3PO2K

Arrested rna polymerase ii elongation complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3po2K00
4OIRA 5TMCA 1I50K 3GTMC 4A3GK 4LJZA 2Y0SD 4LLGA 1I3QC 4OIQA 3S17K 2NVYK 4MEXA 1TWHC 4BXXK 3HOZC 4A3JC 3RZDK 3M3YC 3S14C 2A68A 3EQLA 3S16K 4YFKA 5IP9C 4BBRK 2E2JC 3GTPC 3HOYC 2R7ZK 3HOVK 4MQ9A 4Y52K 2JA7C 5IP7C 4A3IK 2PA8L 3K7AK 3HOXC 3GTKK 3S1MK 2NVTC 4A3KC 3HKZL 4Y7NC 3GTJC 1WCMC 4QJVB 2PMZD 4G7OA 3PO2C 3DXJA 2WB1D 3H0GC 1TWGK 1TWCK 5TMFA 2NVXC 4QIWL 5M3MK 4A3EK 1Y1WK 2VUMC 3PO3C 3S15C 3S2DC 3FKIK 1TWAK 5FLMC 4X6AK 3I4NK 4BBSC 1Y1VK 4A3DK 2CW0A 4A3MC 4BY7K 1R9TK 2PPBA 3S1QK 2E2IC 4BY1C 3GTMK 4A93K 5C4XK 1I3QK 4XSXA 2R93K 2JA5C 4G7ZA 3GTQC 5IYCC 1YNJA 2O5JA 1I6HC 4A3JK 4KN7A 5C44C 4A3LC 2NVQC 4XLNA 3GTOC 2JA6C 5C3EC 2WB1L 5C4JC 3GTGK 4A3FC 3S2HK 4A3CC 4KMUA 1ZYRA 2JA7K 4AYBD 2A69A 5FJ8K 4A3KK 2A6EA 2WAQL 5M5YK 2O5IA 2YU9C 4YFNA 2B63C 3H0GK 3HOWC 2E2HK 3WODA 2R92C 4C2MK 5D4DA 2NVXK 2JA8K 3GTLK 3RZOC 4A3BK 4XSZA 2VUMK 2Y0SL 3S1RK 5FLMK 4GZYA 3M4OC 3H3VD 3PO3K 3CQZC 1I50C 3HOZK 4XLPA 2E2IK 4OIOA 5M5WK 1SFOC 4BXXC 1TWFC 3RZDC 5IYBC 5IYCK 1I6HK 3S16C 1TWHK 3M3YK 3S14K 5C44K 4JK1A 1BDFA 2JA6K 4BBRC 5C3EK 2PMZL 2R7ZC 5IP9K 4Y52C 1IW7A 4LK1A 4YFXA 4A3IC 3GTKC 2E2JK 4OINA 3GTPK 3HOYK 4LK0A 5IP7K 3HOXK 2NVTK 4ZH4A 4Y7NK 3GTJK 1WCMK 1TWGC 1YNNA 1TWCC 2YU9K 3HOWK 1XPPA 4MEYA 5IYDC 4A3EC 1Y1WC 3HOUC 3PO2K 3S1NC 2PA8D 1TWAC 3FKIC 1SMYA 5M3FK 3S15K 3I4NC 4Q5SA 4X6AC 1K83C 3HKZD 5M5XK 3M4OK 3S2DK 4QJVA 3I4MC 2A6HA 4BY7C 3CQZK 1R9TC 3S1QC 4BBSK 4A93C 4A3MK 4A3GC 4QIWD 5C4XC 2R93C 4C3HK 4BY1K 4KN4A 1SFOK 3S17C 4NOIA 1TWFK 2NVYC 4A3DC 5IYBK 5IYDK 2JA5K 4AYBL 3GTQK 3GTGC 4A3LK 3S2HC 4G7HA 2NVQK 3GTOK 4YG2A 5C4JK 4A3FK 3HOVC 4A3CK 4Q4ZA 1I6VA 3K7AC 3S1MC 3H3VL 4OIPA 2E2HC 1HQMA 2BE5A 2JA8C 3GTLC 4A3BC 2B63K 4C3JK 3HOUK 3S1RC 3S1NK 2R92K 3RZOK 4C3IK 1K83K 2WAQD 3I4MK 1Y1VC
chains in the Genus database with same CATH superfamily
3FOFA 4OIRA 3GDZA 2FQOA 4LJZA 2Y0SD 5JFEA 1I3QC 3AQPA 3QX3A 3S17K 3A8KA 1DCPA 4YFKA 4BBRK 3GTPC 1WOSA 1WSRA 5IP7C 4WILA 3GTJC 4G7OA 4C45A 1EH1A 3H0GC 3S15C 5TMFA 1JOEA 4QIWL 2VUMC 3S2DC 1VJEA 3TFIA 4A3DK 1IBAA 2ZUEA 3S1QK 4C3HC 2E2IC 3GTMK 3GTMA 4GTLA 1XZQA 3GEIA 5C44C 3GTOC 5C4JC 1C0AA 2JA7K 5FJ8K 2JA7A 4G0WA 2RGRA 3OREA 4YFNA 3HOWC 5E68A 2R92C 3S1RK 3L4KA 2V6UA 5FLMK 3M4OC 3PO3K 4KMAA 1WOPA 3GEHA 1SFOC 5IYCK 4GTCA 1F7UA 4JK1A 2JA6K 4BBRC 3MMLB 2JA6A 3G4CA 3HOYK 2ZFZA 3IPJA 4KASA 1UV7A 4GTFA 4ZH4A 3T00A 2P5MA 1WCMK 2CFAA 4GTDA 1XPPA 3HOUC 1WCMA 2PA8D 3HKZD 3BP8C 3TFJA 2A6HA 3OEPA 4P5AA 3I4MC 5IOQA 3S1QC 2ZUFA 4A3MK 1USOA 1BGWA 5TJ3A 1TWFK 1TWFA 2GAGC 3NUHA 4A3LK 4G7HA 4A3FK 2Y3PA 4PABA 3S1RC 3G4AA 1ZQ1C 2YU9A 1DCOA 1K83K 1SMYA 3PO3C 3GIRA 1K83A 3OPFA 1I50K 1KQ4A 3GEEA 3VA7A 4A3GK 3BP3A 1I50A 4BXXK 4KARA 4A3JC 3RZDK 3ERED 3HOYC 4LOWA 3HOVK 4MQ9A 1XXBA 4Y52K 3K7AK 1VLOA 1L0WA 3AQOA 1WCMC 4QJVB 5IOTA 4LQYA 3DXJA 2WB1D 1TWAK 1Y1VK 1O2AA 1TWAA 1J6XA 2XCQA 4A3MC 1Y1VA 5C4XK 4XSXA 1X31C 2R93K 4G7ZA 2R93A 4A3LC 4PAAA 4XLNA 3SZZA 3CAGA 2WB1L 4A3FC 4FM9A 4KMUA 2CFAB 5CHPA 4BKWA 1DD5A 4LR2A 4A3KK 2A6EA 2YU9C 2E2HK 3WODA 5D4DA 2NVXK 3GTLK 4XSZA 1XXCA 2Y0SL 2E2HA 2NVXA 2FQTA 3GTLA 4KAWX 1G51A 4GTAA 1I50C 3AD7C 5M5WK 4BXXC 3RZDC 1I6HK 1TWHK 3S14K 1O24A 1TWHA 2V6SA 5C3EK 5IP9K 4Y52C 4YFXA 4LK1A 1ISEA 4O2DA 4OINA 3AD9C 4LK0A 3HOXK 4GTEA 2NVTK 4GT9A 3HOZK 3L4JA 1TWAC 3GSIA 5M3FK 1WQFA 4QJVA 3CQZK 1O27A 1O26A 4BLBA 4M1XA 3CQZA 5C4XC 1WOOA 2R93C 3S17C 1WORA 5IYBK 2JA5K 3GTQK 4KMDA 3N0CA 2JA5A 3GTQA 2NVQK 4YG2A 1DCHA 1USMA 5JVOA 4OIPA 1B4BA 2E2HC 3GTLC 3S1NK 3RZOK 4C3IK 2WAQD 4A3DC 5TMCA 3T01A 3GTMC 1HI9A 1IE0A 2NVYK 1TWHC 3ADAC 3S14C 2NVYA 5L46A 2A68A 5CJ9A 5IP9C 2RH6A 3TTGA 2JA7C 4A3IK 2PA8L 3HOXC 1O25A 3AD8C 2NVTC 3S1MK 4G0UA 3HKZL 1PJ5A 2PMZD 2GSUA 5M3MK 1AB4A 1O2BA 3FKIK 5FLMC 3I4NK 3FKIA 2CW0A 4BY7K 1R9TK 1R9TA 1I3QK 2JA5C 3GTQC 5IYCC 1YNJA 1I3QA 2PHCB 2NVQC 4KM9A 2JA6C 1IQ0A 3GTGK 3S2HK 1YX2A 1V5VA 3GTGA 4AYBD 2A69A 3SZYA 2GAHC 2O5IA 3FHZA 3H0GK 3LAPA 3RZOC 2JA8K 4A3BK 3H0GA 2VUMK 1WSVA 2VUMA 3H3VD 4XLPA 2E2IK 1INNA 1GE9A 5IOSA 3S0XA 1TWFC 3Q3QA 1ZXOA 3M3YK 4KB4A 5C44K 1BDFA 2XCRB 3A8IA 4KDDA 4A3IC 2E2JK 4GFQA 5EGHA 4Y7NK 3HOWK 3PO2K 3FKIC 4Q5SA 3I4NC 1K83C 5M5XK 3M4OK 4AH6A 4BY7C 1R9TC 4BBSK 4A3GC 4QIWD 4KC6A 2JH3A 4BY1K 3A8JA 1RU0A 4KN4A 1SFOK 4NOIA 3FOEA 1J6VA 1SFOA 3LAJA 1XZPA 3N0BA 1ZBSA 3GTGC 3S2HC 1IL2A 3HOVC 4A3CK 1BS2A 1I6VA 3K7AC 1EK8A 1EI6A 1YCLA 1O29A 4P9SA 1HQMA 2JA8C 4A3BC 2B63K 4C3JK 3HOUK 4GTBA 5HL8A 2B63A 3I4MK 1Y1VC 4WJ3M 4LLGA 4OIQA 4WJ4A 4MEXA 1O2FB 3M3YC 3EQLA 3S16K 2GSNA 4ILDA 2W7VA 2E2JC 2R7ZK 2P8TA 3GTKK 1WIHA 2R7ZA 4A3KC 4Y7NC 3GTKA 3PO2C 1TWGK 1TWCK 2NVXC 4A3EK 1Y1WK 5IYDK 1TWGA 3HXAA 1TWCA 4X6AK 1Y1WA 3JSTA 4BBSC 1F7VA 2PPBA 1B4AA 1VRQC 4DDQA 4A93K 4BY1C 1EQRA 3BUEA 1ZVUA 2O5JA 1I6HC 4A3JK 4KN7A 1BJTA 5C3EC 4A3CC 1ZYRA 4FZBA 2WAQL 5M5YK 1EFWA 4G0VA 4BLAA 2B63C 3V4GA 1WQHA 4C3JC 3HOZC 3T02A 4C2MK 4GZYA 4RMFA 3CQZC 1XZPB 3AH5A 4P5BA 4OIOA 2D6FC 2EBBA 4KMHA 5IYBC 5IORA 3S16C 2V6TA 1PJ6A 4XCHA 2PMZL 3LPXA 2R7ZC 3TFHA 1IW7A 3GTKC 3GTPK 2XCOA 2GSOA 5IP7K 3GTPA 4KM8A 1J6WA 1JVIA 3GTJK 2YU9K 1TWGC 1YNNA 1TWCC 1F93A 2KWAA 4MEYA 5IYDC 4A3EC 1Y1WC 3GTJA 3S1NC 4X6AC 3S15K 4C3IC 3S2DK 1XZQB 4A93C 1WQGA 4C3HK 1VGXA 4KATA 1F9NA 2NVYC 2E2IA 4AYBL 1VH2A 1PJ7A 5EGEA 3GTOK 5C4JK 3GTOA 4Q4ZA 3S1MC 4J3NA 1IS1A 1J98A 1XXAA 3H3VL 1O28A 4C2MC 2BE5A 3N3YA 1JQWA 4KB2A 2R92K 2R92A
chains in the Genus database with same CATH topology
4OIRA 5TMCA 1I50K 3GTMC 4A3GK 4LJZA 2Y0SD 4LLGA 1I3QC 4OIQA 3S17K 2NVYK 4MEXA 1TWHC 4BXXK 3HOZC 4A3JC 3RZDK 3M3YC 3S14C 2A68A 3EQLA 3S16K 4YFKA 5IP9C 4BBRK 2E2JC 3GTPC 3HOYC 2R7ZK 3HOVK 4MQ9A 4Y52K 2JA7C 5IP7C 4A3IK 2PA8L 3K7AK 3HOXC 3GTKK 3S1MK 2NVTC 4A3KC 3HKZL 4Y7NC 3GTJC 1WCMC 4QJVB 2PMZD 4G7OA 3PO2C 3DXJA 2WB1D 3H0GC 1TWGK 1TWCK 5TMFA 2NVXC 4QIWL 5M3MK 4A3EK 1Y1WK 2VUMC 3PO3C 3S15C 3S2DC 3FKIK 1TWAK 5FLMC 4X6AK 3I4NK 4BBSC 1Y1VK 4A3DK 2CW0A 4A3MC 4BY7K 1R9TK 2PPBA 3S1QK 2E2IC 4BY1C 3GTMK 4A93K 5C4XK 1I3QK 4XSXA 2R93K 2JA5C 4G7ZA 3GTQC 5IYCC 1YNJA 2O5JA 1I6HC 4A3JK 4KN7A 5C44C 4A3LC 2NVQC 4XLNA 3GTOC 2JA6C 5C3EC 2WB1L 5C4JC 3GTGK 4A3FC 3S2HK 4A3CC 4KMUA 1ZYRA 2JA7K 4AYBD 2A69A 5FJ8K 4A3KK 2A6EA 2WAQL 5M5YK 2O5IA 2YU9C 4YFNA 2B63C 3H0GK 3HOWC 2E2HK 3WODA 2R92C 4C2MK 5D4DA 2NVXK 2JA8K 3GTLK 3RZOC 4A3BK 4XSZA 2VUMK 2Y0SL 3S1RK 5FLMK 4GZYA 3M4OC 3H3VD 3PO3K 3CQZC 1I50C 3HOZK 4XLPA 2E2IK 4OIOA 5M5WK 1SFOC 4BXXC 1TWFC 3RZDC 5IYBC 5IYCK 1I6HK 3S16C 1TWHK 3M3YK 3S14K 5C44K 4JK1A 1BDFA 2JA6K 4BBRC 5C3EK 2PMZL 2R7ZC 5IP9K 4Y52C 1IW7A 4LK1A 4YFXA 4A3IC 3GTKC 2E2JK 4OINA 3GTPK 3HOYK 4LK0A 5IP7K 3HOXK 2NVTK 4ZH4A 4Y7NK 3GTJK 1WCMK 1TWGC 1YNNA 1TWCC 2YU9K 3HOWK 1XPPA 4MEYA 5IYDC 4A3EC 1Y1WC 3HOUC 3PO2K 3S1NC 2PA8D 1TWAC 3FKIC 1SMYA 5M3FK 3S15K 3I4NC 4Q5SA 4X6AC 1K83C 3HKZD 5M5XK 3M4OK 3S2DK 4QJVA 3I4MC 2A6HA 4BY7C 3CQZK 1R9TC 3S1QC 4BBSK 4A93C 4A3MK 4A3GC 4QIWD 5C4XC 2R93C 4C3HK 4BY1K 4KN4A 1SFOK 3S17C 4NOIA 1TWFK 2NVYC 4A3DC 5IYBK 5IYDK 2JA5K 4AYBL 3GTQK 3GTGC 4A3LK 3S2HC 4G7HA 2NVQK 3GTOK 4YG2A 5C4JK 4A3FK 3HOVC 4A3CK 4Q4ZA 1I6VA 3K7AC 3S1MC 3H3VL 4OIPA 2E2HC 1HQMA 2BE5A 2JA8C 3GTLC 4A3BC 2B63K 4C3JK 3HOUK 3S1RC 3S1NK 2R92K 3RZOK 4C3IK 1K83K 2WAQD 3I4MK 1Y1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIR A;  5TMC A;  1I50 K;  3GTM C;  4A3G K;  4LJZ A;  2Y0S D;  4LLG A;  1I3Q C;  4OIQ A;  3S17 K;  2NVY K;  4MEX A;  1TWH C;  4BXX K;  3HOZ C;  4A3J C;  3RZD K;  3M3Y C;  3S14 C;  2A68 A;  3EQL A;  3S16 K;  4YFK A;  5IP9 C;  4BBR K;  2E2J C;  3GTP C;  3HOY C;  2R7Z K;  3HOV K;  4MQ9 A;  4Y52 K;  2JA7 C;  5IP7 C;  4A3I K;  2PA8 L;  3K7A K;  3HOX C;  3GTK K;  3S1M K;  2NVT C;  4A3K C;  3HKZ L;  4Y7N C;  3GTJ C;  1WCM C;  4QJV B;  2PMZ D;  4G7O A;  3PO2 C;  3DXJ A;  2WB1 D;  3H0G C;  1TWG K;  1TWC K;  5TMF A;  2NVX C;  4QIW L;  5M3M K;  4A3E K;  1Y1W K;  2VUM C;  3PO3 C;  3S15 C;  3S2D C;  3FKI K;  1TWA K;  5FLM C;  4X6A K;  3I4N K;  4BBS C;  1Y1V K;  4A3D K;  2CW0 A;  4A3M C;  4BY7 K;  1R9T K;  2PPB A;  3S1Q K;  2E2I C;  4BY1 C;  3GTM K;  4A93 K;  5C4X K;  1I3Q K;  4XSX A;  2R93 K;  2JA5 C;  4G7Z A;  3GTQ C;  5IYC C;  1YNJ A;  2O5J A;  1I6H C;  4A3J K;  4KN7 A;  5C44 C;  4A3L C;  2NVQ C;  4XLN A;  3GTO C;  2JA6 C;  5C3E C;  2WB1 L;  5C4J C;  3GTG K;  4A3F C;  3S2H K;  4A3C C;  4KMU A;  1ZYR A;  2JA7 K;  4AYB D;  2A69 A;  5FJ8 K;  4A3K K;  2A6E A;  2WAQ L;  5M5Y K;  2O5I A;  2YU9 C;  4YFN A;  2B63 C;  3H0G K;  3HOW C;  2E2H K;  3WOD A;  2R92 C;  4C2M K;  5D4D A;  2NVX K;  2JA8 K;  3GTL K;  3RZO C;  4A3B K;  4XSZ A;  2VUM K;  2Y0S L;  3S1R K;  5FLM K;  4GZY A;  3M4O C;  3H3V D;  3PO3 K;  3CQZ C;  1I50 C;  3HOZ K;  4XLP A;  2E2I K;  4OIO A;  5M5W K;  1SFO C;  4BXX C;  1TWF C;  3RZD C;  5IYB C;  5IYC K;  1I6H K;  3S16 C;  1TWH K;  3M3Y K;  3S14 K;  5C44 K;  4JK1 A;  1BDF A;  2JA6 K;  4BBR C;  5C3E K;  2PMZ L;  2R7Z C;  5IP9 K;  4Y52 C;  1IW7 A;  4LK1 A;  4YFX A;  4A3I C;  3GTK C;  2E2J K;  4OIN A;  3GTP K;  3HOY K;  4LK0 A;  5IP7 K;  3HOX K;  2NVT K;  4ZH4 A;  4Y7N K;  3GTJ K;  1WCM K;  1TWG C;  1YNN A;  1TWC C;  2YU9 K;  3HOW K;  1XPP A;  4MEY A;  5IYD C;  4A3E C;  1Y1W C;  3HOU C;  3PO2 K;  3S1N C;  2PA8 D;  1TWA C;  3FKI C;  1SMY A;  5M3F K;  3S15 K;  3I4N C;  4Q5S A;  4X6A C;  1K83 C;  3HKZ D;  5M5X K;  3M4O K;  3S2D K;  4QJV A;  3I4M C;  2A6H A;  4BY7 C;  3CQZ K;  1R9T C;  3S1Q C;  4BBS K;  4A93 C;  4A3M K;  4A3G C;  4QIW D;  5C4X C;  2R93 C;  4C3H K;  4BY1 K;  4KN4 A;  1SFO K;  3S17 C;  4NOI A;  1TWF K;  2NVY C;  4A3D C;  5IYB K;  5IYD K;  2JA5 K;  4AYB L;  3GTQ K;  3GTG C;  4A3L K;  3S2H C;  4G7H A;  2NVQ K;  3GTO K;  4YG2 A;  5C4J K;  4A3F K;  3HOV C;  4A3C K;  4Q4Z A;  1I6V A;  3K7A C;  3S1M C;  3H3V L;  4OIP A;  2E2H C;  1HQM A;  2BE5 A;  2JA8 C;  3GTL C;  4A3B C;  2B63 K;  4C3J K;  3HOU K;  3S1R C;  3S1N K;  2R92 K;  3RZO K;  4C3I K;  1K83 K;  2WAQ D;  3I4M K;  1Y1V C; 
#chains in the Genus database with same CATH topology
 3FOF A;  4OIR A;  3GDZ A;  2FQO A;  4LJZ A;  2Y0S D;  5JFE A;  1I3Q C;  3AQP A;  3QX3 A;  3S17 K;  3A8K A;  1DCP A;  4YFK A;  4BBR K;  3GTP C;  1WOS A;  1WSR A;  5IP7 C;  4WIL A;  3GTJ C;  4G7O A;  4C45 A;  1EH1 A;  3H0G C;  3S15 C;  5TMF A;  1JOE A;  4QIW L;  2VUM C;  3S2D C;  1VJE A;  3TFI A;  4A3D K;  1IBA A;  2ZUE A;  3S1Q K;  4C3H C;  2E2I C;  3GTM K;  3GTM A;  4GTL A;  1XZQ A;  3GEI A;  5C44 C;  3GTO C;  5C4J C;  1C0A A;  2JA7 K;  5FJ8 K;  2JA7 A;  4G0W A;  2RGR A;  3ORE A;  4YFN A;  3HOW C;  5E68 A;  2R92 C;  3S1R K;  3L4K A;  2V6U A;  5FLM K;  3M4O C;  3PO3 K;  4KMA A;  1WOP A;  3GEH A;  1SFO C;  5IYC K;  4GTC A;  1F7U A;  4JK1 A;  2JA6 K;  4BBR C;  3MML B;  2JA6 A;  3G4C A;  3HOY K;  2ZFZ A;  3IPJ A;  4KAS A;  1UV7 A;  4GTF A;  4ZH4 A;  3T00 A;  2P5M A;  1WCM K;  2CFA A;  4GTD A;  1XPP A;  3HOU C;  1WCM A;  2PA8 D;  3HKZ D;  3BP8 C;  3TFJ A;  2A6H A;  3OEP A;  4P5A A;  3I4M C;  5IOQ A;  3S1Q C;  2ZUF A;  4A3M K;  1USO A;  1BGW A;  5TJ3 A;  1TWF K;  1TWF A;  2GAG C;  3NUH A;  4A3L K;  4G7H A;  4A3F K;  2Y3P A;  4PAB A;  3S1R C;  3G4A A;  1ZQ1 C;  2YU9 A;  1DCO A;  1K83 K;  1SMY A;  3PO3 C;  3GIR A;  1K83 A;  3OPF A;  1I50 K;  1KQ4 A;  3GEE A;  3VA7 A;  4A3G K;  3BP3 A;  1I50 A;  4BXX K;  4KAR A;  4A3J C;  3RZD K;  3ERE D;  3HOY C;  4LOW A;  3HOV K;  4MQ9 A;  1XXB A;  4Y52 K;  3K7A K;  1VLO A;  1L0W A;  3AQO A;  1WCM C;  4QJV B;  5IOT A;  4LQY A;  3DXJ A;  2WB1 D;  1TWA K;  1Y1V K;  1O2A A;  1TWA A;  1J6X A;  2XCQ A;  4A3M C;  1Y1V A;  5C4X K;  4XSX A;  1X31 C;  2R93 K;  4G7Z A;  2R93 A;  4A3L C;  4PAA A;  4XLN A;  3SZZ A;  3CAG A;  2WB1 L;  4A3F C;  4FM9 A;  4KMU A;  2CFA B;  5CHP A;  4BKW A;  1DD5 A;  4LR2 A;  4A3K K;  2A6E A;  2YU9 C;  2E2H K;  3WOD A;  5D4D A;  2NVX K;  3GTL K;  4XSZ A;  1XXC A;  2Y0S L;  2E2H A;  2NVX A;  2FQT A;  3GTL A;  4KAW X;  1G51 A;  4GTA A;  1I50 C;  3AD7 C;  5M5W K;  4BXX C;  3RZD C;  1I6H K;  1TWH K;  3S14 K;  1O24 A;  1TWH A;  2V6S A;  5C3E K;  5IP9 K;  4Y52 C;  4YFX A;  4LK1 A;  1ISE A;  4O2D A;  4OIN A;  3AD9 C;  4LK0 A;  3HOX K;  4GTE A;  2NVT K;  4GT9 A;  3HOZ K;  3L4J A;  1TWA C;  3GSI A;  5M3F K;  1WQF A;  4QJV A;  3CQZ K;  1O27 A;  1O26 A;  4BLB A;  4M1X A;  3CQZ A;  5C4X C;  1WOO A;  2R93 C;  3S17 C;  1WOR A;  5IYB K;  2JA5 K;  3GTQ K;  4KMD A;  3N0C A;  2JA5 A;  3GTQ A;  2NVQ K;  4YG2 A;  1DCH A;  1USM A;  5JVO A;  4OIP A;  1B4B A;  2E2H C;  3GTL C;  3S1N K;  3RZO K;  4C3I K;  2WAQ D;  4A3D C;  5TMC A;  3T01 A;  3GTM C;  1HI9 A;  1IE0 A;  2NVY K;  1TWH C;  3ADA C;  3S14 C;  2NVY A;  5L46 A;  2A68 A;  5CJ9 A;  5IP9 C;  2RH6 A;  3TTG A;  2JA7 C;  4A3I K;  2PA8 L;  3HOX C;  1O25 A;  3AD8 C;  2NVT C;  3S1M K;  4G0U A;  3HKZ L;  1PJ5 A;  2PMZ D;  2GSU A;  5M3M K;  1AB4 A;  1O2B A;  3FKI K;  5FLM C;  3I4N K;  3FKI A;  2CW0 A;  4BY7 K;  1R9T K;  1R9T A;  1I3Q K;  2JA5 C;  3GTQ C;  5IYC C;  1YNJ A;  1I3Q A;  2PHC B;  2NVQ C;  4KM9 A;  2JA6 C;  1IQ0 A;  3GTG K;  3S2H K;  1YX2 A;  1V5V A;  3GTG A;  4AYB D;  2A69 A;  3SZY A;  2GAH C;  2O5I A;  3FHZ A;  3H0G K;  3LAP A;  3RZO C;  2JA8 K;  4A3B K;  3H0G A;  2VUM K;  1WSV A;  2VUM A;  3H3V D;  4XLP A;  2E2I K;  1INN A;  1GE9 A;  5IOS A;  3S0X A;  1TWF C;  3Q3Q A;  1ZXO A;  3M3Y K;  4KB4 A;  5C44 K;  1BDF A;  2XCR B;  3A8I A;  4KDD A;  4A3I C;  2E2J K;  4GFQ A;  5EGH A;  4Y7N K;  3HOW K;  3PO2 K;  3FKI C;  4Q5S A;  3I4N C;  1K83 C;  5M5X K;  3M4O K;  4AH6 A;  4BY7 C;  1R9T C;  4BBS K;  4A3G C;  4QIW D;  4KC6 A;  2JH3 A;  4BY1 K;  3A8J A;  1RU0 A;  4KN4 A;  1SFO K;  4NOI A;  3FOE A;  1J6V A;  1SFO A;  3LAJ A;  1XZP A;  3N0B A;  1ZBS A;  3GTG C;  3S2H C;  1IL2 A;  3HOV C;  4A3C K;  1BS2 A;  1I6V A;  3K7A C;  1EK8 A;  1EI6 A;  1YCL A;  1O29 A;  4P9S A;  1HQM A;  2JA8 C;  4A3B C;  2B63 K;  4C3J K;  3HOU K;  4GTB A;  5HL8 A;  2B63 A;  3I4M K;  1Y1V C;  4WJ3 M;  4LLG A;  4OIQ A;  4WJ4 A;  4MEX A;  1O2F B;  3M3Y C;  3EQL A;  3S16 K;  2GSN A;  4ILD A;  2W7V A;  2E2J C;  2R7Z K;  2P8T A;  3GTK K;  1WIH A;  2R7Z A;  4A3K C;  4Y7N C;  3GTK A;  3PO2 C;  1TWG K;  1TWC K;  2NVX C;  4A3E K;  1Y1W K;  5IYD K;  1TWG A;  3HXA A;  1TWC A;  4X6A K;  1Y1W A;  3JST A;  4BBS C;  1F7V A;  2PPB A;  1B4A A;  1VRQ C;  4DDQ A;  4A93 K;  4BY1 C;  1EQR A;  3BUE A;  1ZVU A;  2O5J A;  1I6H C;  4A3J K;  4KN7 A;  1BJT A;  5C3E C;  4A3C C;  1ZYR A;  4FZB A;  2WAQ L;  5M5Y K;  1EFW A;  4G0V A;  4BLA A;  2B63 C;  3V4G A;  1WQH A;  4C3J C;  3HOZ C;  3T02 A;  4C2M K;  4GZY A;  4RMF A;  3CQZ C;  1XZP B;  3AH5 A;  4P5B A;  4OIO A;  2D6F C;  2EBB A;  4KMH A;  5IYB C;  5IOR A;  3S16 C;  2V6T A;  1PJ6 A;  4XCH A;  2PMZ L;  3LPX A;  2R7Z C;  3TFH A;  1IW7 A;  3GTK C;  3GTP K;  2XCO A;  2GSO A;  5IP7 K;  3GTP A;  4KM8 A;  1J6W A;  1JVI A;  3GTJ K;  2YU9 K;  1TWG C;  1YNN A;  1TWC C;  1F93 A;  2KWA A;  4MEY A;  5IYD C;  4A3E C;  1Y1W C;  3GTJ A;  3S1N C;  4X6A C;  3S15 K;  4C3I C;  3S2D K;  1XZQ B;  4A93 C;  1WQG A;  4C3H K;  1VGX A;  4KAT A;  1F9N A;  2NVY C;  2E2I A;  4AYB L;  1VH2 A;  1PJ7 A;  5EGE A;  3GTO K;  5C4J K;  3GTO A;  4Q4Z A;  3S1M C;  4J3N A;  1IS1 A;  1J98 A;  1XXA A;  3H3V L;  1O28 A;  4C2M C;  2BE5 A;  3N3Y A;  1JQW A;  4KB2 A;  2R92 K;  2R92 A; 
#chains in the Genus database with same CATH homology
 4OIR A;  5TMC A;  1I50 K;  3GTM C;  4A3G K;  4LJZ A;  2Y0S D;  4LLG A;  1I3Q C;  4OIQ A;  3S17 K;  2NVY K;  4MEX A;  1TWH C;  4BXX K;  3HOZ C;  4A3J C;  3RZD K;  3M3Y C;  3S14 C;  2A68 A;  3EQL A;  3S16 K;  4YFK A;  5IP9 C;  4BBR K;  2E2J C;  3GTP C;  3HOY C;  2R7Z K;  3HOV K;  4MQ9 A;  4Y52 K;  2JA7 C;  5IP7 C;  4A3I K;  2PA8 L;  3K7A K;  3HOX C;  3GTK K;  3S1M K;  2NVT C;  4A3K C;  3HKZ L;  4Y7N C;  3GTJ C;  1WCM C;  4QJV B;  2PMZ D;  4G7O A;  3PO2 C;  3DXJ A;  2WB1 D;  3H0G C;  1TWG K;  1TWC K;  5TMF A;  2NVX C;  4QIW L;  5M3M K;  4A3E K;  1Y1W K;  2VUM C;  3PO3 C;  3S15 C;  3S2D C;  3FKI K;  1TWA K;  5FLM C;  4X6A K;  3I4N K;  4BBS C;  1Y1V K;  4A3D K;  2CW0 A;  4A3M C;  4BY7 K;  1R9T K;  2PPB A;  3S1Q K;  2E2I C;  4BY1 C;  3GTM K;  4A93 K;  5C4X K;  1I3Q K;  4XSX A;  2R93 K;  2JA5 C;  4G7Z A;  3GTQ C;  5IYC C;  1YNJ A;  2O5J A;  1I6H C;  4A3J K;  4KN7 A;  5C44 C;  4A3L C;  2NVQ C;  4XLN A;  3GTO C;  2JA6 C;  5C3E C;  2WB1 L;  5C4J C;  3GTG K;  4A3F C;  3S2H K;  4A3C C;  4KMU A;  1ZYR A;  2JA7 K;  4AYB D;  2A69 A;  5FJ8 K;  4A3K K;  2A6E A;  2WAQ L;  5M5Y K;  2O5I A;  2YU9 C;  4YFN A;  2B63 C;  3H0G K;  3HOW C;  2E2H K;  3WOD A;  2R92 C;  4C2M K;  5D4D A;  2NVX K;  2JA8 K;  3GTL K;  3RZO C;  4A3B K;  4XSZ A;  2VUM K;  2Y0S L;  3S1R K;  5FLM K;  4GZY A;  3M4O C;  3H3V D;  3PO3 K;  3CQZ C;  1I50 C;  3HOZ K;  4XLP A;  2E2I K;  4OIO A;  5M5W K;  1SFO C;  4BXX C;  1TWF C;  3RZD C;  5IYB C;  5IYC K;  1I6H K;  3S16 C;  1TWH K;  3M3Y K;  3S14 K;  5C44 K;  4JK1 A;  1BDF A;  2JA6 K;  4BBR C;  5C3E K;  2PMZ L;  2R7Z C;  5IP9 K;  4Y52 C;  1IW7 A;  4LK1 A;  4YFX A;  4A3I C;  3GTK C;  2E2J K;  4OIN A;  3GTP K;  3HOY K;  4LK0 A;  5IP7 K;  3HOX K;  2NVT K;  4ZH4 A;  4Y7N K;  3GTJ K;  1WCM K;  1TWG C;  1YNN A;  1TWC C;  2YU9 K;  3HOW K;  1XPP A;  4MEY A;  5IYD C;  4A3E C;  1Y1W C;  3HOU C;  3PO2 K;  3S1N C;  2PA8 D;  1TWA C;  3FKI C;  1SMY A;  5M3F K;  3S15 K;  3I4N C;  4Q5S A;  4X6A C;  1K83 C;  3HKZ D;  5M5X K;  3M4O K;  3S2D K;  4QJV A;  3I4M C;  2A6H A;  4BY7 C;  3CQZ K;  1R9T C;  3S1Q C;  4BBS K;  4A93 C;  4A3M K;  4A3G C;  4QIW D;  5C4X C;  2R93 C;  4C3H K;  4BY1 K;  4KN4 A;  1SFO K;  3S17 C;  4NOI A;  1TWF K;  2NVY C;  4A3D C;  5IYB K;  5IYD K;  2JA5 K;  4AYB L;  3GTQ K;  3GTG C;  4A3L K;  3S2H C;  4G7H A;  2NVQ K;  3GTO K;  4YG2 A;  5C4J K;  4A3F K;  3HOV C;  4A3C K;  4Q4Z A;  1I6V A;  3K7A C;  3S1M C;  3H3V L;  4OIP A;  2E2H C;  1HQM A;  2BE5 A;  2JA8 C;  3GTL C;  4A3B C;  2B63 K;  4C3J K;  3HOU K;  3S1R C;  3S1N K;  2R92 K;  3RZO K;  4C3I K;  1K83 K;  2WAQ D;  3I4M K;  1Y1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...