3PO2K

Arrested rna polymerase ii elongation complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3po2K00
2JA6C 4QIWL 2A69A 4G7HA 5TMCA 4G7ZA 1R9TK 3DXJA 3GTQK 3WODA 4LLGA 3GTKC 4A3CC 3S1MK 5C4XC 3S1NK 3H0GK 3M3YK 3HOZK 3S1QC 4X6AC 4KMUA 4A3JK 3S2HC 2A68A 5IP7C 4A3EC 3I4MC 3RZOK 3S17C 3RZDC 4A3DC 4A3FC 4OINA 1Y1WK 5IP9K 3CQZC 5IYDC 4Y52K 5M5XK 5C4JK 2YU9K 4A3LK 5C44K 2JA8C 1I3QK 3S1RK 4A3KK 1I6HC 3K7AK 5C3EC 2R92C 3HOWC 4OIQA 3I4NC 4OIRA 5FLMC 5IYBK 2WB1L 4Y7NK 3S14C 2R93K 2WAQD 3GTMK 4A3MC 3GTJK 4BXXC 3HKZL 1TWGC 3M4OK 1WCMK 3EQLA 2NVXC 4AYBD 3GTKK 4A3CK 5IYCC 5C4XK 4BY1C 4A3GK 2NVYC 3GTLC 4X6AK 3S2HK 3HOYC 3PO3K 5IP7K 2E2IK 5M5WK 4A3DK 3RZDK 3GTOC 4A3FK 4XLNA 3CQZK 5IYDK 4MQ9A 2PPBA 2A6EA 3S16K 2PMZD 4YFKA 1YNJA 4MEYA 4QJVB 2R7ZC 4A93C 1I6HK 2E2JC 4C2MK 2NVTC 4YFNA 3HOWK 3I4NK 4BBRK 5FLMK 3S14K 3S15K 1I50K 2WAQL 1TWFC 1K83C 4C3HK 5M5YK 2O5IA 3GTGC 4BBSK 4XSZA 4BXXK 3HOUC 1TWGK 2BE5A 3H3VD 1TWHC 2Y0SL 2PA8L 4ZH4A 2JA7K 2NVQC 2JA6K 5IYCK 4BY1K 1ZYRA 4LJZA 2O5JA 3GTPC 3HOVC 2JA5C 4QIWD 3GTLK 2A6HA 2VUMC 4KN4A 2B63C 3GTOK 3S1QK 3FKIC 4JK1A 3S1NC 5M3FK 4A3EK 3I4MK 4A3JC 4OIOA 1Y1VC 3S17K 1BDFA 3RZOC 2R7ZK 1SMYA 1TWAC 4A93K 4Y52C 4BY7C 2NVTK 1TWCC 4C3IK 3S2DC 2JA8K 4Q5SA 1TWFK 1K83K 5FJ8K 3PO2C 1XPPA 3GTGK 4A3LC 5C3EK 2R92K 1SFOC 4XLPA 1TWHK 4NOIA 4A3IC 4A3BC 4YFXA 4Y7NC 4A3MK 2WB1D 3GTPK 2CW0A 4AYBL 3GTJC 2NVXK 3HOXC 3HOVK 2E2HC 2JA5K 3HKZD 3M4OC 1WCMC 2VUMK 1YNNA 2B63K 3FKIK 2NVYK 4OIPA 1I6VA 4YG2A 4A3GC 1R9TC 3HOYK 1HQMA 3GTQC 5TMFA 1IW7A 1Y1VK 4MEXA 3S1MC 3PO3C 3H0GC 2E2IC 4KN7A 3M3YC 3HOZC 2PMZL 1TWAK 4BY7K 1TWCK 3S2DK 3S16C 1Y1WC 4XSXA 4LK1A 5IP9C 3PO2K 2E2JK 1SFOK 5M3MK 5C4JC 4A3IK 2YU9C 4A3BK 5C44C 4BBRC 1I3QC 4QJVA 3S1RC 1I50C 3H3VL 3HOUK 4LK0A 4A3KC 5D4DA 3S15C 4BBSC 4GZYA 3K7AC 2JA7C 3HOXK 2NVQK 2E2HK 4G7OA 4C3JK 5IYBC 2Y0SD 2PA8D 2R93C 4Q4ZA 3GTMC
chains in the Genus database with same CATH superfamily
3A8JA 1TWCA 4FM9A 3GTQK 3A8KA 3WODA 1IBAA 1XXBA 3S1NK 3HOZK 2V6UA 5IOSA 1ISEA 1C0AA 4OINA 2YU9K 4DDQA 4A3LK 3GTQA 3K7AK 3HOWC 3L4JA 4OIRA 2ZUEA 1JVIA 4A3MC 1L0WA 2GSNA 2W7VA 2P8TA 4M1XA 4WJ3M 4AYBD 2ZUFA 5IYCC 5C4XK 4A3GK 1ZVUA 1EH1A 2YU9A 3GTLC 4GTAA 3PO3K 4AH6A 5M5WK 3GTOC 5EGHA 1XZQA 3S16K 2JA7A 2PMZD 4BLAA 1V5VA 2KWAA 2JH3A 1I6HK 4C2MK 4YFNA 3S15K 1I50K 4C3HK 4KAWX 2XCQA 4KB4A 3Q3QA 3TFIA 1TWGK 1TWHC 2Y0SL 1G51A 4BY1K 3HOVC 4C45A 4QIWD 3GEIA 4KN4A 2B63C 1O27A 2CFAB 4JK1A 2R92A 5M3FK 3TFHA 1KQ4A 5E68A 4A3JC 3AD9C 1TWGA 2R7ZK 1SMYA 1O2BA 2NVXA 4Y52C 1TWCC 2PHCB 4Q5SA 1K83K 1XPPA 4KM9A 4YFXA 4A3MK 2WB1D 5TJ3A 1YCLA 2CW0A 4AYBL 3GTJC 1VH2A 2JA5K 3HKZD 2R7ZA 1EI6A 4BLBA 2Y3PA 4OIPA 3GTQC 1K83A 3T02A 4KN7A 3HOZC 2PMZL 2EBBA 4WILA 3S2DK 3TTGA 3PO2K 4GTFA 2JA5A 4GTLA 4A3IK 2YU9C 4A3BK 4LK0A 4BBSC 1JOEA 3K7AC 1J6WA 2E2HK 4C3JK 2XCRB 2JA7C 2PA8D 1IL2A 4QIWL 1EQRA 4LLGA 3OREA 5C4XC 2GAGC 3H0GK 1XZQB 4A3JK 1VGXA 1WSRA 3S17C 5CJ9A 2CFAA 1Y1WK 1ZBSA 4Y52K 2E2HA 5C4JK 1PJ6A 4C3IC 5C44K 1I6HC 5C3EC 2R92C 3NUHA 2WB1L 3H0GA 3HXAA 3GTMK 3GTJK 3HKZL 1TWGC 4WJ4A 1DD5A 2NVXC 3AH5A 3GTKK 1Y1WA 4A3CK 4KMDA 4BY1C 4LOWA 3N3YA 2NVYC 3S2HK 5IP7K 3FHZA 3RZDK 3BUEA 1WIHA 2GSUA 4RMFA 2PPBA 4YFKA 3GTMA 1YNJA 4MEYA 3GTJA 2JA6A 2R7ZC 4KM8A 2E2JC 3I4NK 3GTKA 3S14K 2GSOA 3VA7A 1K83C 1VJEA 5M5YK 4BBSK 4BXXK 2PA8L 2JA7K 2NVQC 1PJ7A 4KATA 2JA5C 1VLOA 4GTDA 2XCOA 1IQ0A 1BS2A 3S17K 1XZPB 4A93K 1J98A 2FQOA 3GIRA 1F9NA 2NVTK 1GE9A 4C3IK 3S2DC 1TWFK 3PO2C 3GTGK 5C3EK 1DCOA 2R92K 4NOIA 4A3IC 1XXAA 4A3BC 3GTPK 2NVXK 1F7VA 1WOSA 4KDDA 2E2HC 4C3JC 3M4OC 1DCHA 2VUMK 2NVYK 4YG2A 1HQMA 1J6XA 5TMFA 1TWFA 4MEXA 3S0XA 3GTGA 3H0GC 4BY7K 4XCHA 1Y1WC 3GTPA 4G0WA 2E2JK 5M3MK 3T01A 3GDZA 4PAAA 3BP3A 5C4JC 2D6FC 2VUMA 5C44C 4BBRC 2NVYA 3FOFA 4GZYA 3HOXK 2NVQK 4G7OA 5TMCA 3GTMC 2JA6C 4G7HA 4G7ZA 1R9TK 3DXJA 1USOA 3GTKC 4A3CC 3S1MK 3M3YK 1BGWA 1HI9A 3ERED 3S2HC 2A68A 5IP7C 4A3EC 3RZDC 1WSVA 3G4CA 3OPFA 3A8IA 1WCMA 1O2AA 3ADAC 3LPXA 1I3QK 3S1RK 1XZPA 1R9TA 4G0VA 4OIQA 3I4NC 3S14C 5IYBK 2E2IA 1F93A 3TFJA 4BXXC 3M4OK 3EQLA 4X6AK 3G4AA 4FZBA 1I3QA 4A3DK 4A3FK 4XLNA 4KARA 1O26A 3CQZK 5IYDK 2P5MA 1WQHA 4MQ9A 1EK8A 2A6EA 4KMAA 4A93C 1O29A 2NVTC 4BBRK 5FLMK 2WAQL 1TWFC 4KC6A 2O5IA 3GTGC 3HOUC 4ZH4A 2JA6K 4ILDA 3CQZA 1ZYRA 3GTPC 2A6HA 2VUMC 5HL8A 3SZYA 4A3EK 3RZOC 1AB4A 4BY7C 1B4AA 4GTEA 4O2DA 5IORA 1UV7A 4Y7NC 3GEEA 4GFQA 4GTCA 5IOTA 3HOXC 3AD7C 1WCMC 1EFWA 1INNA 2ZFZA 1IE0A 3FKIK 2RH6A 4BKWA 1R9TC 1Y1VK 1VRQC 3S1MC 2E2IC 3QX3A 3GEHA 3M3YC 1O24A 1TWAK 4PABA 3V4GA 3LAPA 4KMHA 4XSXA 1SFOK 1I3QC 3GSIA 3FKIA 4J3NA 3S1RC 3HOUK 1BJTA 1WORA 1Y1VA 5IYBC 1WOOA 3BP8C 2RGRA 4Q4ZA 1TWAA 1XXCA 1ZXOA 2A69A 3AD8C 1J6VA 4LR2A 1SFOA 3S1QC 1PJ5A 1ZQ1C 4KMUA 4X6AC 2FQTA 3I4MC 3RZOK 4A3DC 4A3FC 1O25A 5IP9K 3CQZC 5IYDC 5M5XK 2JA8C 1DCPA 4A3KK 3SZZA 3OEPA 5FLMC 4Y7NK 1IS1A 2R93K 2WAQD 5IOQA 1WCMK 3LAJA 5JVOA 3HOYC 2E2IK 1I50A 1O2FB 2R93A 4QJVB 1WQFA 5CHPA 3HOWK 3IPJA 2GAHC 2V6SA 1WOPA 4XSZA 2BE5A 3N0CA 3H3VD 3JSTA 5IYCK 4P5BA 4LJZA 2O5JA 2V6TA 3AQOA 4GT9A 3GTLK 5JFEA 3GTOK 3S1QK 3FKIC 4GTBA 3S1NC 3I4MK 3CAGA 1WQGA 1Y1VC 1BDFA 4OIOA 4G0UA 1YX2A 1TWAC 1USMA 2JA8K 5FJ8K 4A3LC 1SFOC 3GTLA 4XLPA 1TWHK 4KB2A 3GTOA 1F7UA 1RU0A 3HOVK 1B4BA 3AQPA 1YNNA 2B63K 3MMLB 4P9SA 1I6VA 4A3GC 4P5AA 3HOYK 1IW7A 3PO3C 1TWHA 1X31C 1TWCK 3N0BA 3S16C 1JQWA 4LQYA 5IP9C 4LK1A 4KASA 4C2MC 5EGEA 2B63A 4QJVA 3H3VL 3S15C 1I50C 4C3HC 4A3KC 5L46A 5D4DA 1O28A 2Y0SD 3FOEA 2R93C 3L4KA 3T00A
chains in the Genus database with same CATH topology
2JA6C 4QIWL 2A69A 4G7HA 5TMCA 4G7ZA 1R9TK 3DXJA 3GTQK 3WODA 4LLGA 3GTKC 4A3CC 3S1MK 5C4XC 3S1NK 3H0GK 3M3YK 3HOZK 3S1QC 4X6AC 4KMUA 4A3JK 3S2HC 2A68A 5IP7C 4A3EC 3I4MC 3RZOK 3S17C 3RZDC 4A3DC 4A3FC 4OINA 1Y1WK 5IP9K 3CQZC 5IYDC 4Y52K 5M5XK 5C4JK 2YU9K 4A3LK 5C44K 2JA8C 1I3QK 3S1RK 4A3KK 1I6HC 3K7AK 5C3EC 2R92C 3HOWC 4OIQA 3I4NC 4OIRA 5FLMC 5IYBK 2WB1L 4Y7NK 3S14C 2R93K 2WAQD 3GTMK 4A3MC 3GTJK 4BXXC 3HKZL 1TWGC 3M4OK 1WCMK 3EQLA 2NVXC 4AYBD 3GTKK 4A3CK 5IYCC 5C4XK 4BY1C 4A3GK 2NVYC 3GTLC 4X6AK 3S2HK 3HOYC 3PO3K 5IP7K 2E2IK 5M5WK 4A3DK 3RZDK 3GTOC 4A3FK 4XLNA 3CQZK 5IYDK 4MQ9A 2PPBA 2A6EA 3S16K 2PMZD 4YFKA 1YNJA 4MEYA 4QJVB 2R7ZC 4A93C 1I6HK 2E2JC 4C2MK 2NVTC 4YFNA 3HOWK 3I4NK 4BBRK 5FLMK 3S14K 3S15K 1I50K 2WAQL 1TWFC 1K83C 4C3HK 5M5YK 2O5IA 3GTGC 4BBSK 4XSZA 4BXXK 3HOUC 1TWGK 2BE5A 3H3VD 1TWHC 2Y0SL 2PA8L 4ZH4A 2JA7K 2NVQC 2JA6K 5IYCK 4BY1K 1ZYRA 4LJZA 2O5JA 3GTPC 3HOVC 2JA5C 4QIWD 3GTLK 2A6HA 2VUMC 4KN4A 2B63C 3GTOK 3S1QK 3FKIC 4JK1A 3S1NC 5M3FK 4A3EK 3I4MK 4A3JC 4OIOA 1Y1VC 3S17K 1BDFA 3RZOC 2R7ZK 1SMYA 1TWAC 4A93K 4Y52C 4BY7C 2NVTK 1TWCC 4C3IK 3S2DC 2JA8K 4Q5SA 1TWFK 1K83K 5FJ8K 3PO2C 1XPPA 3GTGK 4A3LC 5C3EK 2R92K 1SFOC 4XLPA 1TWHK 4NOIA 4A3IC 4A3BC 4YFXA 4Y7NC 4A3MK 2WB1D 3GTPK 2CW0A 4AYBL 3GTJC 2NVXK 3HOXC 3HOVK 2E2HC 2JA5K 3HKZD 3M4OC 1WCMC 2VUMK 1YNNA 2B63K 3FKIK 2NVYK 4OIPA 1I6VA 4YG2A 4A3GC 1R9TC 3HOYK 1HQMA 3GTQC 5TMFA 1IW7A 1Y1VK 4MEXA 3S1MC 3PO3C 3H0GC 2E2IC 4KN7A 3M3YC 3HOZC 2PMZL 1TWAK 4BY7K 1TWCK 3S2DK 3S16C 1Y1WC 4XSXA 4LK1A 5IP9C 3PO2K 2E2JK 1SFOK 5M3MK 5C4JC 4A3IK 2YU9C 4A3BK 5C44C 4BBRC 1I3QC 4QJVA 3S1RC 1I50C 3H3VL 3HOUK 4LK0A 4A3KC 5D4DA 3S15C 4BBSC 4GZYA 3K7AC 2JA7C 3HOXK 2NVQK 2E2HK 4G7OA 4C3JK 5IYBC 2Y0SD 2PA8D 2R93C 4Q4ZA 3GTMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 C;  4QIW L;  2A69 A;  4G7H A;  5TMC A;  4G7Z A;  1R9T K;  3DXJ A;  3GTQ K;  3WOD A;  4LLG A;  3GTK C;  4A3C C;  3S1M K;  5C4X C;  3S1N K;  3H0G K;  3M3Y K;  3HOZ K;  3S1Q C;  4X6A C;  4KMU A;  4A3J K;  3S2H C;  2A68 A;  5IP7 C;  4A3E C;  3I4M C;  3RZO K;  3S17 C;  3RZD C;  4A3D C;  4A3F C;  4OIN A;  1Y1W K;  5IP9 K;  3CQZ C;  5IYD C;  4Y52 K;  5M5X K;  5C4J K;  2YU9 K;  4A3L K;  5C44 K;  2JA8 C;  1I3Q K;  3S1R K;  4A3K K;  1I6H C;  3K7A K;  5C3E C;  2R92 C;  3HOW C;  4OIQ A;  3I4N C;  4OIR A;  5FLM C;  5IYB K;  2WB1 L;  4Y7N K;  3S14 C;  2R93 K;  2WAQ D;  3GTM K;  4A3M C;  3GTJ K;  4BXX C;  3HKZ L;  1TWG C;  3M4O K;  1WCM K;  3EQL A;  2NVX C;  4AYB D;  3GTK K;  4A3C K;  5IYC C;  5C4X K;  4BY1 C;  4A3G K;  2NVY C;  3GTL C;  4X6A K;  3S2H K;  3HOY C;  3PO3 K;  5IP7 K;  2E2I K;  5M5W K;  4A3D K;  3RZD K;  3GTO C;  4A3F K;  4XLN A;  3CQZ K;  5IYD K;  4MQ9 A;  2PPB A;  2A6E A;  3S16 K;  2PMZ D;  4YFK A;  1YNJ A;  4MEY A;  4QJV B;  2R7Z C;  4A93 C;  1I6H K;  2E2J C;  4C2M K;  2NVT C;  4YFN A;  3HOW K;  3I4N K;  4BBR K;  5FLM K;  3S14 K;  3S15 K;  1I50 K;  2WAQ L;  1TWF C;  1K83 C;  4C3H K;  5M5Y K;  2O5I A;  3GTG C;  4BBS K;  4XSZ A;  4BXX K;  3HOU C;  1TWG K;  2BE5 A;  3H3V D;  1TWH C;  2Y0S L;  2PA8 L;  4ZH4 A;  2JA7 K;  2NVQ C;  2JA6 K;  5IYC K;  4BY1 K;  1ZYR A;  4LJZ A;  2O5J A;  3GTP C;  3HOV C;  2JA5 C;  4QIW D;  3GTL K;  2A6H A;  2VUM C;  4KN4 A;  2B63 C;  3GTO K;  3S1Q K;  3FKI C;  4JK1 A;  3S1N C;  5M3F K;  4A3E K;  3I4M K;  4A3J C;  4OIO A;  1Y1V C;  3S17 K;  1BDF A;  3RZO C;  2R7Z K;  1SMY A;  1TWA C;  4A93 K;  4Y52 C;  4BY7 C;  2NVT K;  1TWC C;  4C3I K;  3S2D C;  2JA8 K;  4Q5S A;  1TWF K;  1K83 K;  5FJ8 K;  3PO2 C;  1XPP A;  3GTG K;  4A3L C;  5C3E K;  2R92 K;  1SFO C;  4XLP A;  1TWH K;  4NOI A;  4A3I C;  4A3B C;  4YFX A;  4Y7N C;  4A3M K;  2WB1 D;  3GTP K;  2CW0 A;  4AYB L;  3GTJ C;  2NVX K;  3HOX C;  3HOV K;  2E2H C;  2JA5 K;  3HKZ D;  3M4O C;  1WCM C;  2VUM K;  1YNN A;  2B63 K;  3FKI K;  2NVY K;  4OIP A;  1I6V A;  4YG2 A;  4A3G C;  1R9T C;  3HOY K;  1HQM A;  3GTQ C;  5TMF A;  1IW7 A;  1Y1V K;  4MEX A;  3S1M C;  3PO3 C;  3H0G C;  2E2I C;  4KN7 A;  3M3Y C;  3HOZ C;  2PMZ L;  1TWA K;  4BY7 K;  1TWC K;  3S2D K;  3S16 C;  1Y1W C;  4XSX A;  4LK1 A;  5IP9 C;  3PO2 K;  2E2J K;  1SFO K;  5M3M K;  5C4J C;  4A3I K;  2YU9 C;  4A3B K;  5C44 C;  4BBR C;  1I3Q C;  4QJV A;  3S1R C;  1I50 C;  3H3V L;  3HOU K;  4LK0 A;  4A3K C;  5D4D A;  3S15 C;  4BBS C;  4GZY A;  3K7A C;  2JA7 C;  3HOX K;  2NVQ K;  2E2H K;  4G7O A;  4C3J K;  5IYB C;  2Y0S D;  2PA8 D;  2R93 C;  4Q4Z A;  3GTM C; 
#chains in the Genus database with same CATH topology
 3A8J A;  1TWC A;  4FM9 A;  3GTQ K;  3A8K A;  3WOD A;  1IBA A;  1XXB A;  3S1N K;  3HOZ K;  2V6U A;  5IOS A;  1ISE A;  1C0A A;  4OIN A;  2YU9 K;  4DDQ A;  4A3L K;  3GTQ A;  3K7A K;  3HOW C;  3L4J A;  4OIR A;  2ZUE A;  1JVI A;  4A3M C;  1L0W A;  2GSN A;  2W7V A;  2P8T A;  4M1X A;  4WJ3 M;  4AYB D;  2ZUF A;  5IYC C;  5C4X K;  4A3G K;  1ZVU A;  1EH1 A;  2YU9 A;  3GTL C;  4GTA A;  3PO3 K;  4AH6 A;  5M5W K;  3GTO C;  5EGH A;  1XZQ A;  3S16 K;  2JA7 A;  2PMZ D;  4BLA A;  1V5V A;  2KWA A;  2JH3 A;  1I6H K;  4C2M K;  4YFN A;  3S15 K;  1I50 K;  4C3H K;  4KAW X;  2XCQ A;  4KB4 A;  3Q3Q A;  3TFI A;  1TWG K;  1TWH C;  2Y0S L;  1G51 A;  4BY1 K;  3HOV C;  4C45 A;  4QIW D;  3GEI A;  4KN4 A;  2B63 C;  1O27 A;  2CFA B;  4JK1 A;  2R92 A;  5M3F K;  3TFH A;  1KQ4 A;  5E68 A;  4A3J C;  3AD9 C;  1TWG A;  2R7Z K;  1SMY A;  1O2B A;  2NVX A;  4Y52 C;  1TWC C;  2PHC B;  4Q5S A;  1K83 K;  1XPP A;  4KM9 A;  4YFX A;  4A3M K;  2WB1 D;  5TJ3 A;  1YCL A;  2CW0 A;  4AYB L;  3GTJ C;  1VH2 A;  2JA5 K;  3HKZ D;  2R7Z A;  1EI6 A;  4BLB A;  2Y3P A;  4OIP A;  3GTQ C;  1K83 A;  3T02 A;  4KN7 A;  3HOZ C;  2PMZ L;  2EBB A;  4WIL A;  3S2D K;  3TTG A;  3PO2 K;  4GTF A;  2JA5 A;  4GTL A;  4A3I K;  2YU9 C;  4A3B K;  4LK0 A;  4BBS C;  1JOE A;  3K7A C;  1J6W A;  2E2H K;  4C3J K;  2XCR B;  2JA7 C;  2PA8 D;  1IL2 A;  4QIW L;  1EQR A;  4LLG A;  3ORE A;  5C4X C;  2GAG C;  3H0G K;  1XZQ B;  4A3J K;  1VGX A;  1WSR A;  3S17 C;  5CJ9 A;  2CFA A;  1Y1W K;  1ZBS A;  4Y52 K;  2E2H A;  5C4J K;  1PJ6 A;  4C3I C;  5C44 K;  1I6H C;  5C3E C;  2R92 C;  3NUH A;  2WB1 L;  3H0G A;  3HXA A;  3GTM K;  3GTJ K;  3HKZ L;  1TWG C;  4WJ4 A;  1DD5 A;  2NVX C;  3AH5 A;  3GTK K;  1Y1W A;  4A3C K;  4KMD A;  4BY1 C;  4LOW A;  3N3Y A;  2NVY C;  3S2H K;  5IP7 K;  3FHZ A;  3RZD K;  3BUE A;  1WIH A;  2GSU A;  4RMF A;  2PPB A;  4YFK A;  3GTM A;  1YNJ A;  4MEY A;  3GTJ A;  2JA6 A;  2R7Z C;  4KM8 A;  2E2J C;  3I4N K;  3GTK A;  3S14 K;  2GSO A;  3VA7 A;  1K83 C;  1VJE A;  5M5Y K;  4BBS K;  4BXX K;  2PA8 L;  2JA7 K;  2NVQ C;  1PJ7 A;  4KAT A;  2JA5 C;  1VLO A;  4GTD A;  2XCO A;  1IQ0 A;  1BS2 A;  3S17 K;  1XZP B;  4A93 K;  1J98 A;  2FQO A;  3GIR A;  1F9N A;  2NVT K;  1GE9 A;  4C3I K;  3S2D C;  1TWF K;  3PO2 C;  3GTG K;  5C3E K;  1DCO A;  2R92 K;  4NOI A;  4A3I C;  1XXA A;  4A3B C;  3GTP K;  2NVX K;  1F7V A;  1WOS A;  4KDD A;  2E2H C;  4C3J C;  3M4O C;  1DCH A;  2VUM K;  2NVY K;  4YG2 A;  1HQM A;  1J6X A;  5TMF A;  1TWF A;  4MEX A;  3S0X A;  3GTG A;  3H0G C;  4BY7 K;  4XCH A;  1Y1W C;  3GTP A;  4G0W A;  2E2J K;  5M3M K;  3T01 A;  3GDZ A;  4PAA A;  3BP3 A;  5C4J C;  2D6F C;  2VUM A;  5C44 C;  4BBR C;  2NVY A;  3FOF A;  4GZY A;  3HOX K;  2NVQ K;  4G7O A;  5TMC A;  3GTM C;  2JA6 C;  4G7H A;  4G7Z A;  1R9T K;  3DXJ A;  1USO A;  3GTK C;  4A3C C;  3S1M K;  3M3Y K;  1BGW A;  1HI9 A;  3ERE D;  3S2H C;  2A68 A;  5IP7 C;  4A3E C;  3RZD C;  1WSV A;  3G4C A;  3OPF A;  3A8I A;  1WCM A;  1O2A A;  3ADA C;  3LPX A;  1I3Q K;  3S1R K;  1XZP A;  1R9T A;  4G0V A;  4OIQ A;  3I4N C;  3S14 C;  5IYB K;  2E2I A;  1F93 A;  3TFJ A;  4BXX C;  3M4O K;  3EQL A;  4X6A K;  3G4A A;  4FZB A;  1I3Q A;  4A3D K;  4A3F K;  4XLN A;  4KAR A;  1O26 A;  3CQZ K;  5IYD K;  2P5M A;  1WQH A;  4MQ9 A;  1EK8 A;  2A6E A;  4KMA A;  4A93 C;  1O29 A;  2NVT C;  4BBR K;  5FLM K;  2WAQ L;  1TWF C;  4KC6 A;  2O5I A;  3GTG C;  3HOU C;  4ZH4 A;  2JA6 K;  4ILD A;  3CQZ A;  1ZYR A;  3GTP C;  2A6H A;  2VUM C;  5HL8 A;  3SZY A;  4A3E K;  3RZO C;  1AB4 A;  4BY7 C;  1B4A A;  4GTE A;  4O2D A;  5IOR A;  1UV7 A;  4Y7N C;  3GEE A;  4GFQ A;  4GTC A;  5IOT A;  3HOX C;  3AD7 C;  1WCM C;  1EFW A;  1INN A;  2ZFZ A;  1IE0 A;  3FKI K;  2RH6 A;  4BKW A;  1R9T C;  1Y1V K;  1VRQ C;  3S1M C;  2E2I C;  3QX3 A;  3GEH A;  3M3Y C;  1O24 A;  1TWA K;  4PAB A;  3V4G A;  3LAP A;  4KMH A;  4XSX A;  1SFO K;  1I3Q C;  3GSI A;  3FKI A;  4J3N A;  3S1R C;  3HOU K;  1BJT A;  1WOR A;  1Y1V A;  5IYB C;  1WOO A;  3BP8 C;  2RGR A;  4Q4Z A;  1TWA A;  1XXC A;  1ZXO A;  2A69 A;  3AD8 C;  1J6V A;  4LR2 A;  1SFO A;  3S1Q C;  1PJ5 A;  1ZQ1 C;  4KMU A;  4X6A C;  2FQT A;  3I4M C;  3RZO K;  4A3D C;  4A3F C;  1O25 A;  5IP9 K;  3CQZ C;  5IYD C;  5M5X K;  2JA8 C;  1DCP A;  4A3K K;  3SZZ A;  3OEP A;  5FLM C;  4Y7N K;  1IS1 A;  2R93 K;  2WAQ D;  5IOQ A;  1WCM K;  3LAJ A;  5JVO A;  3HOY C;  2E2I K;  1I50 A;  1O2F B;  2R93 A;  4QJV B;  1WQF A;  5CHP A;  3HOW K;  3IPJ A;  2GAH C;  2V6S A;  1WOP A;  4XSZ A;  2BE5 A;  3N0C A;  3H3V D;  3JST A;  5IYC K;  4P5B A;  4LJZ A;  2O5J A;  2V6T A;  3AQO A;  4GT9 A;  3GTL K;  5JFE A;  3GTO K;  3S1Q K;  3FKI C;  4GTB A;  3S1N C;  3I4M K;  3CAG A;  1WQG A;  1Y1V C;  1BDF A;  4OIO A;  4G0U A;  1YX2 A;  1TWA C;  1USM A;  2JA8 K;  5FJ8 K;  4A3L C;  1SFO C;  3GTL A;  4XLP A;  1TWH K;  4KB2 A;  3GTO A;  1F7U A;  1RU0 A;  3HOV K;  1B4B A;  3AQP A;  1YNN A;  2B63 K;  3MML B;  4P9S A;  1I6V A;  4A3G C;  4P5A A;  3HOY K;  1IW7 A;  3PO3 C;  1TWH A;  1X31 C;  1TWC K;  3N0B A;  3S16 C;  1JQW A;  4LQY A;  5IP9 C;  4LK1 A;  4KAS A;  4C2M C;  5EGE A;  2B63 A;  4QJV A;  3H3V L;  3S15 C;  1I50 C;  4C3H C;  4A3K C;  5L46 A;  5D4D A;  1O28 A;  2Y0S D;  3FOE A;  2R93 C;  3L4K A;  3T00 A; 
#chains in the Genus database with same CATH homology
 2JA6 C;  4QIW L;  2A69 A;  4G7H A;  5TMC A;  4G7Z A;  1R9T K;  3DXJ A;  3GTQ K;  3WOD A;  4LLG A;  3GTK C;  4A3C C;  3S1M K;  5C4X C;  3S1N K;  3H0G K;  3M3Y K;  3HOZ K;  3S1Q C;  4X6A C;  4KMU A;  4A3J K;  3S2H C;  2A68 A;  5IP7 C;  4A3E C;  3I4M C;  3RZO K;  3S17 C;  3RZD C;  4A3D C;  4A3F C;  4OIN A;  1Y1W K;  5IP9 K;  3CQZ C;  5IYD C;  4Y52 K;  5M5X K;  5C4J K;  2YU9 K;  4A3L K;  5C44 K;  2JA8 C;  1I3Q K;  3S1R K;  4A3K K;  1I6H C;  3K7A K;  5C3E C;  2R92 C;  3HOW C;  4OIQ A;  3I4N C;  4OIR A;  5FLM C;  5IYB K;  2WB1 L;  4Y7N K;  3S14 C;  2R93 K;  2WAQ D;  3GTM K;  4A3M C;  3GTJ K;  4BXX C;  3HKZ L;  1TWG C;  3M4O K;  1WCM K;  3EQL A;  2NVX C;  4AYB D;  3GTK K;  4A3C K;  5IYC C;  5C4X K;  4BY1 C;  4A3G K;  2NVY C;  3GTL C;  4X6A K;  3S2H K;  3HOY C;  3PO3 K;  5IP7 K;  2E2I K;  5M5W K;  4A3D K;  3RZD K;  3GTO C;  4A3F K;  4XLN A;  3CQZ K;  5IYD K;  4MQ9 A;  2PPB A;  2A6E A;  3S16 K;  2PMZ D;  4YFK A;  1YNJ A;  4MEY A;  4QJV B;  2R7Z C;  4A93 C;  1I6H K;  2E2J C;  4C2M K;  2NVT C;  4YFN A;  3HOW K;  3I4N K;  4BBR K;  5FLM K;  3S14 K;  3S15 K;  1I50 K;  2WAQ L;  1TWF C;  1K83 C;  4C3H K;  5M5Y K;  2O5I A;  3GTG C;  4BBS K;  4XSZ A;  4BXX K;  3HOU C;  1TWG K;  2BE5 A;  3H3V D;  1TWH C;  2Y0S L;  2PA8 L;  4ZH4 A;  2JA7 K;  2NVQ C;  2JA6 K;  5IYC K;  4BY1 K;  1ZYR A;  4LJZ A;  2O5J A;  3GTP C;  3HOV C;  2JA5 C;  4QIW D;  3GTL K;  2A6H A;  2VUM C;  4KN4 A;  2B63 C;  3GTO K;  3S1Q K;  3FKI C;  4JK1 A;  3S1N C;  5M3F K;  4A3E K;  3I4M K;  4A3J C;  4OIO A;  1Y1V C;  3S17 K;  1BDF A;  3RZO C;  2R7Z K;  1SMY A;  1TWA C;  4A93 K;  4Y52 C;  4BY7 C;  2NVT K;  1TWC C;  4C3I K;  3S2D C;  2JA8 K;  4Q5S A;  1TWF K;  1K83 K;  5FJ8 K;  3PO2 C;  1XPP A;  3GTG K;  4A3L C;  5C3E K;  2R92 K;  1SFO C;  4XLP A;  1TWH K;  4NOI A;  4A3I C;  4A3B C;  4YFX A;  4Y7N C;  4A3M K;  2WB1 D;  3GTP K;  2CW0 A;  4AYB L;  3GTJ C;  2NVX K;  3HOX C;  3HOV K;  2E2H C;  2JA5 K;  3HKZ D;  3M4O C;  1WCM C;  2VUM K;  1YNN A;  2B63 K;  3FKI K;  2NVY K;  4OIP A;  1I6V A;  4YG2 A;  4A3G C;  1R9T C;  3HOY K;  1HQM A;  3GTQ C;  5TMF A;  1IW7 A;  1Y1V K;  4MEX A;  3S1M C;  3PO3 C;  3H0G C;  2E2I C;  4KN7 A;  3M3Y C;  3HOZ C;  2PMZ L;  1TWA K;  4BY7 K;  1TWC K;  3S2D K;  3S16 C;  1Y1W C;  4XSX A;  4LK1 A;  5IP9 C;  3PO2 K;  2E2J K;  1SFO K;  5M3M K;  5C4J C;  4A3I K;  2YU9 C;  4A3B K;  5C44 C;  4BBR C;  1I3Q C;  4QJV A;  3S1R C;  1I50 C;  3H3V L;  3HOU K;  4LK0 A;  4A3K C;  5D4D A;  3S15 C;  4BBS C;  4GZY A;  3K7A C;  2JA7 C;  3HOX K;  2NVQ K;  2E2H K;  4G7O A;  4C3J K;  5IYB C;  2Y0S D;  2PA8 D;  2R93 C;  4Q4Z A;  3GTM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...