q5SA 3GTMK 4GZYA 3HOZC 4BY1C 5M3MK 2O5JA 1TWCC 1Y1WK 2Y0SL 4A3DK 5TMCA 3S2DC 4LJZA 3S16K 1TWFC 4G7ZA 3GTKK 4A3DC 4YG2A 3RZDK 5IYCK 5FLMC 5C4XK 3CQZC 3HOUK 4KN4A 3H0GC 1SFOK 5C4XC 3HOUC 2PA8L 1Y1VK 4A3JK 2NVYK 5C3EC 2E2HK 4A3JC 3GTPC 2NVYC 4QIWL 2E2HC 2PPBA 3H3VL 1TWGC 1I50C 2NVTC 4AYBL 1TWAC 2JA6K 2R7ZK 2NVQK 3S1QK 4MEXA 1BDFA 4KN7A 4OIOA 2B63C 2JA6C 4BBSC 4A3IK 3GTQC 5C44C 3S14C 3GTGK 2PMZL 2CW0A 3S15K 3I4NK 3GTGC 4A3MK 3I4MK 3I4NC 4Q4ZA 4A3MC 3S1NK 1YNNA 4OINA 1ZYRA 4KMUA 3PO3K 5D4DA 4A3KK 5TMFA 1I3QK 3GTMC 4A3KC 1Y1WC 4YFKA 1I6HK 4OIQA 4C3IK
chains in the Genus database with same CATH superfamily
2GAHC 3GTKC 3RZDC 1TWHK 1WCMA 3JSTA 2NVXA 1Y1VC 2E2IK 1WSRA 1XZQA 3GEEA 2R7ZC 1EK8A 4MQ9A 5FJ8K 4M1XA 2WB1L 4A3IC 5M5YK 4BXXK 3MMLB 3RZOK 3H3VD 4BBRK 3HOYK 2XCOA 4A3EK 1R9TA 3K7AK 4G0UA 3GIRA 2JA8K 3AD9C 3GTLK 3CAGA 4ILDA 1I3QC 5HL8A 2YU9K 4XSZA 4JK1A 4KM9A 3HKZL 4BKWA 1O25A 4P5AA 3GTPA 1K83C 2R93C 3BP8C 1KQ4A 1VJEA 2B63A 2JA6A 3N0CA 1WQHA 3S2HK 3GTQA 4YFXA 5C4JK 2ZFZA 1TWCK 2A6EA 1O27A 3AQOA 2A68A 4BLBA 5FLMK 3TFJA 2WB1D 4XSXA 4Y52K 1TWAK 2JA7C 4LOWA 2GAGC 4BY7C 3V4GA 2ZUFA 3HXAA 2D6FC 2XCQA 3HKZD 5M3FK 4GTLA 1J6WA 4GZYA 4BY1C 5M3MK 4LJZA 1TWFC 3SZYA 4G7ZA 3GTKK 1DD5A 4YG2A 3RZDK 4A3DC 3CQZC 4KN4A 3H0GC 1USOA 5C4XC 4KB4A 2PA8L 1Y1VK 5E68A 4A3JK 1XXAA 2E2HC 1TWGC 1I50C 2NVTC 2JA6K 2Y3PA 2R7ZK 1TWHA 4MEXA 4OIOA 4BBSC 3TTGA 3GDZA 5EGHA 4A3IK 3A8KA 5C44C 3S14C 3GTGC 4P5BA 3I4NC 2R92A 1GE9A 4WJ3M 4OINA 3GTOA 5TMFA 1I3QK 3GTMC 1ZQ1C 1VLOA 1Y1WC 4KM8A 5JVOA 3G4CA 1BS2A 3FKIA 4ZH4A 1K83K 4A3FK 3GTLA 3A8IA 2YU9A 3M3YC 4A3GC 3N3YA 3EQLA 4GTFA 4NOIA 2PA8D 2JA5C 5IP9K 3A8JA 4A3LK 3I4MC 1XPPA 4KARA 3S17C 1TWCA 3M4OK 5IYDC 3LAJA 4GTEA 4G7HA 1WORA 1WCMC 4BY7K 5JFEA 3ERED 3HOVC 4GTBA 3GTJC 2WAQL 2E2JC 5IYBC 1TWAA 2A69A 3S1MK 2R92K 5EGEA 3AD7C 2V6TA 3GTOK 3T01A 4BY1K 4A3CK 4LLGA 4C2MK 2BE5A 1TWFK 1V5VA 3CQZK 5L46A 3QX3A 3H0GK 4XLNA 3FKIK 4A3BK 5IP7K 3N0BA 4Y7NC 2VUMC 1TWGK 3S1RC 1I50K 2NVTK 3GTKA 3PO2K 4BBSK 1VGXA 1HQMA 5IOTA 1Y1VA 5C44K 3S14K 1YNJA 1L0WA 1YX2A 1O24A 2RH6A 2R7ZA 3HOWK 2WAQD 3GTMK 5IOQA 1Y1WK 4FM9A 2GSOA 3L4KA 1B4AA 4DDQA 4C3JC 3HOUC 1I3QA 3OPFA 2NVYC 1ZVUA 1BDFA 1K83A 2R93A 2PMZL 4LQYA 4KDDA 3I4MK 4GTAA 1IQ0A 4Q4ZA 4A3MC 4G0VA 2GSNA 1BJTA 1ZYRA 4KMUA 5D4DA 4A3KK 3T02A 1O29A 1WOPA 3BUEA 3S16C 1JQWA 1HI9A 5IYCC 1SFOC 2E2JK 4LR2A 1O2BA 2JA7A 5M5XK 2E2IC 5IOSA 1EFWA 2NVQC 4LK1A 3LAPA 1WSVA 4C45A 1ISEA 4BXXC 3FOEA 3RZOC 4FZBA 4BBRC 3OREA 4A3EC 2JH3A 4KASA 2VUMK 3PO3C 2PMZD 1XZQB 1TWFA 2JA8C 3CQZA 2FQOA 3H0GA 1I6HC 4C3IC 3OEPA 3AD8C 4GTCA 2R93K 4KAWX 3DXJA 2E2HA 1J6VA 1TWGA 1I50A 2ZUEA 4XLPA 1F9NA 1DCOA 2W7VA 2KWAA 3ADAC 4C3HC 3HOXC 2V6UA 5C4JC 1DCHA 3G4AA 1WOSA 4C3JK 3GTMA 1AB4A 1Y1WA 4X6AC 4G7OA 2NVXC 2JA7K 1C0AA 4Y52C 1J6XA 1ZXOA 4KMAA 4KATA 4A93C 4WJ4A 1JVIA 4QJVB 3Q3QA 1XZPB 1USMA 1R9TC 2JA5A 3TFHA 4Q5SA 3HOZC 4KB2A 5IORA 2Y0SL 4A3DK 5TMCA 3S2DC 3S16K 4XCHA 1PJ7A 5IYCK 5C4XK 4PABA 1EH1A 1SFOK 1EQRA 5C3EC 2E2HK 4WILA 4A3JC 3IPJA 4KMDA 4QIWL 2PPBA 3GTPC 4GFQA 4AYBL 2CFAB 3GTJA 2NVQK 4KN7A 2B63C 2JA6C 1X31C 1O26A 1INNA 3GTQC 3GTGK 3I4NK 1O28A 4J3NA 1WQGA 1F7UA 1YNNA 3PO3K 1WQFA 1I6HK 4OIQA 4C3IK 1UV7A 1IW7A 1F93A 1O2AA 2VUMA 3TFIA 2RGRA 1PJ6A 3M3YK 4A3GK 4C3HK 4A3FC 2Y0SD 1RU0A 3HOXK 5M5WK 3S1QC 2JA5K 1VH2A 4OIRA 4QIWD 3S15C 5IP9C 4OIPA 1BGWA 3S17K 4A3LC 4AYBD 1JOEA 1XXBA 3S1NC 5IYDK 1O2FB 3S0XA 4QJVA 1ZBSA 2A6HA 4X6AK 1IBAA 1XZPA 1WCMK 2NVXK 3M4OC 1VRQC 1EI6A 1IL2A 1PJ5A 4MEYA 3HOVK 1J98A 3GTJK 5CJ9A 4KMHA 1I6VA 1SMYA 1TWHC 4BLAA 5IYBK 2NVYA 4A93K 3L4JA 1G51A 2O5IA 3GEHA 1R9TK 2R92C 3S1MC 3HOZK 2CFAA 2FQTA 3GTOC 4A3CC 3S2DK 3BP3A 4YFNA 5CHPA 4C2MC 3HOYC 3FOFA 4KC6A 2GSUA 1F7VA 3WODA 4Y7NK 3K7AC 5C3EK 3FKIC 4A3BC 3S1RK 3GTPK 5IP7C 3GTLC 4LK0A 3AQPA 2YU9C 2B63K 1SFOA 3PO2C 3GTQK 2E2IA 2PHCB 1B4BA 3GSIA 2V6SA 3NUHA 3HOWC 3S2HC 3VA7A 3GTGA 2O5JA 1TWCC 1IE0A 1WIHA 3FHZA 5FLMC 3HOUK 3T00A 3LPXA 2NVYK 4AH6A 3GEIA 4PAAA 4G0WA 3H3VL 3AH5A 1TWAC 3S1QK 2EBBA 3SZZA 1IS1A 1XXCA 4GT9A 2CW0A 4O2DA 4RMFA 4GTDA 2XCRB 3S15K 4A3MK 3S1NK 1WOOA 2P5MA 5TJ3A 1YCLA 1DCPA 4A3KC 4YFKA 2P8TA 4P9SA
chains in the Genus database with same CATH topology
3GTKC 1IW7A 5IYCC 1TWHK 3RZDC 1SFOC 2E2JK 4ZH4A 1K83K 4A3FK 3M3YK 3S16C 1Y1VC 4A3GK 4C3HK 4A3FC 2E2IK 2Y0SD 3M3YC 4A3GC 5M5XK 2E2IC 3EQLA 3HOXK 2R7ZC 5M5WK 2NVQC 3S1QC 4MQ9A 4LK1A 4NOIA 5FJ8K 4A3IC 2PA8D 2WB1L 2JA5K 5M5YK 4OIRA 4BXXK 2JA5C 5IP9K 3RZOK 4BXXC 4A3LK 4QIWD 3S15C 3H3VD 5IP9C 4OIPA 4BBRK 3HOYK 4A3EK 3I4MC 3RZOC 3S17K 4AYBD 1XPPA 4BBRC 4A3LC 4A3EC 3S17C 3S1NC 5IYDK 3K7AK 4QJVA 3M4OK 2A6HA 5IYDC 2JA8K 2VUMK 3PO3C 2PMZD 4X6AK 3GTLK 3M4OC 1WCMK 4G7HA 1I3QC 2NVXK 2JA8C 2YU9K 1WCMC 4XSZA 4MEYA 3HOVK 4JK1A 4BY7K 1I6HC 3HKZL 3GTJK 3HOVC 1I6VA 3GTJC 1TWHC 1SMYA 2WAQL 2R93K 5IYBK 2E2JC 3DXJA 1K83C 4A93K 2R93C 5IYBC 4XLPA 2A69A 2O5IA 3S1MK 2R92K 3HOXC 3S2HK 1R9TK 2R92C 3S1MC 4YFXA 5C4JK 3GTOK 4BY1K 3HOZK 4A3CK 1TWCK 4LLGA 2A6EA 5C4JC 3GTOC 4A3CC 4C2MK 3S2DK 2BE5A 1TWFK 4YFNA 2A68A 5FLMK 3HOYC 3CQZK 3H0GK 4C3JK 4XLNA 3FKIK 3WODA 4Y7NK 4A3BK 3K7AC 2WB1D 5C3EK 3FKIC 5IP7K 4Y7NC 3S1RK 2VUMC 3GTPK 4A3BC 4X6AC 4G7OA 5IP7C 4XSXA 1TWGK 3S1RC 2NVXC 1I50K 2JA7K 2NVTK 3GTLC 1TWAK 4Y52K 4LK0A 2YU9C 3PO2K 2JA7C 4BBSK 4Y52C 2B63K 4BY7C 3PO2C 1HQMA 3GTQK 5C44K 3S14K 1YNJA 4A93C 4QJVB 3HOWK 3HKZD 3HOWC 3S2HC 1R9TC 2WAQD 5M3FK 4Q5SA 3GTMK 4GZYA 3HOZC 4BY1C 5M3MK 2O5JA 1TWCC 1Y1WK 2Y0SL 4A3DK 5TMCA 3S2DC 4LJZA 3S16K 1TWFC 4G7ZA 3GTKK 4A3DC 4YG2A 3RZDK 5IYCK 5FLMC 5C4XK 3CQZC 3HOUK 4KN4A 3H0GC 1SFOK 5C4XC 3HOUC 2PA8L 1Y1VK 4A3JK 2NVYK 5C3EC 2E2HK 4A3JC 3GTPC 2NVYC 4QIWL 2E2HC 2PPBA 3H3VL 1TWGC 1I50C 2NVTC 4AYBL 1TWAC 2JA6K 2R7ZK 2NVQK 3S1QK 4MEXA 1BDFA 4KN7A 4OIOA 2B63C 2JA6C 4BBSC 4A3IK 3GTQC 5C44C 3S14C 3GTGK 2PMZL 2CW0A 3S15K 3I4NK 3GTGC 4A3MK 3I4MK 3I4NC 4Q4ZA 4A3MC 3S1NK 1YNNA 4OINA 1ZYRA 4KMUA 3PO3K 5D4DA 4A3KK 5TMFA 1I3QK 3GTMC 4A3KC 1Y1WC 4YFKA 1I6HK 4OIQA 4C3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK C;  1IW7 A;  5IYC C;  1TWH K;  3RZD C;  1SFO C;  2E2J K;  4ZH4 A;  1K83 K;  4A3F K;  3M3Y K;  3S16 C;  1Y1V C;  4A3G K;  4C3H K;  4A3F C;  2E2I K;  2Y0S D;  3M3Y C;  4A3G C;  5M5X K;  2E2I C;  3EQL A;  3HOX K;  2R7Z C;  5M5W K;  2NVQ C;  3S1Q C;  4MQ9 A;  4LK1 A;  4NOI A;  5FJ8 K;  4A3I C;  2PA8 D;  2WB1 L;  2JA5 K;  5M5Y K;  4OIR A;  4BXX K;  2JA5 C;  5IP9 K;  3RZO K;  4BXX C;  4A3L K;  4QIW D;  3S15 C;  3H3V D;  5IP9 C;  4OIP A;  4BBR K;  3HOY K;  4A3E K;  3I4M C;  3RZO C;  3S17 K;  4AYB D;  1XPP A;  4BBR C;  4A3L C;  4A3E C;  3S17 C;  3S1N C;  5IYD K;  3K7A K;  4QJV A;  3M4O K;  2A6H A;  5IYD C;  2JA8 K;  2VUM K;  3PO3 C;  2PMZ D;  4X6A K;  3GTL K;  3M4O C;  1WCM K;  4G7H A;  1I3Q C;  2NVX K;  2JA8 C;  2YU9 K;  1WCM C;  4XSZ A;  4MEY A;  3HOV K;  4JK1 A;  4BY7 K;  1I6H C;  3HKZ L;  3GTJ K;  3HOV C;  1I6V A;  3GTJ C;  1TWH C;  1SMY A;  2WAQ L;  2R93 K;  5IYB K;  2E2J C;  3DXJ A;  1K83 C;  4A93 K;  2R93 C;  5IYB C;  4XLP A;  2A69 A;  2O5I A;  3S1M K;  2R92 K;  3HOX C;  3S2H K;  1R9T K;  2R92 C;  3S1M C;  4YFX A;  5C4J K;  3GTO K;  4BY1 K;  3HOZ K;  4A3C K;  1TWC K;  4LLG A;  2A6E A;  5C4J C;  3GTO C;  4A3C C;  4C2M K;  3S2D K;  2BE5 A;  1TWF K;  4YFN A;  2A68 A;  5FLM K;  3HOY C;  3CQZ K;  3H0G K;  4C3J K;  4XLN A;  3FKI K;  3WOD A;  4Y7N K;  4A3B K;  3K7A C;  2WB1 D;  5C3E K;  3FKI C;  5IP7 K;  4Y7N C;  3S1R K;  2VUM C;  3GTP K;  4A3B C;  4X6A C;  4G7O A;  5IP7 C;  4XSX A;  1TWG K;  3S1R C;  2NVX C;  1I50 K;  2JA7 K;  2NVT K;  3GTL C;  1TWA K;  4Y52 K;  4LK0 A;  2YU9 C;  3PO2 K;  2JA7 C;  4BBS K;  4Y52 C;  2B63 K;  4BY7 C;  3PO2 C;  1HQM A;  3GTQ K;  5C44 K;  3S14 K;  1YNJ A;  4A93 C;  4QJV B;  3HOW K;  3HKZ D;  3HOW C;  3S2H C;  1R9T C;  2WAQ D;  5M3F K;  4Q5S A;  3GTM K;  4GZY A;  3HOZ C;  4BY1 C;  5M3M K;  2O5J A;  1TWC C;  1Y1W K;  2Y0S L;  4A3D K;  5TMC A;  3S2D C;  4LJZ A;  3S16 K;  1TWF C;  4G7Z A;  3GTK K;  4A3D C;  4YG2 A;  3RZD K;  5IYC K;  5FLM C;  5C4X K;  3CQZ C;  3HOU K;  4KN4 A;  3H0G C;  1SFO K;  5C4X C;  3HOU C;  2PA8 L;  1Y1V K;  4A3J K;  2NVY K;  5C3E C;  2E2H K;  4A3J C;  3GTP C;  2NVY C;  4QIW L;  2E2H C;  2PPB A;  3H3V L;  1TWG C;  1I50 C;  2NVT C;  4AYB L;  1TWA C;  2JA6 K;  2R7Z K;  2NVQ K;  3S1Q K;  4MEX A;  1BDF A;  4KN7 A;  4OIO A;  2B63 C;  2JA6 C;  4BBS C;  4A3I K;  3GTQ C;  5C44 C;  3S14 C;  3GTG K;  2PMZ L;  2CW0 A;  3S15 K;  3I4N K;  3GTG C;  4A3M K;  3I4M K;  3I4N C;  4Q4Z A;  4A3M C;  3S1N K;  1YNN A;  4OIN A;  1ZYR A;  4KMU A;  3PO3 K;  5D4D A;  4A3K K;  5TMF A;  1I3Q K;  3GTM C;  4A3K C;  1Y1W C;  4YFK A;  1I6H K;  4OIQ A;  4C3I K; 
#chains in the Genus database with same CATH topology
 2GAH C;  3GTK C;  3RZD C;  1TWH K;  1WCM A;  3JST A;  2NVX A;  1Y1V C;  2E2I K;  1WSR A;  1XZQ A;  3GEE A;  2R7Z C;  1EK8 A;  4MQ9 A;  5FJ8 K;  4M1X A;  2WB1 L;  4A3I C;  5M5Y K;  4BXX K;  3MML B;  3RZO K;  3H3V D;  4BBR K;  3HOY K;  2XCO A;  4A3E K;  1R9T A;  3K7A K;  4G0U A;  3GIR A;  2JA8 K;  3AD9 C;  3GTL K;  3CAG A;  4ILD A;  1I3Q C;  5HL8 A;  2YU9 K;  4XSZ A;  4JK1 A;  4KM9 A;  3HKZ L;  4BKW A;  1O25 A;  4P5A A;  3GTP A;  1K83 C;  2R93 C;  3BP8 C;  1KQ4 A;  1VJE A;  2B63 A;  2JA6 A;  3N0C A;  1WQH A;  3S2H K;  3GTQ A;  4YFX A;  5C4J K;  2ZFZ A;  1TWC K;  2A6E A;  1O27 A;  3AQO A;  2A68 A;  4BLB A;  5FLM K;  3TFJ A;  2WB1 D;  4XSX A;  4Y52 K;  1TWA K;  2JA7 C;  4LOW A;  2GAG C;  4BY7 C;  3V4G A;  2ZUF A;  3HXA A;  2D6F C;  2XCQ A;  3HKZ D;  5M3F K;  4GTL A;  1J6W A;  4GZY A;  4BY1 C;  5M3M K;  4LJZ A;  1TWF C;  3SZY A;  4G7Z A;  3GTK K;  1DD5 A;  4YG2 A;  3RZD K;  4A3D C;  3CQZ C;  4KN4 A;  3H0G C;  1USO A;  5C4X C;  4KB4 A;  2PA8 L;  1Y1V K;  5E68 A;  4A3J K;  1XXA A;  2E2H C;  1TWG C;  1I50 C;  2NVT C;  2JA6 K;  2Y3P A;  2R7Z K;  1TWH A;  4MEX A;  4OIO A;  4BBS C;  3TTG A;  3GDZ A;  5EGH A;  4A3I K;  3A8K A;  5C44 C;  3S14 C;  3GTG C;  4P5B A;  3I4N C;  2R92 A;  1GE9 A;  4WJ3 M;  4OIN A;  3GTO A;  5TMF A;  1I3Q K;  3GTM C;  1ZQ1 C;  1VLO A;  1Y1W C;  4KM8 A;  5JVO A;  3G4C A;  1BS2 A;  3FKI A;  4ZH4 A;  1K83 K;  4A3F K;  3GTL A;  3A8I A;  2YU9 A;  3M3Y C;  4A3G C;  3N3Y A;  3EQL A;  4GTF A;  4NOI A;  2PA8 D;  2JA5 C;  5IP9 K;  3A8J A;  4A3L K;  3I4M C;  1XPP A;  4KAR A;  3S17 C;  1TWC A;  3M4O K;  5IYD C;  3LAJ A;  4GTE A;  4G7H A;  1WOR A;  1WCM C;  4BY7 K;  5JFE A;  3ERE D;  3HOV C;  4GTB A;  3GTJ C;  2WAQ L;  2E2J C;  5IYB C;  1TWA A;  2A69 A;  3S1M K;  2R92 K;  5EGE A;  3AD7 C;  2V6T A;  3GTO K;  3T01 A;  4BY1 K;  4A3C K;  4LLG A;  4C2M K;  2BE5 A;  1TWF K;  1V5V A;  3CQZ K;  5L46 A;  3QX3 A;  3H0G K;  4XLN A;  3FKI K;  4A3B K;  5IP7 K;  3N0B A;  4Y7N C;  2VUM C;  1TWG K;  3S1R C;  1I50 K;  2NVT K;  3GTK A;  3PO2 K;  4BBS K;  1VGX A;  1HQM A;  5IOT A;  1Y1V A;  5C44 K;  3S14 K;  1YNJ A;  1L0W A;  1YX2 A;  1O24 A;  2RH6 A;  2R7Z A;  3HOW K;  2WAQ D;  3GTM K;  5IOQ A;  1Y1W K;  4FM9 A;  2GSO A;  3L4K A;  1B4A A;  4DDQ A;  4C3J C;  3HOU C;  1I3Q A;  3OPF A;  2NVY C;  1ZVU A;  1BDF A;  1K83 A;  2R93 A;  2PMZ L;  4LQY A;  4KDD A;  3I4M K;  4GTA A;  1IQ0 A;  4Q4Z A;  4A3M C;  4G0V A;  2GSN A;  1BJT A;  1ZYR A;  4KMU A;  5D4D A;  4A3K K;  3T02 A;  1O29 A;  1WOP A;  3BUE A;  3S16 C;  1JQW A;  1HI9 A;  5IYC C;  1SFO C;  2E2J K;  4LR2 A;  1O2B A;  2JA7 A;  5M5X K;  2E2I C;  5IOS A;  1EFW A;  2NVQ C;  4LK1 A;  3LAP A;  1WSV A;  4C45 A;  1ISE A;  4BXX C;  3FOE A;  3RZO C;  4FZB A;  4BBR C;  3ORE A;  4A3E C;  2JH3 A;  4KAS A;  2VUM K;  3PO3 C;  2PMZ D;  1XZQ B;  1TWF A;  2JA8 C;  3CQZ A;  2FQO A;  3H0G A;  1I6H C;  4C3I C;  3OEP A;  3AD8 C;  4GTC A;  2R93 K;  4KAW X;  3DXJ A;  2E2H A;  1J6V A;  1TWG A;  1I50 A;  2ZUE A;  4XLP A;  1F9N A;  1DCO A;  2W7V A;  2KWA A;  3ADA C;  4C3H C;  3HOX C;  2V6U A;  5C4J C;  1DCH A;  3G4A A;  1WOS A;  4C3J K;  3GTM A;  1AB4 A;  1Y1W A;  4X6A C;  4G7O A;  2NVX C;  2JA7 K;  1C0A A;  4Y52 C;  1J6X A;  1ZXO A;  4KMA A;  4KAT A;  4A93 C;  4WJ4 A;  1JVI A;  4QJV B;  3Q3Q A;  1XZP B;  1USM A;  1R9T C;  2JA5 A;  3TFH A;  4Q5S A;  3HOZ C;  4KB2 A;  5IOR A;  2Y0S L;  4A3D K;  5TMC A;  3S2D C;  3S16 K;  4XCH A;  1PJ7 A;  5IYC K;  5C4X K;  4PAB A;  1EH1 A;  1SFO K;  1EQR A;  5C3E C;  2E2H K;  4WIL A;  4A3J C;  3IPJ A;  4KMD A;  4QIW L;  2PPB A;  3GTP C;  4GFQ A;  4AYB L;  2CFA B;  3GTJ A;  2NVQ K;  4KN7 A;  2B63 C;  2JA6 C;  1X31 C;  1O26 A;  1INN A;  3GTQ C;  3GTG K;  3I4N K;  1O28 A;  4J3N A;  1WQG A;  1F7U A;  1YNN A;  3PO3 K;  1WQF A;  1I6H K;  4OIQ A;  4C3I K;  1UV7 A;  1IW7 A;  1F93 A;  1O2A A;  2VUM A;  3TFI A;  2RGR A;  1PJ6 A;  3M3Y K;  4A3G K;  4C3H K;  4A3F C;  2Y0S D;  1RU0 A;  3HOX K;  5M5W K;  3S1Q C;  2JA5 K;  1VH2 A;  4OIR A;  4QIW D;  3S15 C;  5IP9 C;  4OIP A;  1BGW A;  3S17 K;  4A3L C;  4AYB D;  1JOE A;  1XXB A;  3S1N C;  5IYD K;  1O2F B;  3S0X A;  4QJV A;  1ZBS A;  2A6H A;  4X6A K;  1IBA A;  1XZP A;  1WCM K;  2NVX K;  3M4O C;  1VRQ C;  1EI6 A;  1IL2 A;  1PJ5 A;  4MEY A;  3HOV K;  1J98 A;  3GTJ K;  5CJ9 A;  4KMH A;  1I6V A;  1SMY A;  1TWH C;  4BLA A;  5IYB K;  2NVY A;  4A93 K;  3L4J A;  1G51 A;  2O5I A;  3GEH A;  1R9T K;  2R92 C;  3S1M C;  3HOZ K;  2CFA A;  2FQT A;  3GTO C;  4A3C C;  3S2D K;  3BP3 A;  4YFN A;  5CHP A;  4C2M C;  3HOY C;  3FOF A;  4KC6 A;  2GSU A;  1F7V A;  3WOD A;  4Y7N K;  3K7A C;  5C3E K;  3FKI C;  4A3B C;  3S1R K;  3GTP K;  5IP7 C;  3GTL C;  4LK0 A;  3AQP A;  2YU9 C;  2B63 K;  1SFO A;  3PO2 C;  3GTQ K;  2E2I A;  2PHC B;  1B4B A;  3GSI A;  2V6S A;  3NUH A;  3HOW C;  3S2H C;  3VA7 A;  3GTG A;  2O5J A;  1TWC C;  1IE0 A;  1WIH A;  3FHZ A;  5FLM C;  3HOU K;  3T00 A;  3LPX A;  2NVY K;  4AH6 A;  3GEI A;  4PAA A;  4G0W A;  3H3V L;  3AH5 A;  1TWA C;  3S1Q K;  2EBB A;  3SZZ A;  1IS1 A;  1XXC A;  4GT9 A;  2CW0 A;  4O2D A;  4RMF A;  4GTD A;  2XCR B;  3S15 K;  4A3M K;  3S1N K;  1WOO A;  2P5M A;  5TJ3 A;  1YCL A;  1DCP A;  4A3K C;  4YFK A;  2P8T A;  4P9S A; 
#chains in the Genus database with same CATH homology
 3GTK C;  1IW7 A;  5IYC C;  1TWH K;  3RZD C;  1SFO C;  2E2J K;  4ZH4 A;  1K83 K;  4A3F K;  3M3Y K;  3S16 C;  1Y1V C;  4A3G K;  4C3H K;  4A3F C;  2E2I K;  2Y0S D;  3M3Y C;  4A3G C;  5M5X K;  2E2I C;  3EQL A;  3HOX K;  2R7Z C;  5M5W K;  2NVQ C;  3S1Q C;  4MQ9 A;  4LK1 A;  4NOI A;  5FJ8 K;  4A3I C;  2PA8 D;  2WB1 L;  2JA5 K;  5M5Y K;  4OIR A;  4BXX K;  2JA5 C;  5IP9 K;  3RZO K;  4BXX C;  4A3L K;  4QIW D;  3S15 C;  3H3V D;  5IP9 C;  4OIP A;  4BBR K;  3HOY K;  4A3E K;  3I4M C;  3RZO C;  3S17 K;  4AYB D;  1XPP A;  4BBR C;  4A3L C;  4A3E C;  3S17 C;  3S1N C;  5IYD K;  3K7A K;  4QJV A;  3M4O K;  2A6H A;  5IYD C;  2JA8 K;  2VUM K;  3PO3 C;  2PMZ D;  4X6A K;  3GTL K;  3M4O C;  1WCM K;  4G7H A;  1I3Q C;  2NVX K;  2JA8 C;  2YU9 K;  1WCM C;  4XSZ A;  4MEY A;  3HOV K;  4JK1 A;  4BY7 K;  1I6H C;  3HKZ L;  3GTJ K;  3HOV C;  1I6V A;  3GTJ C;  1TWH C;  1SMY A;  2WAQ L;  2R93 K;  5IYB K;  2E2J C;  3DXJ A;  1K83 C;  4A93 K;  2R93 C;  5IYB C;  4XLP A;  2A69 A;  2O5I A;  3S1M K;  2R92 K;  3HOX C;  3S2H K;  1R9T K;  2R92 C;  3S1M C;  4YFX A;  5C4J K;  3GTO K;  4BY1 K;  3HOZ K;  4A3C K;  1TWC K;  4LLG A;  2A6E A;  5C4J C;  3GTO C;  4A3C C;  4C2M K;  3S2D K;  2BE5 A;  1TWF K;  4YFN A;  2A68 A;  5FLM K;  3HOY C;  3CQZ K;  3H0G K;  4C3J K;  4XLN A;  3FKI K;  3WOD A;  4Y7N K;  4A3B K;  3K7A C;  2WB1 D;  5C3E K;  3FKI C;  5IP7 K;  4Y7N C;  3S1R K;  2VUM C;  3GTP K;  4A3B C;  4X6A C;  4G7O A;  5IP7 C;  4XSX A;  1TWG K;  3S1R C;  2NVX C;  1I50 K;  2JA7 K;  2NVT K;  3GTL C;  1TWA K;  4Y52 K;  4LK0 A;  2YU9 C;  3PO2 K;  2JA7 C;  4BBS K;  4Y52 C;  2B63 K;  4BY7 C;  3PO2 C;  1HQM A;  3GTQ K;  5C44 K;  3S14 K;  1YNJ A;  4A93 C;  4QJV B;  3HOW K;  3HKZ D;  3HOW C;  3S2H C;  1R9T C;  2WAQ D;  5M3F K;  4Q5S A;  3GTM K;  4GZY A;  3HOZ C;  4BY1 C;  5M3M K;  2O5J A;  1TWC C;  1Y1W K;  2Y0S L;  4A3D K;  5TMC A;  3S2D C;  4LJZ A;  3S16 K;  1TWF C;  4G7Z A;  3GTK K;  4A3D C;  4YG2 A;  3RZD K;  5IYC K;  5FLM C;  5C4X K;  3CQZ C;  3HOU K;  4KN4 A;  3H0G C;  1SFO K;  5C4X C;  3HOU C;  2PA8 L;  1Y1V K;  4A3J K;  2NVY K;  5C3E C;  2E2H K;  4A3J C;  3GTP C;  2NVY C;  4QIW L;  2E2H C;  2PPB A;  3H3V L;  1TWG C;  1I50 C;  2NVT C;  4AYB L;  1TWA C;  2JA6 K;  2R7Z K;  2NVQ K;  3S1Q K;  4MEX A;  1BDF A;  4KN7 A;  4OIO A;  2B63 C;  2JA6 C;  4BBS C;  4A3I K;  3GTQ C;  5C44 C;  3S14 C;  3GTG K;  2PMZ L;  2CW0 A;  3S15 K;  3I4N K;  3GTG C;  4A3M K;  3I4M K;  3I4N C;  4Q4Z A;  4A3M C;  3S1N K;  1YNN A;  4OIN A;  1ZYR A;  4KMU A;  3PO3 K;  5D4D A;  4A3K K;  5TMF A;  1I3Q K;  3GTM C;  4A3K C;  1Y1W C;  4YFK A;  1I6H K;  4OIQ A;  4C3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...