1I6HK

Rna polymerase ii elongation complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6hK00
2NVYC 4XSZA 2R93K 3M3YC 3S15C 2E2JC 4Y52C 5TMFA 2VUMC 4A3JC 4A3FK 4Y7NC 3HOYC 3HOWC 5M5YK 4MEYA 3PO3K 5C3EC 4BXXK 2JA8K 4G7OA 4C2MK 5IP7K 4A3FC 3HOYK 4OINA 2R92C 2JA5K 3GTOK 3H3VD 3I4NK 2O5IA 3GTPK 5IYCK 1SFOK 2JA8C 5IYDC 1TWAC 2WB1D 1TWFK 4KN7A 1XPPA 2R7ZK 5M3FK 4A3LK 1K83C 3GTKC 4JK1A 4Y7NK 4A3JK 2NVXK 2E2IK 3K7AK 2A6EA 5C4XK 4A3GC 4Q4ZA 2Y0SL 4YG2A 4A3KC 2PMZD 4A3IK 3S1RK 3DXJA 3S17K 4A3DC 5M5WK 4G7HA 3PO2K 1TWCK 4BBSK 4MQ9A 5M5XK 1Y1WK 4BY1C 2NVQK 1Y1VC 2NVTC 3S16C 1I3QC 2Y0SD 3S1NK 3S17C 5M3MK 2JA7K 1ZYRA 3HOZC 3GTQK 2R7ZC 3M4OC 4A3BC 1I6HK 3RZOK 4C3HK 3GTKK 4YFNA 5IYDK 1K83K 4LJZA 4QJVB 5FLMK 3FKIK 5C44K 1I50K 3RZDK 2R92K 4QIWL 3HOZK 4OIOA 2JA6C 4XSXA 1SFOC 3GTPC 3PO2C 5FJ8K 3GTGK 1SMYA 3S16K 4A3KK 1Y1VK 5C3EK 4BXXC 1WCMK 4A3EK 2E2HC 3S15K 4AYBD 2WAQD 2E2JK 4BBRC 3H0GC 1HQMA 2YU9K 2NVQC 3HOWK 3M3YK 2NVXC 3S2HK 2R93C 4X6AC 2NVYK 1WCMC 2PMZL 1TWAK 2A69A 4ZH4A 5IYBC 4A3MK 2WAQL 5C4JC 2PPBA 4OIQA 2B63K 3GTLK 5IYCC 3S14C 4KMUA 4YFXA 4XLNA 3GTJC 4YFKA 3S1QC 5C44C 3FKIC 3GTGC 3S1MC 1YNNA 5C4JK 2B63C 2JA6K 3GTLC 2JA5C 3GTOC 3PO3C 1I6VA 3S14K 3GTJK 5IP7C 3RZOC 4A3BK 5IP9K 3EQLA 2YU9C 4LLGA 4BBRK 3HOVC 2A68A 2CW0A 1I3QK 4XLPA 1TWHK 2VUMK 2A6HA 4Y52K 4OIPA 4LK0A 3H0GK 1Y1WC 3S2HC 4A3CK 1TWCC 4BBSC 1R9TK 4X6AK 4MEXA 3S1NC 4GZYA 3HOXC 3I4MK 2NVTK 3GTMC 4C3JK 4A93C 1TWGC 4A3EC 2E2HK 3S2DK 3K7AC 4A3GK 5C4XC 2E2IC 2PA8D 3CQZK 3HOUC 1TWHC 4A3IC 4A3DK 4BY7K 4LK1A 4QJVA 3HKZL 4C3IK 4A3CC 5D4DA 5TMCA 1I50C 3RZDC 1TWFC 3H3VL 5FLMC 3HOVK 3GTQC 4OIRA 4G7ZA 2JA7C 2BE5A 4A3LC 4Q5SA 3HKZD 4QIWD 5IP9C 4BY7C 4KN4A 3M4OK 2WB1L 1BDFA 1I6HC 3WODA 3S1QK 2PA8L 4NOIA 1TWGK 3S2DC 3GTMK 4A93K 3S1MK 3HOXK 3I4MC 3S1RC 3HOUK 3I4NC 1R9TC 3CQZC 5IYBK 4A3MC 2O5JA 4BY1K 1IW7A 4AYBL 1YNJA
chains in the Genus database with same CATH superfamily
4C3JC 4XSZA 4AH6A 1SFOA 3M3YC 2P8TA 4Y52C 5TMFA 2VUMC 2XCOA 1ZVUA 1O26A 5M5YK 3HOWC 4MEYA 3HOYC 4BXXK 5IP7K 1WSRA 3H3VD 4BLBA 5IOSA 2WB1D 1USMA 3FOFA 3GTOA 2JA5A 3GTKC 3OPFA 3GTLA 4Y7NK 3GIRA 3GTPA 4WILA 2JA6A 1JQWA 3L4KA 3K7AK 4A3GC 4A3KC 4YG2A 3S1RK 3SZZA 1XXBA 4BY1C 1IL2A 3S16C 2Y0SD 2R7ZA 1ZYRA 4GT9A 4A3BC 1UV7A 4KM8A 5IYDK 2W7VA 5FLMK 5C44K 1INNA 2JA6C 1SFOC 3PO2C 3GTPC 1SMYA 4KMAA 1TWAA 4PABA 4A3EK 1WQGA 2WAQD 1BJTA 4KMHA 1IQ0A 1HQMA 3HOWK 3FOEA 1WCMC 3S15K 2A69A 3MMLB 5IYBC 3M3YK 1IS1A 5C4JC 3GTLK 3S14C 1BGWA 2VUMA 4DDQA 3FKIC 1WQHA 2E2IA 1G51A 1PJ6A 3GTJK 5IP7C 4A3BK 2NVYA 1TWCA 3L4JA 1Y1WA 4XLPA 1WQFA 2A6HA 2KWAA 3H0GK 2JA7A 4MEXA 1EQRA 4KB4A 4LR2A 3HOXC 3I4MK 4C3JK 2E2HK 1B4BA 3K7AC 4A3GK 2PA8D 3CQZK 5L46A 4LK1A 4KATA 1USOA 3LAPA 5D4DA 5TMCA 3N0BA 1I50C 3GTMA 1EK8A 1TWFC 3H3VL 3Q3QA 3N0CA 4OIRA 4Q5SA 3HKZD 4BY7C 3T00A 3AD7C 3WODA 2PA8L 4P9SA 1O28A 3S1MK 3HOUK 3AD8C 1R9TC 2O5JA 3FHZA 3HOYK 4AYBL 3GTQA 1YNJA 2NVYC 2R93K 1WSVA 1F7VA 1VGXA 1BS2A 2XCQA 3GTJA 2E2JC 3IPJA 4M1XA 3PO3K 2GSUA 3LPXA 1HI9A 2NVXA 4C2MK 2R92C 2JA5K 3GTOK 3I4NK 5IYCK 2JA8C 1TWAC 4KN7A 2R7ZK 3VA7A 2GSNA 4JK1A 1WOOA 2E2IK 1IE0A 2A6EA 1O27A 4A3IK 1Y1WK 2NVTC 3A8KA 1ZQ1C 1I3QC 5M3MK 2R92A 3GTQK 4ILDA 3G4AA 1I6HK 4KM9A 4BLAA 4FZBA 4C3HK 2GSOA 4GFQA 4C3IC 4O2DA 1I50K 3QX3A 4QIWL 3HOZK 5FJ8K 1C0AA 2CFAB 1Y1VK 5C3EK 3T01A 4KARA 4AYBD 2E2JK 2YU9K 2NVXC 3G4CA 1ISEA 2NVYK 2ZFZA 2PMZL 4A3MK 2WAQL 1O2FB 3GTJC 3S1QC 1EI6A 2ZUEA 2B63C 4WJ4A 3RZOC 5CHPA 5IP9K 3BP8C 3HOVC 4PAAA 4P5AA 1TWHK 5E68A 4OIPA 1R9TK 3S1NC 4GZYA 3GTMC 4A93C 4A3EC 2P5MA 2V6UA 4WJ3M 4FM9A 2E2IC 1O2BA 3HOUC 3FKIA 3T02A 4LQYA 1ZBSA 3RZDC 2ZUFA 4RMFA 3S0XA 5FLMC 4G0VA 1WCMA 1ZXOA 1O2AA 2XCRB 4NOIA 4G0UA 2GAGC 3HOXK 3I4MC 3JSTA 1PJ5A 3CQZC 5IYBK 3N3YA 1WOSA 2RGRA 3HXAA 1I50A 4KB2A 1DCPA 3S15C 1JOEA 1VLOA 3AQOA 4Y7NC 4KDDA 4GTBA 2JA8K 4G7OA 3BUEA 1O29A 2O5IA 1I3QA 3GTPK 1SFOK 5IYDC 2YU9A 1TWFK 1XPPA 4A3LK 3TFIA 4C45A 1X31C 1XZPA 4GTDA 4A3DC 3DXJA 4GTLA 3PO2K 1TWCK 4BBSK 4MQ9A 5M5XK 1DCOA 1VRQC 3GSIA 3S1NK 3BP3A 1Y1VA 3H0GA 2JA7K 3A8JA 3M4OC 3GTKK 2E2HA 1WIHA 3FKIK 5IORA 3RZDK 4XCHA 4GTFA 3GEIA 3GTGK 3S16K 5IOQA 4A3KK 1K83A 4BXXC 1WCMK 1WORA 3GEHA 5IOTA 4GTCA 1PJ7A 3NUHA 3S2HK 4X6AC 3GDZA 1J6WA 1V5VA 4OIQA 2PPBA 3ERED 4YFXA 4GTEA 4YFKA 5C44C 1TWHA 4LOWA 1YNNA 5C4JK 3GTLC 3S14K 3TTGA 1I6VA 3SZYA 1YCLA 1KQ4A 3AD9C 1L0WA 2GAHC 2CW0A 2VUMK 4Y52K 2CFAA 4LK0A 4KAWX 4A3CK 1TWCC 2FQOA 4BBSC 2NVTK 1VJEA 3V4GA 4KMDA 5JVOA 1TWFA 1TWHC 3GTGA 4A3IC 4QJVA 3HKZL 3AH5A 3A8IA 3OEPA 3HOVK 2JA7C 3CQZA 4QIWD 5IP9C 4KN4A 1I6HC 1BDFA 4BKWA 3S1QK 1TWGK 3S2DC 3GTMK 4A93K 3S1RC 3I4NC 4A3MC 2NVQC 2V6SA 1F93A 4P5BA 2Y3PA 2RH6A 4A3JC 1XXAA 4A3FK 5C3EC 1VH2A 2PHCB 4OINA 2EBBA 1B4AA 4J3NA 2R93A 1XXCA 1IBAA 4C3HC 1J6VA 5M3FK 3AQPA 1WOPA 1K83C 1F7UA 2B63A 4A3JK 3CAGA 1O24A 3TFHA 2NVXK 5C4XK 3GTKA 4Q4ZA 2Y0SL 3S17K 2PMZD 5HL8A 3OREA 5M5WK 4G7HA 2NVQK 1Y1VC 4KASA 1J6XA 3S17C 1O25A 1F9NA 3ADAC 3HOZC 2R7ZC 3RZOK 4YFNA 1DD5A 1K83K 4LJZA 4QJVB 3LAJA 2R92K 3TFJA 4OIOA 1XZQA 4XSXA 1DCHA 2JH3A 5CJ9A 2E2HC 1YX2A 1JVIA 4BBRC 3H0GC 2R93C 1XZQB 4G0WA 2D6FC 4ZH4A 1TWAK 5JFEA 2B63K 5IYCC 4KMUA 4XLNA 3GTGC 3S1MC 5EGEA 2JA6K 2JA5C 3GTOC 3PO3C 2V6TA 1R9TA 3EQLA 2YU9C 1XZPB 1GE9A 4LLGA 4BBRK 4KC6A 2A68A 1I3QK 1AB4A 3S2HC 1Y1WC 4X6AK 2FQTA 1TWGC 3S2DK 1J98A 5C4XC 4GTAA 4A3DK 1EH1A 5TJ3A 4BY7K 5EGHA 4A3CC 4C3IK 1RU0A 1TWGA 3GEEA 3GTQC 4G7ZA 2BE5A 4A3LC 3M4OK 2WB1L 1EFWA 4C2MC 4BY1K 1IW7A 4A3FC
chains in the Genus database with same CATH topology
2NVYC 4XSZA 2R93K 3M3YC 3S15C 2E2JC 4Y52C 5TMFA 2VUMC 4A3JC 4A3FK 4Y7NC 3HOYC 3HOWC 5M5YK 4MEYA 3PO3K 5C3EC 4BXXK 2JA8K 4G7OA 4C2MK 5IP7K 4A3FC 3HOYK 4OINA 2R92C 2JA5K 3GTOK 3H3VD 3I4NK 2O5IA 3GTPK 5IYCK 1SFOK 2JA8C 5IYDC 1TWAC 2WB1D 1TWFK 4KN7A 1XPPA 2R7ZK 5M3FK 4A3LK 1K83C 3GTKC 4JK1A 4Y7NK 4A3JK 2NVXK 2E2IK 3K7AK 2A6EA 5C4XK 4A3GC 4Q4ZA 2Y0SL 4YG2A 4A3KC 2PMZD 4A3IK 3S1RK 3DXJA 3S17K 4A3DC 5M5WK 4G7HA 3PO2K 1TWCK 4BBSK 4MQ9A 5M5XK 1Y1WK 4BY1C 2NVQK 1Y1VC 2NVTC 3S16C 1I3QC 2Y0SD 3S1NK 3S17C 5M3MK 2JA7K 1ZYRA 3HOZC 3GTQK 2R7ZC 3M4OC 4A3BC 1I6HK 3RZOK 4C3HK 3GTKK 4YFNA 5IYDK 1K83K 4LJZA 4QJVB 5FLMK 3FKIK 5C44K 1I50K 3RZDK 2R92K 4QIWL 3HOZK 4OIOA 2JA6C 4XSXA 1SFOC 3GTPC 3PO2C 5FJ8K 3GTGK 1SMYA 3S16K 4A3KK 1Y1VK 5C3EK 4BXXC 1WCMK 4A3EK 2E2HC 3S15K 4AYBD 2WAQD 2E2JK 4BBRC 3H0GC 1HQMA 2YU9K 2NVQC 3HOWK 3M3YK 2NVXC 3S2HK 2R93C 4X6AC 2NVYK 1WCMC 2PMZL 1TWAK 2A69A 4ZH4A 5IYBC 4A3MK 2WAQL 5C4JC 2PPBA 4OIQA 2B63K 3GTLK 5IYCC 3S14C 4KMUA 4YFXA 4XLNA 3GTJC 4YFKA 3S1QC 5C44C 3FKIC 3GTGC 3S1MC 1YNNA 5C4JK 2B63C 2JA6K 3GTLC 2JA5C 3GTOC 3PO3C 1I6VA 3S14K 3GTJK 5IP7C 3RZOC 4A3BK 5IP9K 3EQLA 2YU9C 4LLGA 4BBRK 3HOVC 2A68A 2CW0A 1I3QK 4XLPA 1TWHK 2VUMK 2A6HA 4Y52K 4OIPA 4LK0A 3H0GK 1Y1WC 3S2HC 4A3CK 1TWCC 4BBSC 1R9TK 4X6AK 4MEXA 3S1NC 4GZYA 3HOXC 3I4MK 2NVTK 3GTMC 4C3JK 4A93C 1TWGC 4A3EC 2E2HK 3S2DK 3K7AC 4A3GK 5C4XC 2E2IC 2PA8D 3CQZK 3HOUC 1TWHC 4A3IC 4A3DK 4BY7K 4LK1A 4QJVA 3HKZL 4C3IK 4A3CC 5D4DA 5TMCA 1I50C 3RZDC 1TWFC 3H3VL 5FLMC 3HOVK 3GTQC 4OIRA 4G7ZA 2JA7C 2BE5A 4A3LC 4Q5SA 3HKZD 4QIWD 5IP9C 4BY7C 4KN4A 3M4OK 2WB1L 1BDFA 1I6HC 3WODA 3S1QK 2PA8L 4NOIA 1TWGK 3S2DC 3GTMK 4A93K 3S1MK 3HOXK 3I4MC 3S1RC 3HOUK 3I4NC 1R9TC 3CQZC 5IYBK 4A3MC 2O5JA 4BY1K 1IW7A 4AYBL 1YNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY C;  4XSZ A;  2R93 K;  3M3Y C;  3S15 C;  2E2J C;  4Y52 C;  5TMF A;  2VUM C;  4A3J C;  4A3F K;  4Y7N C;  3HOY C;  3HOW C;  5M5Y K;  4MEY A;  3PO3 K;  5C3E C;  4BXX K;  2JA8 K;  4G7O A;  4C2M K;  5IP7 K;  4A3F C;  3HOY K;  4OIN A;  2R92 C;  2JA5 K;  3GTO K;  3H3V D;  3I4N K;  2O5I A;  3GTP K;  5IYC K;  1SFO K;  2JA8 C;  5IYD C;  1TWA C;  2WB1 D;  1TWF K;  4KN7 A;  1XPP A;  2R7Z K;  5M3F K;  4A3L K;  1K83 C;  3GTK C;  4JK1 A;  4Y7N K;  4A3J K;  2NVX K;  2E2I K;  3K7A K;  2A6E A;  5C4X K;  4A3G C;  4Q4Z A;  2Y0S L;  4YG2 A;  4A3K C;  2PMZ D;  4A3I K;  3S1R K;  3DXJ A;  3S17 K;  4A3D C;  5M5W K;  4G7H A;  3PO2 K;  1TWC K;  4BBS K;  4MQ9 A;  5M5X K;  1Y1W K;  4BY1 C;  2NVQ K;  1Y1V C;  2NVT C;  3S16 C;  1I3Q C;  2Y0S D;  3S1N K;  3S17 C;  5M3M K;  2JA7 K;  1ZYR A;  3HOZ C;  3GTQ K;  2R7Z C;  3M4O C;  4A3B C;  1I6H K;  3RZO K;  4C3H K;  3GTK K;  4YFN A;  5IYD K;  1K83 K;  4LJZ A;  4QJV B;  5FLM K;  3FKI K;  5C44 K;  1I50 K;  3RZD K;  2R92 K;  4QIW L;  3HOZ K;  4OIO A;  2JA6 C;  4XSX A;  1SFO C;  3GTP C;  3PO2 C;  5FJ8 K;  3GTG K;  1SMY A;  3S16 K;  4A3K K;  1Y1V K;  5C3E K;  4BXX C;  1WCM K;  4A3E K;  2E2H C;  3S15 K;  4AYB D;  2WAQ D;  2E2J K;  4BBR C;  3H0G C;  1HQM A;  2YU9 K;  2NVQ C;  3HOW K;  3M3Y K;  2NVX C;  3S2H K;  2R93 C;  4X6A C;  2NVY K;  1WCM C;  2PMZ L;  1TWA K;  2A69 A;  4ZH4 A;  5IYB C;  4A3M K;  2WAQ L;  5C4J C;  2PPB A;  4OIQ A;  2B63 K;  3GTL K;  5IYC C;  3S14 C;  4KMU A;  4YFX A;  4XLN A;  3GTJ C;  4YFK A;  3S1Q C;  5C44 C;  3FKI C;  3GTG C;  3S1M C;  1YNN A;  5C4J K;  2B63 C;  2JA6 K;  3GTL C;  2JA5 C;  3GTO C;  3PO3 C;  1I6V A;  3S14 K;  3GTJ K;  5IP7 C;  3RZO C;  4A3B K;  5IP9 K;  3EQL A;  2YU9 C;  4LLG A;  4BBR K;  3HOV C;  2A68 A;  2CW0 A;  1I3Q K;  4XLP A;  1TWH K;  2VUM K;  2A6H A;  4Y52 K;  4OIP A;  4LK0 A;  3H0G K;  1Y1W C;  3S2H C;  4A3C K;  1TWC C;  4BBS C;  1R9T K;  4X6A K;  4MEX A;  3S1N C;  4GZY A;  3HOX C;  3I4M K;  2NVT K;  3GTM C;  4C3J K;  4A93 C;  1TWG C;  4A3E C;  2E2H K;  3S2D K;  3K7A C;  4A3G K;  5C4X C;  2E2I C;  2PA8 D;  3CQZ K;  3HOU C;  1TWH C;  4A3I C;  4A3D K;  4BY7 K;  4LK1 A;  4QJV A;  3HKZ L;  4C3I K;  4A3C C;  5D4D A;  5TMC A;  1I50 C;  3RZD C;  1TWF C;  3H3V L;  5FLM C;  3HOV K;  3GTQ C;  4OIR A;  4G7Z A;  2JA7 C;  2BE5 A;  4A3L C;  4Q5S A;  3HKZ D;  4QIW D;  5IP9 C;  4BY7 C;  4KN4 A;  3M4O K;  2WB1 L;  1BDF A;  1I6H C;  3WOD A;  3S1Q K;  2PA8 L;  4NOI A;  1TWG K;  3S2D C;  3GTM K;  4A93 K;  3S1M K;  3HOX K;  3I4M C;  3S1R C;  3HOU K;  3I4N C;  1R9T C;  3CQZ C;  5IYB K;  4A3M C;  2O5J A;  4BY1 K;  1IW7 A;  4AYB L;  1YNJ A; 
#chains in the Genus database with same CATH topology
 4C3J C;  4XSZ A;  4AH6 A;  1SFO A;  3M3Y C;  2P8T A;  4Y52 C;  5TMF A;  2VUM C;  2XCO A;  1ZVU A;  1O26 A;  5M5Y K;  3HOW C;  4MEY A;  3HOY C;  4BXX K;  5IP7 K;  1WSR A;  3H3V D;  4BLB A;  5IOS A;  2WB1 D;  1USM A;  3FOF A;  3GTO A;  2JA5 A;  3GTK C;  3OPF A;  3GTL A;  4Y7N K;  3GIR A;  3GTP A;  4WIL A;  2JA6 A;  1JQW A;  3L4K A;  3K7A K;  4A3G C;  4A3K C;  4YG2 A;  3S1R K;  3SZZ A;  1XXB A;  4BY1 C;  1IL2 A;  3S16 C;  2Y0S D;  2R7Z A;  1ZYR A;  4GT9 A;  4A3B C;  1UV7 A;  4KM8 A;  5IYD K;  2W7V A;  5FLM K;  5C44 K;  1INN A;  2JA6 C;  1SFO C;  3PO2 C;  3GTP C;  1SMY A;  4KMA A;  1TWA A;  4PAB A;  4A3E K;  1WQG A;  2WAQ D;  1BJT A;  4KMH A;  1IQ0 A;  1HQM A;  3HOW K;  3FOE A;  1WCM C;  3S15 K;  2A69 A;  3MML B;  5IYB C;  3M3Y K;  1IS1 A;  5C4J C;  3GTL K;  3S14 C;  1BGW A;  2VUM A;  4DDQ A;  3FKI C;  1WQH A;  2E2I A;  1G51 A;  1PJ6 A;  3GTJ K;  5IP7 C;  4A3B K;  2NVY A;  1TWC A;  3L4J A;  1Y1W A;  4XLP A;  1WQF A;  2A6H A;  2KWA A;  3H0G K;  2JA7 A;  4MEX A;  1EQR A;  4KB4 A;  4LR2 A;  3HOX C;  3I4M K;  4C3J K;  2E2H K;  1B4B A;  3K7A C;  4A3G K;  2PA8 D;  3CQZ K;  5L46 A;  4LK1 A;  4KAT A;  1USO A;  3LAP A;  5D4D A;  5TMC A;  3N0B A;  1I50 C;  3GTM A;  1EK8 A;  1TWF C;  3H3V L;  3Q3Q A;  3N0C A;  4OIR A;  4Q5S A;  3HKZ D;  4BY7 C;  3T00 A;  3AD7 C;  3WOD A;  2PA8 L;  4P9S A;  1O28 A;  3S1M K;  3HOU K;  3AD8 C;  1R9T C;  2O5J A;  3FHZ A;  3HOY K;  4AYB L;  3GTQ A;  1YNJ A;  2NVY C;  2R93 K;  1WSV A;  1F7V A;  1VGX A;  1BS2 A;  2XCQ A;  3GTJ A;  2E2J C;  3IPJ A;  4M1X A;  3PO3 K;  2GSU A;  3LPX A;  1HI9 A;  2NVX A;  4C2M K;  2R92 C;  2JA5 K;  3GTO K;  3I4N K;  5IYC K;  2JA8 C;  1TWA C;  4KN7 A;  2R7Z K;  3VA7 A;  2GSN A;  4JK1 A;  1WOO A;  2E2I K;  1IE0 A;  2A6E A;  1O27 A;  4A3I K;  1Y1W K;  2NVT C;  3A8K A;  1ZQ1 C;  1I3Q C;  5M3M K;  2R92 A;  3GTQ K;  4ILD A;  3G4A A;  1I6H K;  4KM9 A;  4BLA A;  4FZB A;  4C3H K;  2GSO A;  4GFQ A;  4C3I C;  4O2D A;  1I50 K;  3QX3 A;  4QIW L;  3HOZ K;  5FJ8 K;  1C0A A;  2CFA B;  1Y1V K;  5C3E K;  3T01 A;  4KAR A;  4AYB D;  2E2J K;  2YU9 K;  2NVX C;  3G4C A;  1ISE A;  2NVY K;  2ZFZ A;  2PMZ L;  4A3M K;  2WAQ L;  1O2F B;  3GTJ C;  3S1Q C;  1EI6 A;  2ZUE A;  2B63 C;  4WJ4 A;  3RZO C;  5CHP A;  5IP9 K;  3BP8 C;  3HOV C;  4PAA A;  4P5A A;  1TWH K;  5E68 A;  4OIP A;  1R9T K;  3S1N C;  4GZY A;  3GTM C;  4A93 C;  4A3E C;  2P5M A;  2V6U A;  4WJ3 M;  4FM9 A;  2E2I C;  1O2B A;  3HOU C;  3FKI A;  3T02 A;  4LQY A;  1ZBS A;  3RZD C;  2ZUF A;  4RMF A;  3S0X A;  5FLM C;  4G0V A;  1WCM A;  1ZXO A;  1O2A A;  2XCR B;  4NOI A;  4G0U A;  2GAG C;  3HOX K;  3I4M C;  3JST A;  1PJ5 A;  3CQZ C;  5IYB K;  3N3Y A;  1WOS A;  2RGR A;  3HXA A;  1I50 A;  4KB2 A;  1DCP A;  3S15 C;  1JOE A;  1VLO A;  3AQO A;  4Y7N C;  4KDD A;  4GTB A;  2JA8 K;  4G7O A;  3BUE A;  1O29 A;  2O5I A;  1I3Q A;  3GTP K;  1SFO K;  5IYD C;  2YU9 A;  1TWF K;  1XPP A;  4A3L K;  3TFI A;  4C45 A;  1X31 C;  1XZP A;  4GTD A;  4A3D C;  3DXJ A;  4GTL A;  3PO2 K;  1TWC K;  4BBS K;  4MQ9 A;  5M5X K;  1DCO A;  1VRQ C;  3GSI A;  3S1N K;  3BP3 A;  1Y1V A;  3H0G A;  2JA7 K;  3A8J A;  3M4O C;  3GTK K;  2E2H A;  1WIH A;  3FKI K;  5IOR A;  3RZD K;  4XCH A;  4GTF A;  3GEI A;  3GTG K;  3S16 K;  5IOQ A;  4A3K K;  1K83 A;  4BXX C;  1WCM K;  1WOR A;  3GEH A;  5IOT A;  4GTC A;  1PJ7 A;  3NUH A;  3S2H K;  4X6A C;  3GDZ A;  1J6W A;  1V5V A;  4OIQ A;  2PPB A;  3ERE D;  4YFX A;  4GTE A;  4YFK A;  5C44 C;  1TWH A;  4LOW A;  1YNN A;  5C4J K;  3GTL C;  3S14 K;  3TTG A;  1I6V A;  3SZY A;  1YCL A;  1KQ4 A;  3AD9 C;  1L0W A;  2GAH C;  2CW0 A;  2VUM K;  4Y52 K;  2CFA A;  4LK0 A;  4KAW X;  4A3C K;  1TWC C;  2FQO A;  4BBS C;  2NVT K;  1VJE A;  3V4G A;  4KMD A;  5JVO A;  1TWF A;  1TWH C;  3GTG A;  4A3I C;  4QJV A;  3HKZ L;  3AH5 A;  3A8I A;  3OEP A;  3HOV K;  2JA7 C;  3CQZ A;  4QIW D;  5IP9 C;  4KN4 A;  1I6H C;  1BDF A;  4BKW A;  3S1Q K;  1TWG K;  3S2D C;  3GTM K;  4A93 K;  3S1R C;  3I4N C;  4A3M C;  2NVQ C;  2V6S A;  1F93 A;  4P5B A;  2Y3P A;  2RH6 A;  4A3J C;  1XXA A;  4A3F K;  5C3E C;  1VH2 A;  2PHC B;  4OIN A;  2EBB A;  1B4A A;  4J3N A;  2R93 A;  1XXC A;  1IBA A;  4C3H C;  1J6V A;  5M3F K;  3AQP A;  1WOP A;  1K83 C;  1F7U A;  2B63 A;  4A3J K;  3CAG A;  1O24 A;  3TFH A;  2NVX K;  5C4X K;  3GTK A;  4Q4Z A;  2Y0S L;  3S17 K;  2PMZ D;  5HL8 A;  3ORE A;  5M5W K;  4G7H A;  2NVQ K;  1Y1V C;  4KAS A;  1J6X A;  3S17 C;  1O25 A;  1F9N A;  3ADA C;  3HOZ C;  2R7Z C;  3RZO K;  4YFN A;  1DD5 A;  1K83 K;  4LJZ A;  4QJV B;  3LAJ A;  2R92 K;  3TFJ A;  4OIO A;  1XZQ A;  4XSX A;  1DCH A;  2JH3 A;  5CJ9 A;  2E2H C;  1YX2 A;  1JVI A;  4BBR C;  3H0G C;  2R93 C;  1XZQ B;  4G0W A;  2D6F C;  4ZH4 A;  1TWA K;  5JFE A;  2B63 K;  5IYC C;  4KMU A;  4XLN A;  3GTG C;  3S1M C;  5EGE A;  2JA6 K;  2JA5 C;  3GTO C;  3PO3 C;  2V6T A;  1R9T A;  3EQL A;  2YU9 C;  1XZP B;  1GE9 A;  4LLG A;  4BBR K;  4KC6 A;  2A68 A;  1I3Q K;  1AB4 A;  3S2H C;  1Y1W C;  4X6A K;  2FQT A;  1TWG C;  3S2D K;  1J98 A;  5C4X C;  4GTA A;  4A3D K;  1EH1 A;  5TJ3 A;  4BY7 K;  5EGH A;  4A3C C;  4C3I K;  1RU0 A;  1TWG A;  3GEE A;  3GTQ C;  4G7Z A;  2BE5 A;  4A3L C;  3M4O K;  2WB1 L;  1EFW A;  4C2M C;  4BY1 K;  1IW7 A;  4A3F C; 
#chains in the Genus database with same CATH homology
 2NVY C;  4XSZ A;  2R93 K;  3M3Y C;  3S15 C;  2E2J C;  4Y52 C;  5TMF A;  2VUM C;  4A3J C;  4A3F K;  4Y7N C;  3HOY C;  3HOW C;  5M5Y K;  4MEY A;  3PO3 K;  5C3E C;  4BXX K;  2JA8 K;  4G7O A;  4C2M K;  5IP7 K;  4A3F C;  3HOY K;  4OIN A;  2R92 C;  2JA5 K;  3GTO K;  3H3V D;  3I4N K;  2O5I A;  3GTP K;  5IYC K;  1SFO K;  2JA8 C;  5IYD C;  1TWA C;  2WB1 D;  1TWF K;  4KN7 A;  1XPP A;  2R7Z K;  5M3F K;  4A3L K;  1K83 C;  3GTK C;  4JK1 A;  4Y7N K;  4A3J K;  2NVX K;  2E2I K;  3K7A K;  2A6E A;  5C4X K;  4A3G C;  4Q4Z A;  2Y0S L;  4YG2 A;  4A3K C;  2PMZ D;  4A3I K;  3S1R K;  3DXJ A;  3S17 K;  4A3D C;  5M5W K;  4G7H A;  3PO2 K;  1TWC K;  4BBS K;  4MQ9 A;  5M5X K;  1Y1W K;  4BY1 C;  2NVQ K;  1Y1V C;  2NVT C;  3S16 C;  1I3Q C;  2Y0S D;  3S1N K;  3S17 C;  5M3M K;  2JA7 K;  1ZYR A;  3HOZ C;  3GTQ K;  2R7Z C;  3M4O C;  4A3B C;  1I6H K;  3RZO K;  4C3H K;  3GTK K;  4YFN A;  5IYD K;  1K83 K;  4LJZ A;  4QJV B;  5FLM K;  3FKI K;  5C44 K;  1I50 K;  3RZD K;  2R92 K;  4QIW L;  3HOZ K;  4OIO A;  2JA6 C;  4XSX A;  1SFO C;  3GTP C;  3PO2 C;  5FJ8 K;  3GTG K;  1SMY A;  3S16 K;  4A3K K;  1Y1V K;  5C3E K;  4BXX C;  1WCM K;  4A3E K;  2E2H C;  3S15 K;  4AYB D;  2WAQ D;  2E2J K;  4BBR C;  3H0G C;  1HQM A;  2YU9 K;  2NVQ C;  3HOW K;  3M3Y K;  2NVX C;  3S2H K;  2R93 C;  4X6A C;  2NVY K;  1WCM C;  2PMZ L;  1TWA K;  2A69 A;  4ZH4 A;  5IYB C;  4A3M K;  2WAQ L;  5C4J C;  2PPB A;  4OIQ A;  2B63 K;  3GTL K;  5IYC C;  3S14 C;  4KMU A;  4YFX A;  4XLN A;  3GTJ C;  4YFK A;  3S1Q C;  5C44 C;  3FKI C;  3GTG C;  3S1M C;  1YNN A;  5C4J K;  2B63 C;  2JA6 K;  3GTL C;  2JA5 C;  3GTO C;  3PO3 C;  1I6V A;  3S14 K;  3GTJ K;  5IP7 C;  3RZO C;  4A3B K;  5IP9 K;  3EQL A;  2YU9 C;  4LLG A;  4BBR K;  3HOV C;  2A68 A;  2CW0 A;  1I3Q K;  4XLP A;  1TWH K;  2VUM K;  2A6H A;  4Y52 K;  4OIP A;  4LK0 A;  3H0G K;  1Y1W C;  3S2H C;  4A3C K;  1TWC C;  4BBS C;  1R9T K;  4X6A K;  4MEX A;  3S1N C;  4GZY A;  3HOX C;  3I4M K;  2NVT K;  3GTM C;  4C3J K;  4A93 C;  1TWG C;  4A3E C;  2E2H K;  3S2D K;  3K7A C;  4A3G K;  5C4X C;  2E2I C;  2PA8 D;  3CQZ K;  3HOU C;  1TWH C;  4A3I C;  4A3D K;  4BY7 K;  4LK1 A;  4QJV A;  3HKZ L;  4C3I K;  4A3C C;  5D4D A;  5TMC A;  1I50 C;  3RZD C;  1TWF C;  3H3V L;  5FLM C;  3HOV K;  3GTQ C;  4OIR A;  4G7Z A;  2JA7 C;  2BE5 A;  4A3L C;  4Q5S A;  3HKZ D;  4QIW D;  5IP9 C;  4BY7 C;  4KN4 A;  3M4O K;  2WB1 L;  1BDF A;  1I6H C;  3WOD A;  3S1Q K;  2PA8 L;  4NOI A;  1TWG K;  3S2D C;  3GTM K;  4A93 K;  3S1M K;  3HOX K;  3I4M C;  3S1R C;  3HOU K;  3I4N C;  1R9T C;  3CQZ C;  5IYB K;  4A3M C;  2O5J A;  4BY1 K;  1IW7 A;  4AYB L;  1YNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...