1I6HK

Rna polymerase ii elongation complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6hK00
4BBSC 2Y0SL 2YU9C 2JA5C 3GTLK 4BY7K 1HQMA 1I50K 2CW0A 4A3BC 1TWHK 2PA8L 5IP9C 3HOUK 2YU9K 4A3GK 3DXJA 3M3YK 2A6HA 3HKZD 1WCMC 1BDFA 3S16C 2NVXK 5M3FK 3PO2C 3S1NC 4A3MK 2B63K 3I4MC 4KN4A 3EQLA 4BBRK 3PO2K 1R9TK 4XLNA 5FLMC 2JA6K 4MEYA 3HOVC 1SMYA 2WAQD 2WAQL 4OINA 3HOWK 3S1NK 4GZYA 3S1QC 4QJVB 4AYBD 4A3LC 4YFNA 4C3JK 5C4JC 4MQ9A 3HOWC 1I6VA 1TWHC 5IP9K 3HOUC 3HOYK 5C3EK 3GTJK 2R7ZK 4QIWL 4XSZA 4OIRA 3S17K 3H0GK 3HOXC 4A3EK 4LJZA 5C3EC 3GTJC 5IYCC 4Y52K 4A3CK 4A3DC 3S2DC 2R93C 3S1MC 4Y7NK 5IYBC 3GTQK 4A93C 1TWGC 5TMCA 4A3DK 5IYDK 5IYBK 3GTQC 2Y0SD 3S14C 4X6AC 4Y7NC 2JA7C 3I4NK 1Y1WK 4BBRC 4G7OA 2BE5A 4LK0A 4LK1A 4OIPA 3GTKK 1K83K 4A3JK 2JA7K 3RZDK 3I4NC 4A3LK 4BBSK 2NVYK 3H3VD 3RZOC 4XSXA 4YFXA 1TWCK 3GTKC 3CQZK 4KN7A 3FKIC 3RZDC 4A3CC 4QJVA 2E2HK 2A68A 3S15K 5M5XK 3S17C 2R7ZC 4OIOA 5IYCK 1YNJA 2O5JA 2NVQC 1I50C 4YG2A 5IP7C 5C44C 5M5YK 4YFKA 3I4MK 3GTGC 4OIQA 3S1MK 5C4JK 1Y1VC 3M3YC 3HOVK 3S16K 2R92K 3H0GC 3HOXK 4A3EC 2JA8K 4LLGA 4A3FK 4Y52C 4A3IC 3GTOK 5FJ8K 2PA8D 1SFOK 4BXXK 2NVTK 4Q5SA 4A3IK 4A3FC 5IYDC 1TWCC 1TWFC 2JA5K 4C3IK 2NVTC 2R93K 4BY1C 4A3BK 4KMUA 3S1RK 3HOZC 4A3GC 2WB1L 3HOZK 3HOYC 2A69A 3WODA 3GTLC 2PMZD 5C4XK 1XPPA 2VUMC 1Y1VK 4A3KC 2E2IC 3S2HK 3K7AC 2NVQK 1SFOC 1R9TC 1Y1WC 3GTPC 4NOIA 4BXXC 3FKIK 3K7AK 2NVXC 4XLPA 5M5WK 3M4OK 2R92C 4G7ZA 1I6HC 3GTMC 3PO3K 1I6HK 4QIWD 5C44K 5IP7K 4A3JC 4ZH4A 4MEXA 1I3QK 3PO3C 2NVYC 3GTGK 3RZOK 5M3MK 2E2HC 5TMFA 4AYBL 1I3QC 1ZYRA 3S15C 4A93K 4JK1A 5C4XC 3S14K 1TWAC 4C3HK 4X6AK 4A3KK 2PMZL 2E2IK 1WCMK 3S2HC 1TWAK 1IW7A 3GTPK 1K83C 2WB1D 2E2JK 1YNNA 3GTOC 4A3MC 2B63C 5FLMK 4C2MK 2E2JC 3HKZL 4BY1K 1TWGK 2JA8C 2JA6C 3H3VL 4BY7C 2VUMK 3GTMK 3S1RC 4Q4ZA 3CQZC 4G7HA 5D4DA 2O5IA 2PPBA 3M4OC 3S1QK 1TWFK 3S2DK 2A6EA
chains in the Genus database with same CATH superfamily
4KATA 1WCMA 1HQMA 3HOUK 3OREA 4A3GK 3M3YK 2A6HA 1C0AA 3PO2C 3S1NC 2B63K 3I4MC 2R7ZA 3EQLA 3PO2K 3FKIA 5FLMC 4MEYA 3HOVC 1VLOA 4OINA 2RGRA 4KASA 3OEPA 1IE0A 3AD8C 3HOWC 4G0VA 3HOUC 5C3EK 4QIWL 2V6SA 3H0GK 4KMAA 3GTJC 3HOXC 4A3EK 4A3DC 3S2DC 2R93C 3GTQK 4A93C 1TWGC 1Y1VA 3ERED 1R9TA 4A3DK 4WJ3M 4BBRC 4OIPA 1EI6A 2JH3A 5EGHA 2JA7K 3N0BA 4YFXA 2YU9A 1O26A 2CFAB 3L4KA 3S0XA 1XZQA 4PAAA 1HI9A 2A68A 5IYCK 4KB4A 2NVQC 1I50C 1XZPA 4YFKA 3GTMA 1WOPA 2GAGC 4G0UA 3M3YC 1TWCA 2R92K 4A3IC 1JQWA 3GTOK 4GTFA 4C3JC 4BXXK 4C3IC 2NVTK 5EGEA 4A3IK 1TWFC 4C3IK 2NVTC 1XXAA 3LAJA 3HOZK 3HOYC 2A69A 3WODA 1JOEA 2NVQK 1SFOC 1WIHA 3GTPC 1J98A 3BP3A 4XLPA 1I6HC 1O24A 1O2BA 4G7ZA 4QIWD 1WOSA 1O29A 5IP7K 4ZH4A 1I3QK 3PO3C 3LAPA 3QX3A 2XCQA 2E2HC 1L0WA 4A93K 2NVXA 3MMLB 3G4AA 1TWAK 3TFHA 2E2JK 1YNNA 3GTOC 1WORA 5FLMK 3GEHA 1TWHA 3T02A 2VUMK 3GTMK 3GTLA 2FQTA 1K83A 4BBSC 2YU9C 4BY7K 2JA5C 4PABA 4KM8A 1I50K 2CW0A 5IORA 1F93A 1XXBA 4A3BC 2PA8L 2V6TA 2YU9K 3HKZD 1BDFA 2JA7A 3A8KA 1IBAA 3AD7C 1ZQ1C 4BBRK 1F7UA 1R9TK 4XLNA 4GTDA 2WAQL 3L4JA 4DDQA 1PJ6A 4A3LC 3FOEA 4KM9A 4YFNA 3GTJK 4XSZA 3TTGA 3S17K 5C3EC 5IYCC 1USOA 1AB4A 5CHPA 3S1MC 4Y7NK 4GTAA 4J3NA 5IYBC 1BJTA 5IYBK 4X6AC 2Y0SD 4Y7NC 3SZZA 2JA7C 2B63A 4KC6A 2BE5A 1WSRA 1EFWA 4LK1A 1SFOA 3GTKK 1K83K 4A3JK 2GSUA 4RMFA 1EK8A 2NVYK 3H3VD 1EQRA 3GSIA 4XSXA 2VUMA 3GTKC 3FKIC 3LPXA 3RZDC 4QJVA 3S15K 5M5XK 2R7ZC 1TWAA 4YG2A 1TWFA 3CAGA 5M5YK 2P8TA 3GTGC 4OIQA 3S1MK 1Y1VC 1TWGA 2D6FC 1WQGA 5TJ3A 4BLAA 5IYDC 2PHCB 1F9NA 2JA5K 2NVYA 4P5BA 4KMUA 4A3GC 1JVIA 3GTKA 5C4XK 4C45A 3ADAC 4WJ4A 2JA6A 2NVXC 5M5WK 3GTMC 3PO3K 2W7VA 5C44K 4MEXA 1X31C 3RZOK 3GTGK 5M3MK 1IS1A 5IOQA 1ZXOA 3S15C 1BGWA 3VA7A 2P5MA 4JK1A 3V4GA 3S14K 2ZFZA 4KAWX 1IW7A 1GE9A 1K83C 1ZBSA 1IQ0A 2B63C 3H3VL 4BY1K 4BY7C 4BBSK 1DD5A 2GSNA 2O5IA 3S1QK 3JSTA 2A6EA 1DCHA 1KQ4A 2Y0SL 3GTLK 1TWHK 5IP9C 3OPFA 4GTLA 3DXJA 3GDZA 3GTGA 4BLBA 1VH2A 4M1XA 2NVXK 3IPJA 2JA6K 1SMYA 3HOWK 4GZYA 2ZUFA 4C3JK 1TWHC 5IP9K 2R7ZK 4LJZA 4Y52K 4A3CK 4KB2A 1VRQC 4KARA 5IYDK 3GTQC 3S14C 2JA5A 3N3YA 4G7OA 3I4NC 5HL8A 3RZOC 1G51A 1WOOA 1RU0A 3CQZK 4KN7A 3AD9C 5E68A 3S17C 2O5JA 4G0WA 4KMDA 1O27A 4OIOA 1YNJA 5C44C 3I4MK 5C4JK 4O2DA 5IOTA 3H0GC 3HOXK 4A3EC 2JA8K 4A3FK 4Y52C 5FJ8K 2PA8D 1SFOK 4Q5SA 4A3FC 1V5VA 3NUHA 1PJ7A 3N0CA 4KDDA 4BY1C 4A3BK 3HOZC 2WB1L 3TFIA 4XCHA 4GTBA 3GTJA 1XPPA 2VUMC 1Y1VK 4A3KC 3K7AC 4GTCA 4BXXC 1R9TC 1XZPB 1Y1WC 4C2MC 3H0GA 3K7AK 1J6XA 1ZVUA 3GIRA 2XCOA 2R92C 2V6UA 2NVYC 2ZUEA 5TMFA 4AYBL 1I3QC 4AH6A 1F7VA 5C4XC 4X6AK 1I50A 2E2IK 3S2HC 3BUEA 3HXAA 3GTPK 1YX2A 4A3MC 2JA6C 4C2MK 2E2JC 1EH1A 2JA8C 1USMA 3S1RC 4G7HA 3M4OC 2PPBA 3FOFA 5L46A 3CQZA 4FM9A 1WCMC 4C3HC 1I3QA 3S16C 3AH5A 4LOWA 5M3FK 4A3MK 4KN4A 4WILA 2WAQD 3S1NK 3S1QC 4QJVB 4AYBD 1O25A 4FZBA 5C4JC 4MQ9A 4A3CC 1I6VA 1B4BA 1DCOA 2RH6A 2Y3PA 3HOYK 4OIRA 3TFJA 5JFEA 2CFAA 4GTEA 1O28A 5TMCA 4BKWA 2FQOA 3I4NK 1Y1WK 2GAHC 4LK0A 4P9SA 1WQFA 1VJEA 3FHZA 3RZDK 3GTOA 4A3LK 2R93A 1TWCK 2R92A 1WQHA 2E2HK 5IOSA 3GTPA 4GFQA 5IP7C 2E2IA 1IL2A 2KWAA 3HOVK 5JVOA 3S16K 4LLGA 4P5AA 3BP8C 2GSOA 2E2HA 1TWCC 1ISEA 2R93K 3GTQA 3A8IA 3S1RK 4ILDA 1J6VA 3AQOA 3A8JA 3GEEA 1Y1WA 3Q3QA 1WSVA 3GTLC 2PMZD 2E2IC 3S2HK 4KMHA 2EBBA 1O2FB 3SZYA 4LR2A 4NOIA 4GT9A 1XZQB 1O2AA 4LQYA 3FKIK 1PJ5A 5CJ9A 3M4OK 3GEIA 1YCLA 1I6HK 4A3JC 1J6WA 1ZYRA 2XCRB 3T00A 1BS2A 1TWAC 4C3HK 4A3KK 2PMZL 1B4AA 1WCMK 1VGXA 1DCPA 2WB1D 1XXCA 3T01A 1UV7A 3AQPA 3HKZL 1TWGK 4Q4ZA 3CQZC 5D4DA 1INNA 1TWFK 3S2DK 3G4CA
chains in the Genus database with same CATH topology
4BBSC 2Y0SL 2YU9C 2JA5C 3GTLK 4BY7K 1HQMA 1I50K 2CW0A 4A3BC 1TWHK 2PA8L 5IP9C 3HOUK 2YU9K 4A3GK 3DXJA 3M3YK 2A6HA 3HKZD 1WCMC 1BDFA 3S16C 2NVXK 5M3FK 3PO2C 3S1NC 4A3MK 2B63K 3I4MC 4KN4A 3EQLA 4BBRK 3PO2K 1R9TK 4XLNA 5FLMC 2JA6K 4MEYA 3HOVC 1SMYA 2WAQD 2WAQL 4OINA 3HOWK 3S1NK 4GZYA 3S1QC 4QJVB 4AYBD 4A3LC 4YFNA 4C3JK 5C4JC 4MQ9A 3HOWC 1I6VA 1TWHC 5IP9K 3HOUC 3HOYK 5C3EK 3GTJK 2R7ZK 4QIWL 4XSZA 4OIRA 3S17K 3H0GK 3HOXC 4A3EK 4LJZA 5C3EC 3GTJC 5IYCC 4Y52K 4A3CK 4A3DC 3S2DC 2R93C 3S1MC 4Y7NK 5IYBC 3GTQK 4A93C 1TWGC 5TMCA 4A3DK 5IYDK 5IYBK 3GTQC 2Y0SD 3S14C 4X6AC 4Y7NC 2JA7C 3I4NK 1Y1WK 4BBRC 4G7OA 2BE5A 4LK0A 4LK1A 4OIPA 3GTKK 1K83K 4A3JK 2JA7K 3RZDK 3I4NC 4A3LK 4BBSK 2NVYK 3H3VD 3RZOC 4XSXA 4YFXA 1TWCK 3GTKC 3CQZK 4KN7A 3FKIC 3RZDC 4A3CC 4QJVA 2E2HK 2A68A 3S15K 5M5XK 3S17C 2R7ZC 4OIOA 5IYCK 1YNJA 2O5JA 2NVQC 1I50C 4YG2A 5IP7C 5C44C 5M5YK 4YFKA 3I4MK 3GTGC 4OIQA 3S1MK 5C4JK 1Y1VC 3M3YC 3HOVK 3S16K 2R92K 3H0GC 3HOXK 4A3EC 2JA8K 4LLGA 4A3FK 4Y52C 4A3IC 3GTOK 5FJ8K 2PA8D 1SFOK 4BXXK 2NVTK 4Q5SA 4A3IK 4A3FC 5IYDC 1TWCC 1TWFC 2JA5K 4C3IK 2NVTC 2R93K 4BY1C 4A3BK 4KMUA 3S1RK 3HOZC 4A3GC 2WB1L 3HOZK 3HOYC 2A69A 3WODA 3GTLC 2PMZD 5C4XK 1XPPA 2VUMC 1Y1VK 4A3KC 2E2IC 3S2HK 3K7AC 2NVQK 1SFOC 1R9TC 1Y1WC 3GTPC 4NOIA 4BXXC 3FKIK 3K7AK 2NVXC 4XLPA 5M5WK 3M4OK 2R92C 4G7ZA 1I6HC 3GTMC 3PO3K 1I6HK 4QIWD 5C44K 5IP7K 4A3JC 4ZH4A 4MEXA 1I3QK 3PO3C 2NVYC 3GTGK 3RZOK 5M3MK 2E2HC 5TMFA 4AYBL 1I3QC 1ZYRA 3S15C 4A93K 4JK1A 5C4XC 3S14K 1TWAC 4C3HK 4X6AK 4A3KK 2PMZL 2E2IK 1WCMK 3S2HC 1TWAK 1IW7A 3GTPK 1K83C 2WB1D 2E2JK 1YNNA 3GTOC 4A3MC 2B63C 5FLMK 4C2MK 2E2JC 3HKZL 4BY1K 1TWGK 2JA8C 2JA6C 3H3VL 4BY7C 2VUMK 3GTMK 3S1RC 4Q4ZA 3CQZC 4G7HA 5D4DA 2O5IA 2PPBA 3M4OC 3S1QK 1TWFK 3S2DK 2A6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS C;  2Y0S L;  2YU9 C;  2JA5 C;  3GTL K;  4BY7 K;  1HQM A;  1I50 K;  2CW0 A;  4A3B C;  1TWH K;  2PA8 L;  5IP9 C;  3HOU K;  2YU9 K;  4A3G K;  3DXJ A;  3M3Y K;  2A6H A;  3HKZ D;  1WCM C;  1BDF A;  3S16 C;  2NVX K;  5M3F K;  3PO2 C;  3S1N C;  4A3M K;  2B63 K;  3I4M C;  4KN4 A;  3EQL A;  4BBR K;  3PO2 K;  1R9T K;  4XLN A;  5FLM C;  2JA6 K;  4MEY A;  3HOV C;  1SMY A;  2WAQ D;  2WAQ L;  4OIN A;  3HOW K;  3S1N K;  4GZY A;  3S1Q C;  4QJV B;  4AYB D;  4A3L C;  4YFN A;  4C3J K;  5C4J C;  4MQ9 A;  3HOW C;  1I6V A;  1TWH C;  5IP9 K;  3HOU C;  3HOY K;  5C3E K;  3GTJ K;  2R7Z K;  4QIW L;  4XSZ A;  4OIR A;  3S17 K;  3H0G K;  3HOX C;  4A3E K;  4LJZ A;  5C3E C;  3GTJ C;  5IYC C;  4Y52 K;  4A3C K;  4A3D C;  3S2D C;  2R93 C;  3S1M C;  4Y7N K;  5IYB C;  3GTQ K;  4A93 C;  1TWG C;  5TMC A;  4A3D K;  5IYD K;  5IYB K;  3GTQ C;  2Y0S D;  3S14 C;  4X6A C;  4Y7N C;  2JA7 C;  3I4N K;  1Y1W K;  4BBR C;  4G7O A;  2BE5 A;  4LK0 A;  4LK1 A;  4OIP A;  3GTK K;  1K83 K;  4A3J K;  2JA7 K;  3RZD K;  3I4N C;  4A3L K;  4BBS K;  2NVY K;  3H3V D;  3RZO C;  4XSX A;  4YFX A;  1TWC K;  3GTK C;  3CQZ K;  4KN7 A;  3FKI C;  3RZD C;  4A3C C;  4QJV A;  2E2H K;  2A68 A;  3S15 K;  5M5X K;  3S17 C;  2R7Z C;  4OIO A;  5IYC K;  1YNJ A;  2O5J A;  2NVQ C;  1I50 C;  4YG2 A;  5IP7 C;  5C44 C;  5M5Y K;  4YFK A;  3I4M K;  3GTG C;  4OIQ A;  3S1M K;  5C4J K;  1Y1V C;  3M3Y C;  3HOV K;  3S16 K;  2R92 K;  3H0G C;  3HOX K;  4A3E C;  2JA8 K;  4LLG A;  4A3F K;  4Y52 C;  4A3I C;  3GTO K;  5FJ8 K;  2PA8 D;  1SFO K;  4BXX K;  2NVT K;  4Q5S A;  4A3I K;  4A3F C;  5IYD C;  1TWC C;  1TWF C;  2JA5 K;  4C3I K;  2NVT C;  2R93 K;  4BY1 C;  4A3B K;  4KMU A;  3S1R K;  3HOZ C;  4A3G C;  2WB1 L;  3HOZ K;  3HOY C;  2A69 A;  3WOD A;  3GTL C;  2PMZ D;  5C4X K;  1XPP A;  2VUM C;  1Y1V K;  4A3K C;  2E2I C;  3S2H K;  3K7A C;  2NVQ K;  1SFO C;  1R9T C;  1Y1W C;  3GTP C;  4NOI A;  4BXX C;  3FKI K;  3K7A K;  2NVX C;  4XLP A;  5M5W K;  3M4O K;  2R92 C;  4G7Z A;  1I6H C;  3GTM C;  3PO3 K;  1I6H K;  4QIW D;  5C44 K;  5IP7 K;  4A3J C;  4ZH4 A;  4MEX A;  1I3Q K;  3PO3 C;  2NVY C;  3GTG K;  3RZO K;  5M3M K;  2E2H C;  5TMF A;  4AYB L;  1I3Q C;  1ZYR A;  3S15 C;  4A93 K;  4JK1 A;  5C4X C;  3S14 K;  1TWA C;  4C3H K;  4X6A K;  4A3K K;  2PMZ L;  2E2I K;  1WCM K;  3S2H C;  1TWA K;  1IW7 A;  3GTP K;  1K83 C;  2WB1 D;  2E2J K;  1YNN A;  3GTO C;  4A3M C;  2B63 C;  5FLM K;  4C2M K;  2E2J C;  3HKZ L;  4BY1 K;  1TWG K;  2JA8 C;  2JA6 C;  3H3V L;  4BY7 C;  2VUM K;  3GTM K;  3S1R C;  4Q4Z A;  3CQZ C;  4G7H A;  5D4D A;  2O5I A;  2PPB A;  3M4O C;  3S1Q K;  1TWF K;  3S2D K;  2A6E A; 
#chains in the Genus database with same CATH topology
 4KAT A;  1WCM A;  1HQM A;  3HOU K;  3ORE A;  4A3G K;  3M3Y K;  2A6H A;  1C0A A;  3PO2 C;  3S1N C;  2B63 K;  3I4M C;  2R7Z A;  3EQL A;  3PO2 K;  3FKI A;  5FLM C;  4MEY A;  3HOV C;  1VLO A;  4OIN A;  2RGR A;  4KAS A;  3OEP A;  1IE0 A;  3AD8 C;  3HOW C;  4G0V A;  3HOU C;  5C3E K;  4QIW L;  2V6S A;  3H0G K;  4KMA A;  3GTJ C;  3HOX C;  4A3E K;  4A3D C;  3S2D C;  2R93 C;  3GTQ K;  4A93 C;  1TWG C;  1Y1V A;  3ERE D;  1R9T A;  4A3D K;  4WJ3 M;  4BBR C;  4OIP A;  1EI6 A;  2JH3 A;  5EGH A;  2JA7 K;  3N0B A;  4YFX A;  2YU9 A;  1O26 A;  2CFA B;  3L4K A;  3S0X A;  1XZQ A;  4PAA A;  1HI9 A;  2A68 A;  5IYC K;  4KB4 A;  2NVQ C;  1I50 C;  1XZP A;  4YFK A;  3GTM A;  1WOP A;  2GAG C;  4G0U A;  3M3Y C;  1TWC A;  2R92 K;  4A3I C;  1JQW A;  3GTO K;  4GTF A;  4C3J C;  4BXX K;  4C3I C;  2NVT K;  5EGE A;  4A3I K;  1TWF C;  4C3I K;  2NVT C;  1XXA A;  3LAJ A;  3HOZ K;  3HOY C;  2A69 A;  3WOD A;  1JOE A;  2NVQ K;  1SFO C;  1WIH A;  3GTP C;  1J98 A;  3BP3 A;  4XLP A;  1I6H C;  1O24 A;  1O2B A;  4G7Z A;  4QIW D;  1WOS A;  1O29 A;  5IP7 K;  4ZH4 A;  1I3Q K;  3PO3 C;  3LAP A;  3QX3 A;  2XCQ A;  2E2H C;  1L0W A;  4A93 K;  2NVX A;  3MML B;  3G4A A;  1TWA K;  3TFH A;  2E2J K;  1YNN A;  3GTO C;  1WOR A;  5FLM K;  3GEH A;  1TWH A;  3T02 A;  2VUM K;  3GTM K;  3GTL A;  2FQT A;  1K83 A;  4BBS C;  2YU9 C;  4BY7 K;  2JA5 C;  4PAB A;  4KM8 A;  1I50 K;  2CW0 A;  5IOR A;  1F93 A;  1XXB A;  4A3B C;  2PA8 L;  2V6T A;  2YU9 K;  3HKZ D;  1BDF A;  2JA7 A;  3A8K A;  1IBA A;  3AD7 C;  1ZQ1 C;  4BBR K;  1F7U A;  1R9T K;  4XLN A;  4GTD A;  2WAQ L;  3L4J A;  4DDQ A;  1PJ6 A;  4A3L C;  3FOE A;  4KM9 A;  4YFN A;  3GTJ K;  4XSZ A;  3TTG A;  3S17 K;  5C3E C;  5IYC C;  1USO A;  1AB4 A;  5CHP A;  3S1M C;  4Y7N K;  4GTA A;  4J3N A;  5IYB C;  1BJT A;  5IYB K;  4X6A C;  2Y0S D;  4Y7N C;  3SZZ A;  2JA7 C;  2B63 A;  4KC6 A;  2BE5 A;  1WSR A;  1EFW A;  4LK1 A;  1SFO A;  3GTK K;  1K83 K;  4A3J K;  2GSU A;  4RMF A;  1EK8 A;  2NVY K;  3H3V D;  1EQR A;  3GSI A;  4XSX A;  2VUM A;  3GTK C;  3FKI C;  3LPX A;  3RZD C;  4QJV A;  3S15 K;  5M5X K;  2R7Z C;  1TWA A;  4YG2 A;  1TWF A;  3CAG A;  5M5Y K;  2P8T A;  3GTG C;  4OIQ A;  3S1M K;  1Y1V C;  1TWG A;  2D6F C;  1WQG A;  5TJ3 A;  4BLA A;  5IYD C;  2PHC B;  1F9N A;  2JA5 K;  2NVY A;  4P5B A;  4KMU A;  4A3G C;  1JVI A;  3GTK A;  5C4X K;  4C45 A;  3ADA C;  4WJ4 A;  2JA6 A;  2NVX C;  5M5W K;  3GTM C;  3PO3 K;  2W7V A;  5C44 K;  4MEX A;  1X31 C;  3RZO K;  3GTG K;  5M3M K;  1IS1 A;  5IOQ A;  1ZXO A;  3S15 C;  1BGW A;  3VA7 A;  2P5M A;  4JK1 A;  3V4G A;  3S14 K;  2ZFZ A;  4KAW X;  1IW7 A;  1GE9 A;  1K83 C;  1ZBS A;  1IQ0 A;  2B63 C;  3H3V L;  4BY1 K;  4BY7 C;  4BBS K;  1DD5 A;  2GSN A;  2O5I A;  3S1Q K;  3JST A;  2A6E A;  1DCH A;  1KQ4 A;  2Y0S L;  3GTL K;  1TWH K;  5IP9 C;  3OPF A;  4GTL A;  3DXJ A;  3GDZ A;  3GTG A;  4BLB A;  1VH2 A;  4M1X A;  2NVX K;  3IPJ A;  2JA6 K;  1SMY A;  3HOW K;  4GZY A;  2ZUF A;  4C3J K;  1TWH C;  5IP9 K;  2R7Z K;  4LJZ A;  4Y52 K;  4A3C K;  4KB2 A;  1VRQ C;  4KAR A;  5IYD K;  3GTQ C;  3S14 C;  2JA5 A;  3N3Y A;  4G7O A;  3I4N C;  5HL8 A;  3RZO C;  1G51 A;  1WOO A;  1RU0 A;  3CQZ K;  4KN7 A;  3AD9 C;  5E68 A;  3S17 C;  2O5J A;  4G0W A;  4KMD A;  1O27 A;  4OIO A;  1YNJ A;  5C44 C;  3I4M K;  5C4J K;  4O2D A;  5IOT A;  3H0G C;  3HOX K;  4A3E C;  2JA8 K;  4A3F K;  4Y52 C;  5FJ8 K;  2PA8 D;  1SFO K;  4Q5S A;  4A3F C;  1V5V A;  3NUH A;  1PJ7 A;  3N0C A;  4KDD A;  4BY1 C;  4A3B K;  3HOZ C;  2WB1 L;  3TFI A;  4XCH A;  4GTB A;  3GTJ A;  1XPP A;  2VUM C;  1Y1V K;  4A3K C;  3K7A C;  4GTC A;  4BXX C;  1R9T C;  1XZP B;  1Y1W C;  4C2M C;  3H0G A;  3K7A K;  1J6X A;  1ZVU A;  3GIR A;  2XCO A;  2R92 C;  2V6U A;  2NVY C;  2ZUE A;  5TMF A;  4AYB L;  1I3Q C;  4AH6 A;  1F7V A;  5C4X C;  4X6A K;  1I50 A;  2E2I K;  3S2H C;  3BUE A;  3HXA A;  3GTP K;  1YX2 A;  4A3M C;  2JA6 C;  4C2M K;  2E2J C;  1EH1 A;  2JA8 C;  1USM A;  3S1R C;  4G7H A;  3M4O C;  2PPB A;  3FOF A;  5L46 A;  3CQZ A;  4FM9 A;  1WCM C;  4C3H C;  1I3Q A;  3S16 C;  3AH5 A;  4LOW A;  5M3F K;  4A3M K;  4KN4 A;  4WIL A;  2WAQ D;  3S1N K;  3S1Q C;  4QJV B;  4AYB D;  1O25 A;  4FZB A;  5C4J C;  4MQ9 A;  4A3C C;  1I6V A;  1B4B A;  1DCO A;  2RH6 A;  2Y3P A;  3HOY K;  4OIR A;  3TFJ A;  5JFE A;  2CFA A;  4GTE A;  1O28 A;  5TMC A;  4BKW A;  2FQO A;  3I4N K;  1Y1W K;  2GAH C;  4LK0 A;  4P9S A;  1WQF A;  1VJE A;  3FHZ A;  3RZD K;  3GTO A;  4A3L K;  2R93 A;  1TWC K;  2R92 A;  1WQH A;  2E2H K;  5IOS A;  3GTP A;  4GFQ A;  5IP7 C;  2E2I A;  1IL2 A;  2KWA A;  3HOV K;  5JVO A;  3S16 K;  4LLG A;  4P5A A;  3BP8 C;  2GSO A;  2E2H A;  1TWC C;  1ISE A;  2R93 K;  3GTQ A;  3A8I A;  3S1R K;  4ILD A;  1J6V A;  3AQO A;  3A8J A;  3GEE A;  1Y1W A;  3Q3Q A;  1WSV A;  3GTL C;  2PMZ D;  2E2I C;  3S2H K;  4KMH A;  2EBB A;  1O2F B;  3SZY A;  4LR2 A;  4NOI A;  4GT9 A;  1XZQ B;  1O2A A;  4LQY A;  3FKI K;  1PJ5 A;  5CJ9 A;  3M4O K;  3GEI A;  1YCL A;  1I6H K;  4A3J C;  1J6W A;  1ZYR A;  2XCR B;  3T00 A;  1BS2 A;  1TWA C;  4C3H K;  4A3K K;  2PMZ L;  1B4A A;  1WCM K;  1VGX A;  1DCP A;  2WB1 D;  1XXC A;  3T01 A;  1UV7 A;  3AQP A;  3HKZ L;  1TWG K;  4Q4Z A;  3CQZ C;  5D4D A;  1INN A;  1TWF K;  3S2D K;  3G4C A; 
#chains in the Genus database with same CATH homology
 4BBS C;  2Y0S L;  2YU9 C;  2JA5 C;  3GTL K;  4BY7 K;  1HQM A;  1I50 K;  2CW0 A;  4A3B C;  1TWH K;  2PA8 L;  5IP9 C;  3HOU K;  2YU9 K;  4A3G K;  3DXJ A;  3M3Y K;  2A6H A;  3HKZ D;  1WCM C;  1BDF A;  3S16 C;  2NVX K;  5M3F K;  3PO2 C;  3S1N C;  4A3M K;  2B63 K;  3I4M C;  4KN4 A;  3EQL A;  4BBR K;  3PO2 K;  1R9T K;  4XLN A;  5FLM C;  2JA6 K;  4MEY A;  3HOV C;  1SMY A;  2WAQ D;  2WAQ L;  4OIN A;  3HOW K;  3S1N K;  4GZY A;  3S1Q C;  4QJV B;  4AYB D;  4A3L C;  4YFN A;  4C3J K;  5C4J C;  4MQ9 A;  3HOW C;  1I6V A;  1TWH C;  5IP9 K;  3HOU C;  3HOY K;  5C3E K;  3GTJ K;  2R7Z K;  4QIW L;  4XSZ A;  4OIR A;  3S17 K;  3H0G K;  3HOX C;  4A3E K;  4LJZ A;  5C3E C;  3GTJ C;  5IYC C;  4Y52 K;  4A3C K;  4A3D C;  3S2D C;  2R93 C;  3S1M C;  4Y7N K;  5IYB C;  3GTQ K;  4A93 C;  1TWG C;  5TMC A;  4A3D K;  5IYD K;  5IYB K;  3GTQ C;  2Y0S D;  3S14 C;  4X6A C;  4Y7N C;  2JA7 C;  3I4N K;  1Y1W K;  4BBR C;  4G7O A;  2BE5 A;  4LK0 A;  4LK1 A;  4OIP A;  3GTK K;  1K83 K;  4A3J K;  2JA7 K;  3RZD K;  3I4N C;  4A3L K;  4BBS K;  2NVY K;  3H3V D;  3RZO C;  4XSX A;  4YFX A;  1TWC K;  3GTK C;  3CQZ K;  4KN7 A;  3FKI C;  3RZD C;  4A3C C;  4QJV A;  2E2H K;  2A68 A;  3S15 K;  5M5X K;  3S17 C;  2R7Z C;  4OIO A;  5IYC K;  1YNJ A;  2O5J A;  2NVQ C;  1I50 C;  4YG2 A;  5IP7 C;  5C44 C;  5M5Y K;  4YFK A;  3I4M K;  3GTG C;  4OIQ A;  3S1M K;  5C4J K;  1Y1V C;  3M3Y C;  3HOV K;  3S16 K;  2R92 K;  3H0G C;  3HOX K;  4A3E C;  2JA8 K;  4LLG A;  4A3F K;  4Y52 C;  4A3I C;  3GTO K;  5FJ8 K;  2PA8 D;  1SFO K;  4BXX K;  2NVT K;  4Q5S A;  4A3I K;  4A3F C;  5IYD C;  1TWC C;  1TWF C;  2JA5 K;  4C3I K;  2NVT C;  2R93 K;  4BY1 C;  4A3B K;  4KMU A;  3S1R K;  3HOZ C;  4A3G C;  2WB1 L;  3HOZ K;  3HOY C;  2A69 A;  3WOD A;  3GTL C;  2PMZ D;  5C4X K;  1XPP A;  2VUM C;  1Y1V K;  4A3K C;  2E2I C;  3S2H K;  3K7A C;  2NVQ K;  1SFO C;  1R9T C;  1Y1W C;  3GTP C;  4NOI A;  4BXX C;  3FKI K;  3K7A K;  2NVX C;  4XLP A;  5M5W K;  3M4O K;  2R92 C;  4G7Z A;  1I6H C;  3GTM C;  3PO3 K;  1I6H K;  4QIW D;  5C44 K;  5IP7 K;  4A3J C;  4ZH4 A;  4MEX A;  1I3Q K;  3PO3 C;  2NVY C;  3GTG K;  3RZO K;  5M3M K;  2E2H C;  5TMF A;  4AYB L;  1I3Q C;  1ZYR A;  3S15 C;  4A93 K;  4JK1 A;  5C4X C;  3S14 K;  1TWA C;  4C3H K;  4X6A K;  4A3K K;  2PMZ L;  2E2I K;  1WCM K;  3S2H C;  1TWA K;  1IW7 A;  3GTP K;  1K83 C;  2WB1 D;  2E2J K;  1YNN A;  3GTO C;  4A3M C;  2B63 C;  5FLM K;  4C2M K;  2E2J C;  3HKZ L;  4BY1 K;  1TWG K;  2JA8 C;  2JA6 C;  3H3V L;  4BY7 C;  2VUM K;  3GTM K;  3S1R C;  4Q4Z A;  3CQZ C;  4G7H A;  5D4D A;  2O5I A;  2PPB A;  3M4O C;  3S1Q K;  1TWF K;  3S2D K;  2A6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...