1I6HK

Rna polymerase ii elongation complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6hK00
4JK1A 3S1QK 4A3LK 1SFOK 3WODA 3GTKK 5IP7K 3S17K 3HOZK 3S1RC 3S1MC 3GTMC 4BY7C 5C4JC 1I50C 1R9TC 3I4NK 1HQMA 5IYCC 3S1RK 3S1MK 3HKZL 3GTMK 1IW7A 5C4JK 3HOWC 1XPPA 1R9TK 4OIRA 5IYCK 3HOXC 2Y0SD 3H3VD 1TWHC 3HOWK 2Y0SL 4LLGA 3HOXK 3GTOC 2NVXC 3GTJC 4AYBD 2JA7K 1TWHK 3FKIC 5IP9K 3S1NC 4YFNA 2VUMK 4MEYA 3GTJK 1Y1WK 3S15C 3S2DK 1TWFK 5M3MK 3FKIK 3RZOC 3S2HC 3H0GC 3S15K 3CQZC 3S2HK 4A3GK 5C44K 3S1QC 4A3LC 5M3FK 5IP7C 3GTKC 4Y7NC 3HOZC 2JA5K 5FLMK 4KMUA 4Y7NK 3I4NC 4NOIA 2NVTK 4QIWD 4LJZA 4QIWL 1I3QK 4QJVA 3I4MK 4ZH4A 3HKZD 4YFXA 4A3KC 1K83C 4OIPA 2R7ZC 5FJ8K 2JA7C 4A3EK 1K83K 5IP9C 4A3KK 2R7ZK 4KN7A 3M4OK 3RZDC 2YU9C 1TWAK 1Y1WC 2VUMC 3S2DC 1TWFC 2A69A 3EQLA 1YNNA 4Y52C 2E2IC 3RZDK 2YU9K 4A3FK 2E2IK 2PPBA 5TMCA 5C44C 3GTQK 4A3GC 2JA8K 4Y52K 5C4XC 4OIOA 5C4XK 2JA5C 1SMYA 5FLMC 2R93K 3S16C 5IYDC 2NVTC 1I3QC 3I4MC 2E2JK 3M3YC 3S16K 5IYDK 2B63K 4A93K 4BY1K 4A3BK 4BBRC 2WAQL 5M5XK 3M3YK 3K7AK 2PA8D 4A3EC 2PA8L 4OIQA 1ZYRA 4BBRK 3M4OC 1TWAC 3PO2K 4KN4A 4XSZA 1TWGC 4A3JC 5C3EK 5D4DA 2E2HC 3PO3K 1WCMC 1TWGK 4A3FC 2A6HA 4A3JK 2E2HK 3GTQC 2JA8C 4X6AC 4A3CK 1WCMK 4MQ9A 3S14K 3GTPC 3HOYC 5IYBK 1TWCC 2CW0A 4A3MK 4A3DK 2NVYK 4YFKA 4OINA 4X6AK 5TMFA 2PMZL 2R93C 4G7HA 4MEXA 2O5IA 2A68A 2NVQC 1TWCK 4LK1A 3GTPK 3GTLK 3HOUC 1I6VA 2WB1D 5M5YK 3HOVC 2WB1L 3HOUK 2JA6C 4G7ZA 2E2JC 2NVQK 3HOVK 2B63C 4XLPA 4A93C 4BY1C 1BDFA 4XSXA 3HOYK 2A6EA 4A3BC 2JA6K 4BY7K 1I6HC 2O5JA 1I50K 4XLNA 3K7AC 4BBSC 4Q4ZA 1I6HK 2WAQD 1Y1VC 4C3JK 4QJVB 3H3VL 3PO2C 2R92C 4C3IK 4YG2A 4BBSK 4G7OA 4AYBL 1Y1VK 2BE5A 5C3EC 4BXXC 3PO3C 3GTOK 2NVXK 2R92K 5M5WK 4BXXK 3GTGC 3S1NK 4GZYA 4C2MK 4A3CC 3DXJA 4A3IC 3S14C 3RZOK 4LK0A 5IYBC 4A3MC 3GTGK 4A3DC 2NVYC 4Q5SA 1YNJA 3H0GK 4A3IK 1SFOC 3CQZK 4C3HK 3S17C 3GTLC 2PMZD
chains in the Genus database with same CATH superfamily
4BY7C 3SZZA 3HKZL 3HOWC 4C3IC 2E2HA 3H3VD 1TWHC 3HOWK 1WCMA 3GTJC 2JA7K 1TWHK 3FKIC 3S1NC 1DCOA 3IPJA 2VUMK 4MEYA 3GTJK 3S2DK 1B4BA 1F93A 2GAGC 3OPFA 3FKIK 3RZOC 4KB4A 4C3HC 1L0WA 5C44K 5FLMK 1F9NA 4KMUA 4P5BA 4QIWD 4LJZA 4QJVA 1I3QK 2NVXA 5IOTA 1EQRA 4G0UA 5FJ8K 4AH6A 3RZDC 1EFWA 2A69A 1GE9A 3GTKA 3RZDK 2PPBA 3GTQK 5TMCA 5C4XC 3N0CA 4J3NA 4OIOA 5C4XK 1SMYA 4GTCA 4KB2A 4FM9A 1WQGA 3S16C 1V5VA 3S16K 3A8KA 4BBRC 2YU9A 1Y1WA 1TWFA 3N3YA 1YX2A 4OIQA 1ZYRA 4BBRK 1TWAC 4XSZA 5C3EK 5TJ3A 1XZPB 4A3FC 4A3CK 4MQ9A 1IQ0A 4LQYA 1X31C 1TWCC 5IYBK 1XXAA 2PMZL 1PJ5A 4G7HA 3HOUC 1IBAA 1TWCK 3GTLK 2V6UA 3HOUK 2JA6C 2R7ZA 1WIHA 2A6EA 2JA6K 3K7AC 2EBBA 3H3VL 4C2MC 3BP8C 2CFAA 3G4AA 1DD5A 4C2MK 2KWAA 1XZQA 3S14C 3AQPA 4XCHA 4Q5SA 3T00A 4JK1A 4KAWX 3S1QK 5IP7K 5JVOA 3S1RC 1J6VA 3T01A 1I50C 1R9TC 3I4NK 2FQOA 3S1RK 4OIRA 1R9TK 4KM9A 2Y0SD 4LLGA 3GTOC 4WJ3M 4AYBD 2NVYA 3TFIA 1XXBA 3OEPA 3H0GC 3SZYA 4BLAA 3CQZC 4G0WA 5M3FK 2JA5K 3ERED 2NVTK 4RMFA 1K83C 1WSVA 3G4CA 2JA7C 4KMDA 4A3EK 1K83K 2XCRB 2ZUFA 3M4OK 2VUMC 3S2DC 1XXCA 4PAAA 4P9SA 3EQLA 2E2IC 1SFOA 1G51A 3GEIA 4ILDA 2E2IK 5C44C 4KMHA 3GTMA 5FLMC 2W7VA 2R93K 1O2BA 4C45A 5IYDC 1I3QC 2E2JK 3GDZA 1JQWA 3MMLB 2B63K 4A93K 4BY1K 5IYDK 2PA8L 2JH3A 3A8JA 1VH2A 1F7UA 1TWGC 2E2HC 5D4DA 1EI6A 3PO3K 1WCMC 3TFHA 1TWGK 2E2HK 3GTQC 1WCMK 1J98A 3HOYC 4A3DK 4OINA 5TMFA 4MEXA 2A68A 2NVQC 3HOYK 1I6VA 3GEHA 2WB1L 1USOA 2NVQK 1EH1A 4KASA 1BDFA 4XSXA 2GSUA 1TWAA 4XLNA 1DCHA 4KC6A 4Q4ZA 4BBSC 4C3JK 1USMA 4BBSK 4KARA 1AB4A 4AYBL 1O2AA 2BE5A 3GEEA 5C3EC 4GTLA 2NVXK 1TWCA 4M1XA 4A3CC 3AD8C 5IYBC 3FOEA 1EK8A 1YNJA 3BUEA 3GTLC 4A3LK 3WODA 3GTKK 1HI9A 1UV7A 3LPXA 3HOZK 1O25A 3S1MC 5C4JC 3S1MK 5C4JK 3HOXC 2RGRA 1XZPA 3HOXK 1JOEA 5IP9K 3GTPA 1Y1WK 1TWFK 5M3MK 3S2HC 5IORA 3L4KA 3GSIA 3S2HK 4A3GK 3S1QC 1I50A 1R9TA 1PJ6A 3A8IA 5IP7C 3JSTA 1WOPA 3QX3A 3GIRA 3I4NC 4NOIA 1Y1VA 4KMAA 4WILA 4QIWL 3GTOA 3I4MK 2R92A 1KQ4A 1WSRA 5JFEA 4GTAA 2R7ZC 1VGXA 3GTGA 1BS2A 4GTFA 2R7ZK 3H0GA 3CQZA 1J6WA 2GAHC 4Y52C 2RH6A 1BJTA 4O2DA 2XCOA 4Y52K 1IS1A 2JA8K 4LR2A 3AH5A 1JVIA 4DDQA 2JA5C 1YCLA 4KM8A 4BKWA 2NVTC 1VRQC 5IOQA 2JA7A 3N0BA 4G0VA 1TWHA 4A3BK 2VUMA 3GTJA 5M5XK 3FKIA 3FHZA 4A3EC 5CHPA 4GTBA 3M4OC 2XCQA 2PHCB 3PO2K 1O24A 1WOOA 1ZVUA 3S0XA 2ZUEA 4A3JC 1WOSA 3L4JA 2D6FC 2ZFZA 1ZBSA 4A3JK 1O26A 2P8TA 3V4GA 4GFQA 2CW0A 4A3MK 2NVYK 4YFKA 1I3QA 2R93C 2Y3PA 4LK1A 1WORA 1IE0A 2E2JC 5CJ9A 4LOWA 2B63C 4A93C 4BY1C 1PJ7A 1I6HC 2FQTA 4BY7K 1ISEA 1O28A 1TWGA 1I6HK 2WAQD 3VA7A 4QJVB 3T02A 4C3IK 4YG2A 3GTQA 3PO3C 2P5MA 3S1NK 5EGEA 4GZYA 3DXJA 3RZOK 4A3DC 1SFOC 4C3HK 3S17C 1SFOK 3S17K 3GTMC 1HQMA 5IYCC 3GTMK 1IW7A 3HXAA 4C3JC 1XPPA 5IYCK 1O2FB 2Y0SL 1BGWA 2NVXC 5L46A 3LAPA 4PABA 1WQFA 4GTDA 1VJEA 1VLOA 4YFNA 3S15C 5HL8A 3GTLA 4FZBA 3ADAC 3S15K 2JA6A 4A3LC 3GTKC 4Y7NC 3HOZC 3NUHA 3TFJA 4Y7NK 4WJ4A 4ZH4A 3HKZD 4YFXA 4A3KC 4OIPA 3AD9C 4P5AA 4A3KK 5IP9C 5IOSA 4KN7A 2YU9C 1TWAK 2V6SA 4KDDA 1Y1WC 1TWFC 1YNNA 1C0AA 2YU9K 4GT9A 4BLBA 4A3FK 2CFAB 4A3GC 5EGHA 2V6TA 1INNA 1XZQB 2GSOA 1O29A 3I4MC 3M3YC 5E68A 3TTGA 3FOFA 1J6XA 2WAQL 3M3YK 3AD7C 3K7AK 2PA8D 4KN4A 1DCPA 3AQOA 2JA5A 2A6HA 1O27A 2JA8C 4X6AC 4GTEA 3S14K 3GTPC 1F7VA 4X6AK 1WQHA 2O5IA 3GTPK 3HOVC 4KATA 2WB1D 5M5YK 1ZQ1C 4G7ZA 3HOVK 1RU0A 3BP3A 3CAGA 4XLPA 3LAJA 1K83A 1ZXOA 4A3BC 2O5JA 1IL2A 1I50K 3Q3QA 1Y1VC 2GSNA 3PO2C 2E2IA 2R92C 4G7OA 1Y1VK 4BXXC 3OREA 3GTOK 2R92K 1B4AA 5M5WK 4BXXK 3GTGC 2R93A 4A3IC 4LK0A 4A3MC 3GTGK 2NVYC 3H0GK 4A3IK 2B63A 3CQZK 2PMZD
chains in the Genus database with same CATH topology
4JK1A 3S1QK 4A3LK 1SFOK 3WODA 3GTKK 5IP7K 3S17K 3HOZK 3S1RC 3S1MC 3GTMC 4BY7C 5C4JC 1I50C 1R9TC 3I4NK 1HQMA 5IYCC 3S1RK 3S1MK 3HKZL 3GTMK 1IW7A 5C4JK 3HOWC 1XPPA 1R9TK 4OIRA 5IYCK 3HOXC 2Y0SD 3H3VD 1TWHC 3HOWK 2Y0SL 4LLGA 3HOXK 3GTOC 2NVXC 3GTJC 4AYBD 2JA7K 1TWHK 3FKIC 5IP9K 3S1NC 4YFNA 2VUMK 4MEYA 3GTJK 1Y1WK 3S15C 3S2DK 1TWFK 5M3MK 3FKIK 3RZOC 3S2HC 3H0GC 3S15K 3CQZC 3S2HK 4A3GK 5C44K 3S1QC 4A3LC 5M3FK 5IP7C 3GTKC 4Y7NC 3HOZC 2JA5K 5FLMK 4KMUA 4Y7NK 3I4NC 4NOIA 2NVTK 4QIWD 4LJZA 4QIWL 1I3QK 4QJVA 3I4MK 4ZH4A 3HKZD 4YFXA 4A3KC 1K83C 4OIPA 2R7ZC 5FJ8K 2JA7C 4A3EK 1K83K 5IP9C 4A3KK 2R7ZK 4KN7A 3M4OK 3RZDC 2YU9C 1TWAK 1Y1WC 2VUMC 3S2DC 1TWFC 2A69A 3EQLA 1YNNA 4Y52C 2E2IC 3RZDK 2YU9K 4A3FK 2E2IK 2PPBA 5TMCA 5C44C 3GTQK 4A3GC 2JA8K 4Y52K 5C4XC 4OIOA 5C4XK 2JA5C 1SMYA 5FLMC 2R93K 3S16C 5IYDC 2NVTC 1I3QC 3I4MC 2E2JK 3M3YC 3S16K 5IYDK 2B63K 4A93K 4BY1K 4A3BK 4BBRC 2WAQL 5M5XK 3M3YK 3K7AK 2PA8D 4A3EC 2PA8L 4OIQA 1ZYRA 4BBRK 3M4OC 1TWAC 3PO2K 4KN4A 4XSZA 1TWGC 4A3JC 5C3EK 5D4DA 2E2HC 3PO3K 1WCMC 1TWGK 4A3FC 2A6HA 4A3JK 2E2HK 3GTQC 2JA8C 4X6AC 4A3CK 1WCMK 4MQ9A 3S14K 3GTPC 3HOYC 5IYBK 1TWCC 2CW0A 4A3MK 4A3DK 2NVYK 4YFKA 4OINA 4X6AK 5TMFA 2PMZL 2R93C 4G7HA 4MEXA 2O5IA 2A68A 2NVQC 1TWCK 4LK1A 3GTPK 3GTLK 3HOUC 1I6VA 2WB1D 5M5YK 3HOVC 2WB1L 3HOUK 2JA6C 4G7ZA 2E2JC 2NVQK 3HOVK 2B63C 4XLPA 4A93C 4BY1C 1BDFA 4XSXA 3HOYK 2A6EA 4A3BC 2JA6K 4BY7K 1I6HC 2O5JA 1I50K 4XLNA 3K7AC 4BBSC 4Q4ZA 1I6HK 2WAQD 1Y1VC 4C3JK 4QJVB 3H3VL 3PO2C 2R92C 4C3IK 4YG2A 4BBSK 4G7OA 4AYBL 1Y1VK 2BE5A 5C3EC 4BXXC 3PO3C 3GTOK 2NVXK 2R92K 5M5WK 4BXXK 3GTGC 3S1NK 4GZYA 4C2MK 4A3CC 3DXJA 4A3IC 3S14C 3RZOK 4LK0A 5IYBC 4A3MC 3GTGK 4A3DC 2NVYC 4Q5SA 1YNJA 3H0GK 4A3IK 1SFOC 3CQZK 4C3HK 3S17C 3GTLC 2PMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 A;  3S1Q K;  4A3L K;  1SFO K;  3WOD A;  3GTK K;  5IP7 K;  3S17 K;  3HOZ K;  3S1R C;  3S1M C;  3GTM C;  4BY7 C;  5C4J C;  1I50 C;  1R9T C;  3I4N K;  1HQM A;  5IYC C;  3S1R K;  3S1M K;  3HKZ L;  3GTM K;  1IW7 A;  5C4J K;  3HOW C;  1XPP A;  1R9T K;  4OIR A;  5IYC K;  3HOX C;  2Y0S D;  3H3V D;  1TWH C;  3HOW K;  2Y0S L;  4LLG A;  3HOX K;  3GTO C;  2NVX C;  3GTJ C;  4AYB D;  2JA7 K;  1TWH K;  3FKI C;  5IP9 K;  3S1N C;  4YFN A;  2VUM K;  4MEY A;  3GTJ K;  1Y1W K;  3S15 C;  3S2D K;  1TWF K;  5M3M K;  3FKI K;  3RZO C;  3S2H C;  3H0G C;  3S15 K;  3CQZ C;  3S2H K;  4A3G K;  5C44 K;  3S1Q C;  4A3L C;  5M3F K;  5IP7 C;  3GTK C;  4Y7N C;  3HOZ C;  2JA5 K;  5FLM K;  4KMU A;  4Y7N K;  3I4N C;  4NOI A;  2NVT K;  4QIW D;  4LJZ A;  4QIW L;  1I3Q K;  4QJV A;  3I4M K;  4ZH4 A;  3HKZ D;  4YFX A;  4A3K C;  1K83 C;  4OIP A;  2R7Z C;  5FJ8 K;  2JA7 C;  4A3E K;  1K83 K;  5IP9 C;  4A3K K;  2R7Z K;  4KN7 A;  3M4O K;  3RZD C;  2YU9 C;  1TWA K;  1Y1W C;  2VUM C;  3S2D C;  1TWF C;  2A69 A;  3EQL A;  1YNN A;  4Y52 C;  2E2I C;  3RZD K;  2YU9 K;  4A3F K;  2E2I K;  2PPB A;  5TMC A;  5C44 C;  3GTQ K;  4A3G C;  2JA8 K;  4Y52 K;  5C4X C;  4OIO A;  5C4X K;  2JA5 C;  1SMY A;  5FLM C;  2R93 K;  3S16 C;  5IYD C;  2NVT C;  1I3Q C;  3I4M C;  2E2J K;  3M3Y C;  3S16 K;  5IYD K;  2B63 K;  4A93 K;  4BY1 K;  4A3B K;  4BBR C;  2WAQ L;  5M5X K;  3M3Y K;  3K7A K;  2PA8 D;  4A3E C;  2PA8 L;  4OIQ A;  1ZYR A;  4BBR K;  3M4O C;  1TWA C;  3PO2 K;  4KN4 A;  4XSZ A;  1TWG C;  4A3J C;  5C3E K;  5D4D A;  2E2H C;  3PO3 K;  1WCM C;  1TWG K;  4A3F C;  2A6H A;  4A3J K;  2E2H K;  3GTQ C;  2JA8 C;  4X6A C;  4A3C K;  1WCM K;  4MQ9 A;  3S14 K;  3GTP C;  3HOY C;  5IYB K;  1TWC C;  2CW0 A;  4A3M K;  4A3D K;  2NVY K;  4YFK A;  4OIN A;  4X6A K;  5TMF A;  2PMZ L;  2R93 C;  4G7H A;  4MEX A;  2O5I A;  2A68 A;  2NVQ C;  1TWC K;  4LK1 A;  3GTP K;  3GTL K;  3HOU C;  1I6V A;  2WB1 D;  5M5Y K;  3HOV C;  2WB1 L;  3HOU K;  2JA6 C;  4G7Z A;  2E2J C;  2NVQ K;  3HOV K;  2B63 C;  4XLP A;  4A93 C;  4BY1 C;  1BDF A;  4XSX A;  3HOY K;  2A6E A;  4A3B C;  2JA6 K;  4BY7 K;  1I6H C;  2O5J A;  1I50 K;  4XLN A;  3K7A C;  4BBS C;  4Q4Z A;  1I6H K;  2WAQ D;  1Y1V C;  4C3J K;  4QJV B;  3H3V L;  3PO2 C;  2R92 C;  4C3I K;  4YG2 A;  4BBS K;  4G7O A;  4AYB L;  1Y1V K;  2BE5 A;  5C3E C;  4BXX C;  3PO3 C;  3GTO K;  2NVX K;  2R92 K;  5M5W K;  4BXX K;  3GTG C;  3S1N K;  4GZY A;  4C2M K;  4A3C C;  3DXJ A;  4A3I C;  3S14 C;  3RZO K;  4LK0 A;  5IYB C;  4A3M C;  3GTG K;  4A3D C;  2NVY C;  4Q5S A;  1YNJ A;  3H0G K;  4A3I K;  1SFO C;  3CQZ K;  4C3H K;  3S17 C;  3GTL C;  2PMZ D; 
#chains in the Genus database with same CATH topology
 4BY7 C;  3SZZ A;  3HKZ L;  3HOW C;  4C3I C;  2E2H A;  3H3V D;  1TWH C;  3HOW K;  1WCM A;  3GTJ C;  2JA7 K;  1TWH K;  3FKI C;  3S1N C;  1DCO A;  3IPJ A;  2VUM K;  4MEY A;  3GTJ K;  3S2D K;  1B4B A;  1F93 A;  2GAG C;  3OPF A;  3FKI K;  3RZO C;  4KB4 A;  4C3H C;  1L0W A;  5C44 K;  5FLM K;  1F9N A;  4KMU A;  4P5B A;  4QIW D;  4LJZ A;  4QJV A;  1I3Q K;  2NVX A;  5IOT A;  1EQR A;  4G0U A;  5FJ8 K;  4AH6 A;  3RZD C;  1EFW A;  2A69 A;  1GE9 A;  3GTK A;  3RZD K;  2PPB A;  3GTQ K;  5TMC A;  5C4X C;  3N0C A;  4J3N A;  4OIO A;  5C4X K;  1SMY A;  4GTC A;  4KB2 A;  4FM9 A;  1WQG A;  3S16 C;  1V5V A;  3S16 K;  3A8K A;  4BBR C;  2YU9 A;  1Y1W A;  1TWF A;  3N3Y A;  1YX2 A;  4OIQ A;  1ZYR A;  4BBR K;  1TWA C;  4XSZ A;  5C3E K;  5TJ3 A;  1XZP B;  4A3F C;  4A3C K;  4MQ9 A;  1IQ0 A;  4LQY A;  1X31 C;  1TWC C;  5IYB K;  1XXA A;  2PMZ L;  1PJ5 A;  4G7H A;  3HOU C;  1IBA A;  1TWC K;  3GTL K;  2V6U A;  3HOU K;  2JA6 C;  2R7Z A;  1WIH A;  2A6E A;  2JA6 K;  3K7A C;  2EBB A;  3H3V L;  4C2M C;  3BP8 C;  2CFA A;  3G4A A;  1DD5 A;  4C2M K;  2KWA A;  1XZQ A;  3S14 C;  3AQP A;  4XCH A;  4Q5S A;  3T00 A;  4JK1 A;  4KAW X;  3S1Q K;  5IP7 K;  5JVO A;  3S1R C;  1J6V A;  3T01 A;  1I50 C;  1R9T C;  3I4N K;  2FQO A;  3S1R K;  4OIR A;  1R9T K;  4KM9 A;  2Y0S D;  4LLG A;  3GTO C;  4WJ3 M;  4AYB D;  2NVY A;  3TFI A;  1XXB A;  3OEP A;  3H0G C;  3SZY A;  4BLA A;  3CQZ C;  4G0W A;  5M3F K;  2JA5 K;  3ERE D;  2NVT K;  4RMF A;  1K83 C;  1WSV A;  3G4C A;  2JA7 C;  4KMD A;  4A3E K;  1K83 K;  2XCR B;  2ZUF A;  3M4O K;  2VUM C;  3S2D C;  1XXC A;  4PAA A;  4P9S A;  3EQL A;  2E2I C;  1SFO A;  1G51 A;  3GEI A;  4ILD A;  2E2I K;  5C44 C;  4KMH A;  3GTM A;  5FLM C;  2W7V A;  2R93 K;  1O2B A;  4C45 A;  5IYD C;  1I3Q C;  2E2J K;  3GDZ A;  1JQW A;  3MML B;  2B63 K;  4A93 K;  4BY1 K;  5IYD K;  2PA8 L;  2JH3 A;  3A8J A;  1VH2 A;  1F7U A;  1TWG C;  2E2H C;  5D4D A;  1EI6 A;  3PO3 K;  1WCM C;  3TFH A;  1TWG K;  2E2H K;  3GTQ C;  1WCM K;  1J98 A;  3HOY C;  4A3D K;  4OIN A;  5TMF A;  4MEX A;  2A68 A;  2NVQ C;  3HOY K;  1I6V A;  3GEH A;  2WB1 L;  1USO A;  2NVQ K;  1EH1 A;  4KAS A;  1BDF A;  4XSX A;  2GSU A;  1TWA A;  4XLN A;  1DCH A;  4KC6 A;  4Q4Z A;  4BBS C;  4C3J K;  1USM A;  4BBS K;  4KAR A;  1AB4 A;  4AYB L;  1O2A A;  2BE5 A;  3GEE A;  5C3E C;  4GTL A;  2NVX K;  1TWC A;  4M1X A;  4A3C C;  3AD8 C;  5IYB C;  3FOE A;  1EK8 A;  1YNJ A;  3BUE A;  3GTL C;  4A3L K;  3WOD A;  3GTK K;  1HI9 A;  1UV7 A;  3LPX A;  3HOZ K;  1O25 A;  3S1M C;  5C4J C;  3S1M K;  5C4J K;  3HOX C;  2RGR A;  1XZP A;  3HOX K;  1JOE A;  5IP9 K;  3GTP A;  1Y1W K;  1TWF K;  5M3M K;  3S2H C;  5IOR A;  3L4K A;  3GSI A;  3S2H K;  4A3G K;  3S1Q C;  1I50 A;  1R9T A;  1PJ6 A;  3A8I A;  5IP7 C;  3JST A;  1WOP A;  3QX3 A;  3GIR A;  3I4N C;  4NOI A;  1Y1V A;  4KMA A;  4WIL A;  4QIW L;  3GTO A;  3I4M K;  2R92 A;  1KQ4 A;  1WSR A;  5JFE A;  4GTA A;  2R7Z C;  1VGX A;  3GTG A;  1BS2 A;  4GTF A;  2R7Z K;  3H0G A;  3CQZ A;  1J6W A;  2GAH C;  4Y52 C;  2RH6 A;  1BJT A;  4O2D A;  2XCO A;  4Y52 K;  1IS1 A;  2JA8 K;  4LR2 A;  3AH5 A;  1JVI A;  4DDQ A;  2JA5 C;  1YCL A;  4KM8 A;  4BKW A;  2NVT C;  1VRQ C;  5IOQ A;  2JA7 A;  3N0B A;  4G0V A;  1TWH A;  4A3B K;  2VUM A;  3GTJ A;  5M5X K;  3FKI A;  3FHZ A;  4A3E C;  5CHP A;  4GTB A;  3M4O C;  2XCQ A;  2PHC B;  3PO2 K;  1O24 A;  1WOO A;  1ZVU A;  3S0X A;  2ZUE A;  4A3J C;  1WOS A;  3L4J A;  2D6F C;  2ZFZ A;  1ZBS A;  4A3J K;  1O26 A;  2P8T A;  3V4G A;  4GFQ A;  2CW0 A;  4A3M K;  2NVY K;  4YFK A;  1I3Q A;  2R93 C;  2Y3P A;  4LK1 A;  1WOR A;  1IE0 A;  2E2J C;  5CJ9 A;  4LOW A;  2B63 C;  4A93 C;  4BY1 C;  1PJ7 A;  1I6H C;  2FQT A;  4BY7 K;  1ISE A;  1O28 A;  1TWG A;  1I6H K;  2WAQ D;  3VA7 A;  4QJV B;  3T02 A;  4C3I K;  4YG2 A;  3GTQ A;  3PO3 C;  2P5M A;  3S1N K;  5EGE A;  4GZY A;  3DXJ A;  3RZO K;  4A3D C;  1SFO C;  4C3H K;  3S17 C;  1SFO K;  3S17 K;  3GTM C;  1HQM A;  5IYC C;  3GTM K;  1IW7 A;  3HXA A;  4C3J C;  1XPP A;  5IYC K;  1O2F B;  2Y0S L;  1BGW A;  2NVX C;  5L46 A;  3LAP A;  4PAB A;  1WQF A;  4GTD A;  1VJE A;  1VLO A;  4YFN A;  3S15 C;  5HL8 A;  3GTL A;  4FZB A;  3ADA C;  3S15 K;  2JA6 A;  4A3L C;  3GTK C;  4Y7N C;  3HOZ C;  3NUH A;  3TFJ A;  4Y7N K;  4WJ4 A;  4ZH4 A;  3HKZ D;  4YFX A;  4A3K C;  4OIP A;  3AD9 C;  4P5A A;  4A3K K;  5IP9 C;  5IOS A;  4KN7 A;  2YU9 C;  1TWA K;  2V6S A;  4KDD A;  1Y1W C;  1TWF C;  1YNN A;  1C0A A;  2YU9 K;  4GT9 A;  4BLB A;  4A3F K;  2CFA B;  4A3G C;  5EGH A;  2V6T A;  1INN A;  1XZQ B;  2GSO A;  1O29 A;  3I4M C;  3M3Y C;  5E68 A;  3TTG A;  3FOF A;  1J6X A;  2WAQ L;  3M3Y K;  3AD7 C;  3K7A K;  2PA8 D;  4KN4 A;  1DCP A;  3AQO A;  2JA5 A;  2A6H A;  1O27 A;  2JA8 C;  4X6A C;  4GTE A;  3S14 K;  3GTP C;  1F7V A;  4X6A K;  1WQH A;  2O5I A;  3GTP K;  3HOV C;  4KAT A;  2WB1 D;  5M5Y K;  1ZQ1 C;  4G7Z A;  3HOV K;  1RU0 A;  3BP3 A;  3CAG A;  4XLP A;  3LAJ A;  1K83 A;  1ZXO A;  4A3B C;  2O5J A;  1IL2 A;  1I50 K;  3Q3Q A;  1Y1V C;  2GSN A;  3PO2 C;  2E2I A;  2R92 C;  4G7O A;  1Y1V K;  4BXX C;  3ORE A;  3GTO K;  2R92 K;  1B4A A;  5M5W K;  4BXX K;  3GTG C;  2R93 A;  4A3I C;  4LK0 A;  4A3M C;  3GTG K;  2NVY C;  3H0G K;  4A3I K;  2B63 A;  3CQZ K;  2PMZ D; 
#chains in the Genus database with same CATH homology
 4JK1 A;  3S1Q K;  4A3L K;  1SFO K;  3WOD A;  3GTK K;  5IP7 K;  3S17 K;  3HOZ K;  3S1R C;  3S1M C;  3GTM C;  4BY7 C;  5C4J C;  1I50 C;  1R9T C;  3I4N K;  1HQM A;  5IYC C;  3S1R K;  3S1M K;  3HKZ L;  3GTM K;  1IW7 A;  5C4J K;  3HOW C;  1XPP A;  1R9T K;  4OIR A;  5IYC K;  3HOX C;  2Y0S D;  3H3V D;  1TWH C;  3HOW K;  2Y0S L;  4LLG A;  3HOX K;  3GTO C;  2NVX C;  3GTJ C;  4AYB D;  2JA7 K;  1TWH K;  3FKI C;  5IP9 K;  3S1N C;  4YFN A;  2VUM K;  4MEY A;  3GTJ K;  1Y1W K;  3S15 C;  3S2D K;  1TWF K;  5M3M K;  3FKI K;  3RZO C;  3S2H C;  3H0G C;  3S15 K;  3CQZ C;  3S2H K;  4A3G K;  5C44 K;  3S1Q C;  4A3L C;  5M3F K;  5IP7 C;  3GTK C;  4Y7N C;  3HOZ C;  2JA5 K;  5FLM K;  4KMU A;  4Y7N K;  3I4N C;  4NOI A;  2NVT K;  4QIW D;  4LJZ A;  4QIW L;  1I3Q K;  4QJV A;  3I4M K;  4ZH4 A;  3HKZ D;  4YFX A;  4A3K C;  1K83 C;  4OIP A;  2R7Z C;  5FJ8 K;  2JA7 C;  4A3E K;  1K83 K;  5IP9 C;  4A3K K;  2R7Z K;  4KN7 A;  3M4O K;  3RZD C;  2YU9 C;  1TWA K;  1Y1W C;  2VUM C;  3S2D C;  1TWF C;  2A69 A;  3EQL A;  1YNN A;  4Y52 C;  2E2I C;  3RZD K;  2YU9 K;  4A3F K;  2E2I K;  2PPB A;  5TMC A;  5C44 C;  3GTQ K;  4A3G C;  2JA8 K;  4Y52 K;  5C4X C;  4OIO A;  5C4X K;  2JA5 C;  1SMY A;  5FLM C;  2R93 K;  3S16 C;  5IYD C;  2NVT C;  1I3Q C;  3I4M C;  2E2J K;  3M3Y C;  3S16 K;  5IYD K;  2B63 K;  4A93 K;  4BY1 K;  4A3B K;  4BBR C;  2WAQ L;  5M5X K;  3M3Y K;  3K7A K;  2PA8 D;  4A3E C;  2PA8 L;  4OIQ A;  1ZYR A;  4BBR K;  3M4O C;  1TWA C;  3PO2 K;  4KN4 A;  4XSZ A;  1TWG C;  4A3J C;  5C3E K;  5D4D A;  2E2H C;  3PO3 K;  1WCM C;  1TWG K;  4A3F C;  2A6H A;  4A3J K;  2E2H K;  3GTQ C;  2JA8 C;  4X6A C;  4A3C K;  1WCM K;  4MQ9 A;  3S14 K;  3GTP C;  3HOY C;  5IYB K;  1TWC C;  2CW0 A;  4A3M K;  4A3D K;  2NVY K;  4YFK A;  4OIN A;  4X6A K;  5TMF A;  2PMZ L;  2R93 C;  4G7H A;  4MEX A;  2O5I A;  2A68 A;  2NVQ C;  1TWC K;  4LK1 A;  3GTP K;  3GTL K;  3HOU C;  1I6V A;  2WB1 D;  5M5Y K;  3HOV C;  2WB1 L;  3HOU K;  2JA6 C;  4G7Z A;  2E2J C;  2NVQ K;  3HOV K;  2B63 C;  4XLP A;  4A93 C;  4BY1 C;  1BDF A;  4XSX A;  3HOY K;  2A6E A;  4A3B C;  2JA6 K;  4BY7 K;  1I6H C;  2O5J A;  1I50 K;  4XLN A;  3K7A C;  4BBS C;  4Q4Z A;  1I6H K;  2WAQ D;  1Y1V C;  4C3J K;  4QJV B;  3H3V L;  3PO2 C;  2R92 C;  4C3I K;  4YG2 A;  4BBS K;  4G7O A;  4AYB L;  1Y1V K;  2BE5 A;  5C3E C;  4BXX C;  3PO3 C;  3GTO K;  2NVX K;  2R92 K;  5M5W K;  4BXX K;  3GTG C;  3S1N K;  4GZY A;  4C2M K;  4A3C C;  3DXJ A;  4A3I C;  3S14 C;  3RZO K;  4LK0 A;  5IYB C;  4A3M C;  3GTG K;  4A3D C;  2NVY C;  4Q5S A;  1YNJ A;  3H0G K;  4A3I K;  1SFO C;  3CQZ K;  4C3H K;  3S17 C;  3GTL C;  2PMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...