1I6HK

Rna polymerase ii elongation complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6hK00
4A3DK 3I4NK 2A69A 4A3MK 5IP9K 2PPBA 3S16C 4A93K 4XSXA 4Q5SA 2A68A 1IW7A 1TWCC 2WAQD 2PMZD 3HOXK 1TWFK 3HOYC 4QJVA 5FLMK 3PO2K 4C3HK 1I3QC 4MQ9A 5M5WK 4A3FC 5C4JC 3S1RC 4A3CK 2E2JK 2JA7C 3GTOK 5D4DA 4XLPA 3S2DK 4AYBD 3S1NC 4QIWL 2NVQK 3HOXC 1TWFC 2PA8D 5C4XK 5M5XK 5FJ8K 4C3IK 4A3CC 3K7AK 3GTLC 4A3GC 3CQZC 3GTGC 4C2MK 4A3BK 1I50K 1Y1VC 5C44C 4LJZA 2YU9K 2R92C 1WCMC 4A3JK 4BY1K 2NVQC 4A3KC 3S17C 2JA6K 3M4OC 1I6VA 4QJVB 1K83C 3K7AC 1SFOK 4A3BC 2E2IK 1BDFA 2R93K 4OIQA 4A3JC 2Y0SL 4Q4ZA 3S1MC 3HOVC 3M3YK 3H3VL 4ZH4A 4X6AC 4A3GK 3FKIK 3GTKK 4A3LK 2E2HK 4A3DC 2WB1D 3I4NC 4A3MC 3S15K 5IP9C 3GTMK 4G7HA 1I6HK 4LK1A 3RZDK 4A93C 3M3YC 2R7ZK 4JK1A 3HOZK 3FKIC 3I4MK 1Y1WK 2E2HC 4BY7K 3PO2C 5TMFA 5FLMC 3S15C 3GTMC 3GTQK 1I6HC 4C3JK 3RZDC 2PMZL 1YNJA 1SMYA 2E2JC 3RZOK 3GTOC 5IP7K 5M3MK 3HOZC 3I4MC 3S2DC 4G7OA 4X6AK 4OIRA 4BBRK 3PO3K 1R9TK 2NVXK 1TWGK 4QIWD 1ZYRA 5C4XC 4KN4A 3GTQC 1I50C 5M3FK 1TWHK 3H0GK 4Y7NK 2NVTK 4OIOA 2YU9C 1TWAK 4BBRC 4LK0A 4BY1C 2BE5A 2NVXC 2JA6C 1TWGC 2JA5K 3S1QK 4A3IK 4XSZA 1SFOC 2VUMK 4BBSK 4G7ZA 4BXXK 2E2IC 2O5JA 1TWHC 3H0GC 3GTJK 1XPPA 4MEYA 4XLNA 3HKZL 3DXJA 4MEXA 2R93C 5IYDK 2B63K 3S14K 3HOUK 3S1QC 3HOWK 3GTKC 3H3VD 4A3IC 3EQLA 4A3LC 4BXXC 3S16K 2A6HA 4NOIA 3S14C 2WAQL 1TWCK 1YNNA 2WB1L 2R7ZC 3HOWC 1Y1WC 4GZYA 3HOYK 2NVYK 4BY7C 5TMCA 1I3QK 4KMUA 4A3FK 3S1RK 5C4JK 4YFXA 2JA7K 4Y52K 4AYBL 3RZOC 4YFKA 5IP7C 3S1NK 2PA8L 4A3EK 4LLGA 5IYBK 3GTPK 2NVYC 1R9TC 3PO3C 2CW0A 5C3EK 3GTLK 3CQZK 5M5YK 3GTGK 4KN7A 2JA8K 5C44K 1Y1VK 4Y52C 4YG2A 2NVTC 4Y7NC 2R92K 1WCMK 5IYCK 3S17K 3M4OK 4A3KK 4A3EC 3S2HK 1TWAC 5IYBC 3GTPC 1K83K 4YFNA 4OIPA 5C3EC 1HQMA 2Y0SD 3WODA 2JA5C 2JA8C 4BBSC 2VUMC 2A6EA 3GTJC 5IYCC 3S1MK 5IYDC 3S2HC 2O5IA 3HOVK 2B63C 3HKZD 4OINA 3HOUC
chains in the Genus database with same CATH superfamily
3GTJA 3I4NK 2PPBA 3S16C 2XCRB 2ZUEA 2KWAA 4LQYA 1TWCC 1DCPA 4KARA 1USMA 5C4JC 2V6SA 1TWCA 2PHCB 3GTOK 1V5VA 4KMDA 1TWFC 1YX2A 2PA8D 1KQ4A 4A3CC 3GDZA 1I50K 5C44C 5HL8A 1ZXOA 3M4OC 1TWFA 4BY1K 2NVQC 4A3KC 1BS2A 3AH5A 1SFOK 1BDFA 4OIQA 4A3JC 2Y0SL 2W7VA 4ZH4A 3VA7A 3TFIA 4A3LK 3I4NC 1G51A 1O24A 1VH2A 4KAWX 2CFAA 3HOZK 5TMFA 3GTMC 1XZQB 1SMYA 2GSNA 4GFQA 3GTOC 4KB2A 3GTMA 4QIWD 2GSUA 1VGXA 3GTOA 1EQRA 1I50C 1TWHK 4BY1C 4BBRC 4GTAA 4LK0A 1TWGC 1I50A 2O5JA 1SFOC 4BBSK 1XPPA 1TWGA 1WSRA 3AD7C 1SFOA 4A3IC 4A3LC 1ISEA 3S14C 1O26A 3N0CA 3AD8C 1HI9A 2P5MA 3T02A 4GZYA 4PAAA 1F9NA 4KMUA 2JA7K 1O2FB 3S1NK 3LPXA 5C3EK 3CQZK 4KN7A 5IOSA 1WCMK 4G0UA 3S2HK 3GTPC 1K83K 4YFNA 3GEHA 1EK8A 4KASA 4BBSC 4KATA 2O5IA 3HOVK 3OREA 1IL2A 4AH6A 4GT9A 5IP9K 4Q5SA 2A68A 1IW7A 3AD9C 1WQHA 4BLBA 1IQ0A 1TWFK 1XZPB 5FLMK 4A3CK 4BKWA 3G4CA 2E2JK 2JA7C 3A8JA 5D4DA 4AYBD 3S1NC 2NVQK 2JA7A 1O25A 3CQZC 2FQTA 1WCMC 4A3JK 3CQZA 1K83C 1I6VA 4QJVB 1DCHA 4A3BC 1WCMA 3ADAC 1UV7A 2R93K 1K83A 3FOFA 3HOVC 1L0WA 3H3VL 1C0AA 3GEIA 1J6WA 5IP9C 1VJEA 3GTMK 3FKIC 1PJ6A 4BY7K 3ERED 5FLMC 3S15C 4J3NA 1BGWA 3FKIA 2E2JC 1USOA 4BBRK 1R9TK 1TWGK 1ZYRA 3A8IA 5CHPA 4KN4A 3GTQC 4GTBA 1XXCA 4Y7NK 2NVTK 4OIOA 1TWAK 2BE5A 1B4BA 2NVXC 3GTQA 2JA5K 3SZYA 3BP3A 4A3IK 2VUMK 4MEXA 4MEYA 4XLNA 3HKZL 3DXJA 2R93C 2NVXA 5IYDK 3S14K 2RGRA 1RU0A 1IE0A 4O2DA 4BXXC 2R93A 4NOIA 1GE9A 4PABA 1EFWA 1JVIA 3HOYK 4BY7C 3S1RK 3AQPA 4YFXA 1O27A 4YFKA 2PA8L 3GTPK 2NVYC 1R9TC 2CW0A 4Y52C 1Y1VK 2D6FC 2NVTC 4Y7NC 1XXBA 2R92K 1EH1A 2NVYA 1R9TA 3S17K 1TWAC 5IYBC 1INNA 2JA5C 1HQMA 1WORA 4P5BA 2FQOA 2VUMC 1TWAA 5TJ3A 3A8KA 5IYDC 3S1MK 2JA5A 1AB4A 5M5YK 4X6AK 1PJ7A 4OINA 3SZZA 2VUMA 3LAPA 4A3DK 4A3MK 4A93K 2WAQD 2PMZD 3HOYC 2P8TA 3S1RC 5M5WK 3HXAA 1B4AA 4P5AA 4G0WA 4QIWL 3HOXC 5M5XK 4A3GC 1J6XA 4C3HC 4C2MK 4A3BK 1Y1VC 5CJ9A 4KC6A 2YU9K 2R92C 3S17C 3GTPA 4KM9A 3K7AC 1Y1VA 3G4AA 2E2IK 2R92A 3S1MC 4Q4ZA 1XZQA 4X6AC 3FKIK 3T01A 3GTKK 3CAGA 4A3DC 1EI6A 4A3MC 1DCOA 3S15K 4G7HA 1WSVA 4LK1A 1VRQC 4A93C 3M3YC 2R7ZK 1DD5A 2JH3A 4GTLA 4JK1A 1O28A 1Y1WK 5EGEA 2E2HC 3TFHA 3GTQK 1I6HC 1IBAA 4C3JK 3RZDC 2PMZL 4GTFA 1WOPA 2E2HA 3I4MC 2GSOA 1O2BA 3PO3K 2NVXK 1WQGA 2CFAB 4C2MC 5M3FK 2XCOA 2YU9C 4BLAA 2EBBA 1JOEA 5JVOA 4XSZA 5IOTA 3S0XA 4G7ZA 2E2IC 2YU9A 3H0GC 4BXXK 3V4GA 1WOOA 2B63K 2V6TA 3S1QC 3GTKC 2E2IA 3H0GA 3EQLA 1F7UA 4KMAA 3GTKA 1YNNA 2R7ZC 3HOWC 1Y1WC 3AQOA 2NVYK 5L46A 1I3QK 1YCLA 4A3FK 3QX3A 4Y52K 2R7ZA 4AYBL 4C3JC 4KM8A 1Y1WA 4GTEA 4LLGA 5JFEA 5IYBK 3PO3C 3TTGA 3GTLK 1WOSA 3GTGK 4YG2A 4GTDA 2GAGC 4A3EC 4WILA 4XCHA 4OIPA 3WODA 2JA8C 1IS1A 1XZPA 3OPFA 2A6EA 5IYCC 4DDQA 2B63C 1O29A 2A69A 3L4JA 2B63A 3N3YA 4XSXA 5E68A 1O2AA 3BP8C 3TFJA 2ZFZA 3HOXK 1X31C 3PO2K 4A3GK 4QJVA 5EGHA 1I3QC 4MQ9A 4KMHA 4C3HK 4A3FC 4KB4A 1JQWA 4XLPA 3S2DK 4FM9A 3GIRA 3T00A 1I3QA 1WIHA 5C4XK 5FJ8K 4C3IK 3K7AK 3GTLC 3BUEA 3NUHA 3GTGC 2V6UA 3N0BA 4LJZA 1XXAA 2JA6K 3GTLA 3GTGA 4M1XA 3M3YK 4LOWA 3FOEA 1BJTA 2E2HK 1J6VA 2WB1D 2RH6A 3OEPA 1I6HK 4C45A 1PJ5A 3RZDK 1F7VA 3I4MK 3FHZA 4WJ3M 2XCQA 3PO2C 1YNJA 4G7OA 3RZOK 5IP7K 5M3MK 3HOZC 3S2DC 4OIRA 1F93A 3Q3QA 5C4XC 4C3IC 4RMFA 3H0GK 4P9SA 2JA6C 3S1QK 4FZBA 4GTCA 1TWHC 3GTJK 2JA6A 3HOUK 3HOWK 3H3VD 1TWHA 3IPJA 3S16K 2A6HA 4KDDA 2WAQL 1TWCK 2WB1L 3LAJA 5IORA 5TMCA 4LR2A 5C4JK 2GAHC 3RZOC 5IP7C 3GSIA 4A3EK 4ILDA 1WQFA 2JA8K 3MMLB 5C44K 1VLOA 3M4OK 5IYCK 4A3KK 1ZBSA 2ZUFA 3GEEA 2Y3PA 5C3EC 1ZVUA 2Y0SD 3JSTA 3L4KA 1J98A 4G0VA 3GTJC 4WJ4A 5IOQA 3S2HC 3HKZD 1ZQ1C 3HOUC
chains in the Genus database with same CATH topology
4A3DK 3I4NK 2A69A 4A3MK 5IP9K 2PPBA 3S16C 4A93K 4XSXA 4Q5SA 2A68A 1IW7A 1TWCC 2WAQD 2PMZD 3HOXK 1TWFK 3HOYC 4QJVA 5FLMK 3PO2K 4C3HK 1I3QC 4MQ9A 5M5WK 4A3FC 5C4JC 3S1RC 4A3CK 2E2JK 2JA7C 3GTOK 5D4DA 4XLPA 3S2DK 4AYBD 3S1NC 4QIWL 2NVQK 3HOXC 1TWFC 2PA8D 5C4XK 5M5XK 5FJ8K 4C3IK 4A3CC 3K7AK 3GTLC 4A3GC 3CQZC 3GTGC 4C2MK 4A3BK 1I50K 1Y1VC 5C44C 4LJZA 2YU9K 2R92C 1WCMC 4A3JK 4BY1K 2NVQC 4A3KC 3S17C 2JA6K 3M4OC 1I6VA 4QJVB 1K83C 3K7AC 1SFOK 4A3BC 2E2IK 1BDFA 2R93K 4OIQA 4A3JC 2Y0SL 4Q4ZA 3S1MC 3HOVC 3M3YK 3H3VL 4ZH4A 4X6AC 4A3GK 3FKIK 3GTKK 4A3LK 2E2HK 4A3DC 2WB1D 3I4NC 4A3MC 3S15K 5IP9C 3GTMK 4G7HA 1I6HK 4LK1A 3RZDK 4A93C 3M3YC 2R7ZK 4JK1A 3HOZK 3FKIC 3I4MK 1Y1WK 2E2HC 4BY7K 3PO2C 5TMFA 5FLMC 3S15C 3GTMC 3GTQK 1I6HC 4C3JK 3RZDC 2PMZL 1YNJA 1SMYA 2E2JC 3RZOK 3GTOC 5IP7K 5M3MK 3HOZC 3I4MC 3S2DC 4G7OA 4X6AK 4OIRA 4BBRK 3PO3K 1R9TK 2NVXK 1TWGK 4QIWD 1ZYRA 5C4XC 4KN4A 3GTQC 1I50C 5M3FK 1TWHK 3H0GK 4Y7NK 2NVTK 4OIOA 2YU9C 1TWAK 4BBRC 4LK0A 4BY1C 2BE5A 2NVXC 2JA6C 1TWGC 2JA5K 3S1QK 4A3IK 4XSZA 1SFOC 2VUMK 4BBSK 4G7ZA 4BXXK 2E2IC 2O5JA 1TWHC 3H0GC 3GTJK 1XPPA 4MEYA 4XLNA 3HKZL 3DXJA 4MEXA 2R93C 5IYDK 2B63K 3S14K 3HOUK 3S1QC 3HOWK 3GTKC 3H3VD 4A3IC 3EQLA 4A3LC 4BXXC 3S16K 2A6HA 4NOIA 3S14C 2WAQL 1TWCK 1YNNA 2WB1L 2R7ZC 3HOWC 1Y1WC 4GZYA 3HOYK 2NVYK 4BY7C 5TMCA 1I3QK 4KMUA 4A3FK 3S1RK 5C4JK 4YFXA 2JA7K 4Y52K 4AYBL 3RZOC 4YFKA 5IP7C 3S1NK 2PA8L 4A3EK 4LLGA 5IYBK 3GTPK 2NVYC 1R9TC 3PO3C 2CW0A 5C3EK 3GTLK 3CQZK 5M5YK 3GTGK 4KN7A 2JA8K 5C44K 1Y1VK 4Y52C 4YG2A 2NVTC 4Y7NC 2R92K 1WCMK 5IYCK 3S17K 3M4OK 4A3KK 4A3EC 3S2HK 1TWAC 5IYBC 3GTPC 1K83K 4YFNA 4OIPA 5C3EC 1HQMA 2Y0SD 3WODA 2JA5C 2JA8C 4BBSC 2VUMC 2A6EA 3GTJC 5IYCC 3S1MK 5IYDC 3S2HC 2O5IA 3HOVK 2B63C 3HKZD 4OINA 3HOUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3D K;  3I4N K;  2A69 A;  4A3M K;  5IP9 K;  2PPB A;  3S16 C;  4A93 K;  4XSX A;  4Q5S A;  2A68 A;  1IW7 A;  1TWC C;  2WAQ D;  2PMZ D;  3HOX K;  1TWF K;  3HOY C;  4QJV A;  5FLM K;  3PO2 K;  4C3H K;  1I3Q C;  4MQ9 A;  5M5W K;  4A3F C;  5C4J C;  3S1R C;  4A3C K;  2E2J K;  2JA7 C;  3GTO K;  5D4D A;  4XLP A;  3S2D K;  4AYB D;  3S1N C;  4QIW L;  2NVQ K;  3HOX C;  1TWF C;  2PA8 D;  5C4X K;  5M5X K;  5FJ8 K;  4C3I K;  4A3C C;  3K7A K;  3GTL C;  4A3G C;  3CQZ C;  3GTG C;  4C2M K;  4A3B K;  1I50 K;  1Y1V C;  5C44 C;  4LJZ A;  2YU9 K;  2R92 C;  1WCM C;  4A3J K;  4BY1 K;  2NVQ C;  4A3K C;  3S17 C;  2JA6 K;  3M4O C;  1I6V A;  4QJV B;  1K83 C;  3K7A C;  1SFO K;  4A3B C;  2E2I K;  1BDF A;  2R93 K;  4OIQ A;  4A3J C;  2Y0S L;  4Q4Z A;  3S1M C;  3HOV C;  3M3Y K;  3H3V L;  4ZH4 A;  4X6A C;  4A3G K;  3FKI K;  3GTK K;  4A3L K;  2E2H K;  4A3D C;  2WB1 D;  3I4N C;  4A3M C;  3S15 K;  5IP9 C;  3GTM K;  4G7H A;  1I6H K;  4LK1 A;  3RZD K;  4A93 C;  3M3Y C;  2R7Z K;  4JK1 A;  3HOZ K;  3FKI C;  3I4M K;  1Y1W K;  2E2H C;  4BY7 K;  3PO2 C;  5TMF A;  5FLM C;  3S15 C;  3GTM C;  3GTQ K;  1I6H C;  4C3J K;  3RZD C;  2PMZ L;  1YNJ A;  1SMY A;  2E2J C;  3RZO K;  3GTO C;  5IP7 K;  5M3M K;  3HOZ C;  3I4M C;  3S2D C;  4G7O A;  4X6A K;  4OIR A;  4BBR K;  3PO3 K;  1R9T K;  2NVX K;  1TWG K;  4QIW D;  1ZYR A;  5C4X C;  4KN4 A;  3GTQ C;  1I50 C;  5M3F K;  1TWH K;  3H0G K;  4Y7N K;  2NVT K;  4OIO A;  2YU9 C;  1TWA K;  4BBR C;  4LK0 A;  4BY1 C;  2BE5 A;  2NVX C;  2JA6 C;  1TWG C;  2JA5 K;  3S1Q K;  4A3I K;  4XSZ A;  1SFO C;  2VUM K;  4BBS K;  4G7Z A;  4BXX K;  2E2I C;  2O5J A;  1TWH C;  3H0G C;  3GTJ K;  1XPP A;  4MEY A;  4XLN A;  3HKZ L;  3DXJ A;  4MEX A;  2R93 C;  5IYD K;  2B63 K;  3S14 K;  3HOU K;  3S1Q C;  3HOW K;  3GTK C;  3H3V D;  4A3I C;  3EQL A;  4A3L C;  4BXX C;  3S16 K;  2A6H A;  4NOI A;  3S14 C;  2WAQ L;  1TWC K;  1YNN A;  2WB1 L;  2R7Z C;  3HOW C;  1Y1W C;  4GZY A;  3HOY K;  2NVY K;  4BY7 C;  5TMC A;  1I3Q K;  4KMU A;  4A3F K;  3S1R K;  5C4J K;  4YFX A;  2JA7 K;  4Y52 K;  4AYB L;  3RZO C;  4YFK A;  5IP7 C;  3S1N K;  2PA8 L;  4A3E K;  4LLG A;  5IYB K;  3GTP K;  2NVY C;  1R9T C;  3PO3 C;  2CW0 A;  5C3E K;  3GTL K;  3CQZ K;  5M5Y K;  3GTG K;  4KN7 A;  2JA8 K;  5C44 K;  1Y1V K;  4Y52 C;  4YG2 A;  2NVT C;  4Y7N C;  2R92 K;  1WCM K;  5IYC K;  3S17 K;  3M4O K;  4A3K K;  4A3E C;  3S2H K;  1TWA C;  5IYB C;  3GTP C;  1K83 K;  4YFN A;  4OIP A;  5C3E C;  1HQM A;  2Y0S D;  3WOD A;  2JA5 C;  2JA8 C;  4BBS C;  2VUM C;  2A6E A;  3GTJ C;  5IYC C;  3S1M K;  5IYD C;  3S2H C;  2O5I A;  3HOV K;  2B63 C;  3HKZ D;  4OIN A;  3HOU C; 
#chains in the Genus database with same CATH topology
 3GTJ A;  3I4N K;  2PPB A;  3S16 C;  2XCR B;  2ZUE A;  2KWA A;  4LQY A;  1TWC C;  1DCP A;  4KAR A;  1USM A;  5C4J C;  2V6S A;  1TWC A;  2PHC B;  3GTO K;  1V5V A;  4KMD A;  1TWF C;  1YX2 A;  2PA8 D;  1KQ4 A;  4A3C C;  3GDZ A;  1I50 K;  5C44 C;  5HL8 A;  1ZXO A;  3M4O C;  1TWF A;  4BY1 K;  2NVQ C;  4A3K C;  1BS2 A;  3AH5 A;  1SFO K;  1BDF A;  4OIQ A;  4A3J C;  2Y0S L;  2W7V A;  4ZH4 A;  3VA7 A;  3TFI A;  4A3L K;  3I4N C;  1G51 A;  1O24 A;  1VH2 A;  4KAW X;  2CFA A;  3HOZ K;  5TMF A;  3GTM C;  1XZQ B;  1SMY A;  2GSN A;  4GFQ A;  3GTO C;  4KB2 A;  3GTM A;  4QIW D;  2GSU A;  1VGX A;  3GTO A;  1EQR A;  1I50 C;  1TWH K;  4BY1 C;  4BBR C;  4GTA A;  4LK0 A;  1TWG C;  1I50 A;  2O5J A;  1SFO C;  4BBS K;  1XPP A;  1TWG A;  1WSR A;  3AD7 C;  1SFO A;  4A3I C;  4A3L C;  1ISE A;  3S14 C;  1O26 A;  3N0C A;  3AD8 C;  1HI9 A;  2P5M A;  3T02 A;  4GZY A;  4PAA A;  1F9N A;  4KMU A;  2JA7 K;  1O2F B;  3S1N K;  3LPX A;  5C3E K;  3CQZ K;  4KN7 A;  5IOS A;  1WCM K;  4G0U A;  3S2H K;  3GTP C;  1K83 K;  4YFN A;  3GEH A;  1EK8 A;  4KAS A;  4BBS C;  4KAT A;  2O5I A;  3HOV K;  3ORE A;  1IL2 A;  4AH6 A;  4GT9 A;  5IP9 K;  4Q5S A;  2A68 A;  1IW7 A;  3AD9 C;  1WQH A;  4BLB A;  1IQ0 A;  1TWF K;  1XZP B;  5FLM K;  4A3C K;  4BKW A;  3G4C A;  2E2J K;  2JA7 C;  3A8J A;  5D4D A;  4AYB D;  3S1N C;  2NVQ K;  2JA7 A;  1O25 A;  3CQZ C;  2FQT A;  1WCM C;  4A3J K;  3CQZ A;  1K83 C;  1I6V A;  4QJV B;  1DCH A;  4A3B C;  1WCM A;  3ADA C;  1UV7 A;  2R93 K;  1K83 A;  3FOF A;  3HOV C;  1L0W A;  3H3V L;  1C0A A;  3GEI A;  1J6W A;  5IP9 C;  1VJE A;  3GTM K;  3FKI C;  1PJ6 A;  4BY7 K;  3ERE D;  5FLM C;  3S15 C;  4J3N A;  1BGW A;  3FKI A;  2E2J C;  1USO A;  4BBR K;  1R9T K;  1TWG K;  1ZYR A;  3A8I A;  5CHP A;  4KN4 A;  3GTQ C;  4GTB A;  1XXC A;  4Y7N K;  2NVT K;  4OIO A;  1TWA K;  2BE5 A;  1B4B A;  2NVX C;  3GTQ A;  2JA5 K;  3SZY A;  3BP3 A;  4A3I K;  2VUM K;  4MEX A;  4MEY A;  4XLN A;  3HKZ L;  3DXJ A;  2R93 C;  2NVX A;  5IYD K;  3S14 K;  2RGR A;  1RU0 A;  1IE0 A;  4O2D A;  4BXX C;  2R93 A;  4NOI A;  1GE9 A;  4PAB A;  1EFW A;  1JVI A;  3HOY K;  4BY7 C;  3S1R K;  3AQP A;  4YFX A;  1O27 A;  4YFK A;  2PA8 L;  3GTP K;  2NVY C;  1R9T C;  2CW0 A;  4Y52 C;  1Y1V K;  2D6F C;  2NVT C;  4Y7N C;  1XXB A;  2R92 K;  1EH1 A;  2NVY A;  1R9T A;  3S17 K;  1TWA C;  5IYB C;  1INN A;  2JA5 C;  1HQM A;  1WOR A;  4P5B A;  2FQO A;  2VUM C;  1TWA A;  5TJ3 A;  3A8K A;  5IYD C;  3S1M K;  2JA5 A;  1AB4 A;  5M5Y K;  4X6A K;  1PJ7 A;  4OIN A;  3SZZ A;  2VUM A;  3LAP A;  4A3D K;  4A3M K;  4A93 K;  2WAQ D;  2PMZ D;  3HOY C;  2P8T A;  3S1R C;  5M5W K;  3HXA A;  1B4A A;  4P5A A;  4G0W A;  4QIW L;  3HOX C;  5M5X K;  4A3G C;  1J6X A;  4C3H C;  4C2M K;  4A3B K;  1Y1V C;  5CJ9 A;  4KC6 A;  2YU9 K;  2R92 C;  3S17 C;  3GTP A;  4KM9 A;  3K7A C;  1Y1V A;  3G4A A;  2E2I K;  2R92 A;  3S1M C;  4Q4Z A;  1XZQ A;  4X6A C;  3FKI K;  3T01 A;  3GTK K;  3CAG A;  4A3D C;  1EI6 A;  4A3M C;  1DCO A;  3S15 K;  4G7H A;  1WSV A;  4LK1 A;  1VRQ C;  4A93 C;  3M3Y C;  2R7Z K;  1DD5 A;  2JH3 A;  4GTL A;  4JK1 A;  1O28 A;  1Y1W K;  5EGE A;  2E2H C;  3TFH A;  3GTQ K;  1I6H C;  1IBA A;  4C3J K;  3RZD C;  2PMZ L;  4GTF A;  1WOP A;  2E2H A;  3I4M C;  2GSO A;  1O2B A;  3PO3 K;  2NVX K;  1WQG A;  2CFA B;  4C2M C;  5M3F K;  2XCO A;  2YU9 C;  4BLA A;  2EBB A;  1JOE A;  5JVO A;  4XSZ A;  5IOT A;  3S0X A;  4G7Z A;  2E2I C;  2YU9 A;  3H0G C;  4BXX K;  3V4G A;  1WOO A;  2B63 K;  2V6T A;  3S1Q C;  3GTK C;  2E2I A;  3H0G A;  3EQL A;  1F7U A;  4KMA A;  3GTK A;  1YNN A;  2R7Z C;  3HOW C;  1Y1W C;  3AQO A;  2NVY K;  5L46 A;  1I3Q K;  1YCL A;  4A3F K;  3QX3 A;  4Y52 K;  2R7Z A;  4AYB L;  4C3J C;  4KM8 A;  1Y1W A;  4GTE A;  4LLG A;  5JFE A;  5IYB K;  3PO3 C;  3TTG A;  3GTL K;  1WOS A;  3GTG K;  4YG2 A;  4GTD A;  2GAG C;  4A3E C;  4WIL A;  4XCH A;  4OIP A;  3WOD A;  2JA8 C;  1IS1 A;  1XZP A;  3OPF A;  2A6E A;  5IYC C;  4DDQ A;  2B63 C;  1O29 A;  2A69 A;  3L4J A;  2B63 A;  3N3Y A;  4XSX A;  5E68 A;  1O2A A;  3BP8 C;  3TFJ A;  2ZFZ A;  3HOX K;  1X31 C;  3PO2 K;  4A3G K;  4QJV A;  5EGH A;  1I3Q C;  4MQ9 A;  4KMH A;  4C3H K;  4A3F C;  4KB4 A;  1JQW A;  4XLP A;  3S2D K;  4FM9 A;  3GIR A;  3T00 A;  1I3Q A;  1WIH A;  5C4X K;  5FJ8 K;  4C3I K;  3K7A K;  3GTL C;  3BUE A;  3NUH A;  3GTG C;  2V6U A;  3N0B A;  4LJZ A;  1XXA A;  2JA6 K;  3GTL A;  3GTG A;  4M1X A;  3M3Y K;  4LOW A;  3FOE A;  1BJT A;  2E2H K;  1J6V A;  2WB1 D;  2RH6 A;  3OEP A;  1I6H K;  4C45 A;  1PJ5 A;  3RZD K;  1F7V A;  3I4M K;  3FHZ A;  4WJ3 M;  2XCQ A;  3PO2 C;  1YNJ A;  4G7O A;  3RZO K;  5IP7 K;  5M3M K;  3HOZ C;  3S2D C;  4OIR A;  1F93 A;  3Q3Q A;  5C4X C;  4C3I C;  4RMF A;  3H0G K;  4P9S A;  2JA6 C;  3S1Q K;  4FZB A;  4GTC A;  1TWH C;  3GTJ K;  2JA6 A;  3HOU K;  3HOW K;  3H3V D;  1TWH A;  3IPJ A;  3S16 K;  2A6H A;  4KDD A;  2WAQ L;  1TWC K;  2WB1 L;  3LAJ A;  5IOR A;  5TMC A;  4LR2 A;  5C4J K;  2GAH C;  3RZO C;  5IP7 C;  3GSI A;  4A3E K;  4ILD A;  1WQF A;  2JA8 K;  3MML B;  5C44 K;  1VLO A;  3M4O K;  5IYC K;  4A3K K;  1ZBS A;  2ZUF A;  3GEE A;  2Y3P A;  5C3E C;  1ZVU A;  2Y0S D;  3JST A;  3L4K A;  1J98 A;  4G0V A;  3GTJ C;  4WJ4 A;  5IOQ A;  3S2H C;  3HKZ D;  1ZQ1 C;  3HOU C; 
#chains in the Genus database with same CATH homology
 4A3D K;  3I4N K;  2A69 A;  4A3M K;  5IP9 K;  2PPB A;  3S16 C;  4A93 K;  4XSX A;  4Q5S A;  2A68 A;  1IW7 A;  1TWC C;  2WAQ D;  2PMZ D;  3HOX K;  1TWF K;  3HOY C;  4QJV A;  5FLM K;  3PO2 K;  4C3H K;  1I3Q C;  4MQ9 A;  5M5W K;  4A3F C;  5C4J C;  3S1R C;  4A3C K;  2E2J K;  2JA7 C;  3GTO K;  5D4D A;  4XLP A;  3S2D K;  4AYB D;  3S1N C;  4QIW L;  2NVQ K;  3HOX C;  1TWF C;  2PA8 D;  5C4X K;  5M5X K;  5FJ8 K;  4C3I K;  4A3C C;  3K7A K;  3GTL C;  4A3G C;  3CQZ C;  3GTG C;  4C2M K;  4A3B K;  1I50 K;  1Y1V C;  5C44 C;  4LJZ A;  2YU9 K;  2R92 C;  1WCM C;  4A3J K;  4BY1 K;  2NVQ C;  4A3K C;  3S17 C;  2JA6 K;  3M4O C;  1I6V A;  4QJV B;  1K83 C;  3K7A C;  1SFO K;  4A3B C;  2E2I K;  1BDF A;  2R93 K;  4OIQ A;  4A3J C;  2Y0S L;  4Q4Z A;  3S1M C;  3HOV C;  3M3Y K;  3H3V L;  4ZH4 A;  4X6A C;  4A3G K;  3FKI K;  3GTK K;  4A3L K;  2E2H K;  4A3D C;  2WB1 D;  3I4N C;  4A3M C;  3S15 K;  5IP9 C;  3GTM K;  4G7H A;  1I6H K;  4LK1 A;  3RZD K;  4A93 C;  3M3Y C;  2R7Z K;  4JK1 A;  3HOZ K;  3FKI C;  3I4M K;  1Y1W K;  2E2H C;  4BY7 K;  3PO2 C;  5TMF A;  5FLM C;  3S15 C;  3GTM C;  3GTQ K;  1I6H C;  4C3J K;  3RZD C;  2PMZ L;  1YNJ A;  1SMY A;  2E2J C;  3RZO K;  3GTO C;  5IP7 K;  5M3M K;  3HOZ C;  3I4M C;  3S2D C;  4G7O A;  4X6A K;  4OIR A;  4BBR K;  3PO3 K;  1R9T K;  2NVX K;  1TWG K;  4QIW D;  1ZYR A;  5C4X C;  4KN4 A;  3GTQ C;  1I50 C;  5M3F K;  1TWH K;  3H0G K;  4Y7N K;  2NVT K;  4OIO A;  2YU9 C;  1TWA K;  4BBR C;  4LK0 A;  4BY1 C;  2BE5 A;  2NVX C;  2JA6 C;  1TWG C;  2JA5 K;  3S1Q K;  4A3I K;  4XSZ A;  1SFO C;  2VUM K;  4BBS K;  4G7Z A;  4BXX K;  2E2I C;  2O5J A;  1TWH C;  3H0G C;  3GTJ K;  1XPP A;  4MEY A;  4XLN A;  3HKZ L;  3DXJ A;  4MEX A;  2R93 C;  5IYD K;  2B63 K;  3S14 K;  3HOU K;  3S1Q C;  3HOW K;  3GTK C;  3H3V D;  4A3I C;  3EQL A;  4A3L C;  4BXX C;  3S16 K;  2A6H A;  4NOI A;  3S14 C;  2WAQ L;  1TWC K;  1YNN A;  2WB1 L;  2R7Z C;  3HOW C;  1Y1W C;  4GZY A;  3HOY K;  2NVY K;  4BY7 C;  5TMC A;  1I3Q K;  4KMU A;  4A3F K;  3S1R K;  5C4J K;  4YFX A;  2JA7 K;  4Y52 K;  4AYB L;  3RZO C;  4YFK A;  5IP7 C;  3S1N K;  2PA8 L;  4A3E K;  4LLG A;  5IYB K;  3GTP K;  2NVY C;  1R9T C;  3PO3 C;  2CW0 A;  5C3E K;  3GTL K;  3CQZ K;  5M5Y K;  3GTG K;  4KN7 A;  2JA8 K;  5C44 K;  1Y1V K;  4Y52 C;  4YG2 A;  2NVT C;  4Y7N C;  2R92 K;  1WCM K;  5IYC K;  3S17 K;  3M4O K;  4A3K K;  4A3E C;  3S2H K;  1TWA C;  5IYB C;  3GTP C;  1K83 K;  4YFN A;  4OIP A;  5C3E C;  1HQM A;  2Y0S D;  3WOD A;  2JA5 C;  2JA8 C;  4BBS C;  2VUM C;  2A6E A;  3GTJ C;  5IYC C;  3S1M K;  5IYD C;  3S2H C;  2O5I A;  3HOV K;  2B63 C;  3HKZ D;  4OIN A;  3HOU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...