3GTPK

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtpK00
3HOVK 1TWAK 3HOWK 3M3YK 1I50C 4A3MC 2WAQD 4KN7A 3HOVC 4A3GC 3H3VD 1TWAC 2NVXK 3HOWC 3M3YC 4KMUA 4A93K 3GTQC 4KN4A 5IYBC 3M4OK 2NVXC 4MEYA 5IP7K 1HQMA 2VUMC 4OINA 4A3BK 3GTKK 3M4OC 4GZYA 3H0GC 3CQZK 4BBSK 4C3JK 2R7ZK 4A3BC 4XSZA 5IYDK 3CQZC 4BBSC 3S14C 2BE5A 2YU9K 4A3EC 2PMZL 2Y0SL 1TWHC 5C3EK 1R9TK 4Y7NC 2YU9C 3S16K 4G7HA 2Y0SD 2PMZD 2R93K 3FKIK 4A3IC 3HOYK 3I4NC 4JK1A 1BDFA 3RZOC 3FKIC 1ZYRA 2WAQL 3HOYC 2A69A 3S1QK 3GTMK 4A3LK 1SMYA 2E2IC 3S1QC 2CW0A 3S1MC 1K83K 3K7AK 3PO2K 3GTGK 1K83C 1TWCK 3HOUC 3GTGC 3PO2C 4A93C 4YFKA 5D4DA 5IP7C 4A3KK 1TWCC 4C3HK 4A3DK 4X6AK 1YNJA 3GTKC 3WODA 1IW7A 3GTLK 4A3KC 4BY1K 2JA7K 2R7ZC 1WCMK 4A3DC 4BY7K 4X6AC 5IYDC 5C4JK 5IP9K 4OIOA 5FLMK 2JA7C 4AYBL 1WCMC 5C4XK 5IP9C 5TMFA 3S17K 5FLMC 4LLGA 5C3EC 1R9TC 2JA8K 2NVQK 1TWFK 2JA6K 3PO3K 3S1NC 4QJVB 4AYBD 2E2JK 4G7ZA 3S17C 3S16C 2R92K 2JA8C 4MEXA 2NVQC 3S15K 1TWFC 4BBRK 3DXJA 1Y1WK 2E2JC 3HOZK 2R93C 5IYCK 4Q5SA 5TMCA 2JA5K 3HOZC 4A3FK 2O5JA 1I3QK 4Y52K 3GTMC 2JA5C 4A3FC 1TWGK 3S2HK 3S2DK 4XSXA 3GTPK 3S2HC 3S2DC 3K7AC 3HOXK 5M3MK 4A3CK 3I4MK 4A3CC 2A6EA 4LJZA 4A3JK 4XLNA 1Y1VK 4NOIA 4QJVA 2NVYK 5M3FK 2B63K 2O5IA 1I6VA 4A3JC 4OIQA 1YNNA 3S1MK 3GTLC 2NVYC 4LK0A 4BY1C 2B63C 4BXXK 5C4JC 2A6HA 1I50K 2PPBA 4A3MK 4A3GK 5C4XC 3EQLA 2WB1L 4A3LC 4C2MK 4BY7C 4QIWD 3GTQK 5IYBK 1SFOK 2JA6C 3GTJK 3PO3C 2E2HK 2WB1D 2R92C 3S15C 2VUMK 4LK1A 4XLPA 4BBRC 1Y1WC 1SFOC 1XPPA 4MQ9A 3GTJC 5IYCC 2E2HC 3H0GK 4BXXC 4YFNA 4YFXA 4G7OA 3S1RK 4ZH4A 1I3QC 4Y52C 3S14K 3S1RC 3HKZL 3S1NK 1TWGC 2A68A 4A3EK 5M5XK 1TWHK 1I6HK 2PA8L 4Y7NK 3GTPC 3HKZD 3HOXC 5C44K 1I6HC 4Q4ZA 4OIPA 2NVTK 4A3IK 2PA8D 3GTOK 3I4MC 3I4NK 5C44C 5M5YK 3RZDK 4OIRA 1Y1VC 2NVTC 3H3VL 3RZOK 3GTOC 3HOUK 3RZDC 5M5WK 5FJ8K 4QIWL 2E2IK 4C3IK 4YG2A
chains in the Genus database with same CATH superfamily
3M3YK 1I50C 2R7ZA 4A3GC 2NVXK 4GTCA 2GSUA 1IE0A 4A93K 2V6SA 5IYBC 3G4CA 3NUHA 1O2FB 3AQPA 1HQMA 3LPXA 3FOFA 4OINA 2VUMC 4GTLA 3GTKK 4A3BK 3CQZK 4J3NA 4BBSK 4C3JK 4P5BA 2PMZL 2Y0SD 1O2AA 2R93K 4FM9A 1ZXOA 4JK1A 1BDFA 4PAAA 3HOYC 2A69A 3S1QK 1SMYA 2E2IC 1WIHA 1B4BA 1VH2A 1K83C 5HL8A 4KAWX 3PO2C 4A93C 5D4DA 3GTKC 2RGRA 3WODA 3TTGA 1BS2A 1IW7A 3SZZA 4C3HC 4BY1K 5FLMK 1EH1A 2GAHC 1WCMC 3S17K 5E68A 2NVQK 3A8JA 3JSTA 2R92K 2JA8C 4P9SA 3GTPA 2R93C 1XXBA 3HOZC 3S0XA 2ZUEA 4FZBA 1I3QK 4Y52K 3AD7C 1TWGK 3GIRA 3S2DK 1VRQC 2GSOA 3T00A 5IOQA 1WOOA 2GSNA 5M3MK 1I50A 1IL2A 1EQRA 2A6EA 4XLNA 2XCRB 1BGWA 4GTBA 3QX3A 1AB4A 2VUMA 2NVYC 1X31C 4LK0A 4BY1C 2B63C 2D6FC 1O2BA 4A3MK 1J6XA 3BP3A 4LR2A 2XCOA 1F9NA 4QIWD 3GTQK 3CAGA 2R92C 3GTJC 1BJTA 2E2HC 2V6TA 3ERED 1I3QC 4Y52C 3S14K 1TWGC 4KMHA 3L4KA 1YCLA 2PA8L 2E2IA 5C44K 1I6HC 4Q4ZA 4A3IK 4LOWA 1K83A 2NVXA 5M5YK 3RZDK 5FJ8K 4QIWL 3HOUC 3GTKA 3N0CA 1F7UA 4A3MC 1PJ6A 1TWAC 1WCMA 3GTQC 4GT9A 1YX2A 3LAPA 1PJ5A 4MEYA 2CFAB 5IP7K 1KQ4A 2R93A 1VLOA 4DDQA 1ISEA 3S14C 2BE5A 5C3EK 3OREA 1USOA 2YU9C 2PMZD 4A3IC 4KB2A 3HOYK 3HXAA 3FKIC 4WJ4A 1GE9A 1K83K 2NVYA 3GEHA 1L0WA 4XCHA 2B63A 3PO2K 1O28A 3GTGC 5IP7C 1TWCC 4C3HK 1VJEA 5EGHA 2R92A 3GTLK 4A3KC 4GTAA 1WCMK 2GAGC 2E2HA 1WOPA 4OIOA 5EGEA 5TMFA 1I3QA 5C3EC 2JA8K 1TWGA 3PO3K 3S1NC 3OPFA 1TWFC 3GEEA 3DXJA 3HOZK 5IYCK 4Q5SA 3ADAC 2O5JA 4GTEA 2JA5C 4A3FC 4KM9A 1XZPA 4A3CC 4LJZA 1Y1VK 3VA7A 3GTQA 2O5IA 2NVYK 2B63K 3T02A 4A3JC 5JFEA 1O29A 1DCOA 3GTLC 4KARA 4BXXK 2A6HA 2RH6A 2WB1L 4C2MK 4G0UA 1XXCA 3PO3C 2PHCB 3GTJK 4KMDA 2E2HK 1SFOC 3Q3QA 2YU9A 5IYCC 3T01A 4YFXA 1ZBSA 1WSVA 3GDZA 4G7OA 3SZYA 3FKIA 1EFWA 3HKZL 3BP8C 1O24A 1I6HK 4Y7NK 1C0AA 3AD9C 2PA8D 2ZUFA 3I4NK 4OIRA 1Y1VC 2NVTC 3H3VL 3RZOK 3GTGA 3HOUK 1XZQB 1TWCA 4G0VA 1PJ7A 4YG2A 4BXXC 1ZVUA 1TWAK 2WAQD 3HOVC 3HOWC 4C2MC 3AH5A 4KMUA 4WILA 3OEPA 4P5AA 1G51A 3M4OC 1TWFA 1J6VA 4XSZA 5IYDK 1HI9A 1JQWA 4GTFA 2YU9K 2JA5A 1R9TK 4Y7NC 1EI6A 4BLAA 4G7HA 3FKIK 3I4NC 4ILDA 3RZOC 1ZYRA 4KATA 2WAQL 4WJ3M 3GTMK 1O27A 3GTLA 3GTGK 1TWCK 4YFKA 3TFHA 4A3KK 3L4JA 1YNJA 4G0WA 1SFOA 4RMFA 4A3DC 4X6AC 1XXAA 5IYDC 1JOEA 5C4JK 2JA7C 4AYBL 1USMA 3GEIA 2ZFZA 4LQYA 4C45A 5IP9C 3S1NK 4LLGA 1R9TC 1TWFK 2JA6K 4G7ZA 3S15K 4MEXA 1J6WA 1Y1WK 4BLBA 2E2JC 3G4AA 2JA5K 4A3FK 1Y1VA 3GTMC 5IORA 1B4AA 4M1XA 2P8TA 4XSXA 3S2HC 3HOXK 4A3CK 3N3YA 3I4MK 4A3JK 3MMLB 4NOIA 1O25A 4QJVA 3GTJA 4OIQA 1YNNA 3TFJA 5C4JC 2PPBA 3TFIA 4GTDA 3EQLA 4PABA 1F7VA 1SFOK 2JA6C 2WB1D 3S15C 5IOSA 2Y3PA 1Y1WC 1XPPA 3H0GK 4YFNA 1WORA 4ZH4A 1EK8A 3S1RC 2A68A 1DCHA 4A3EK 1TWHK 4O2DA 3HKZD 3HOXC 1TWAA 4OIPA 2NVTK 5L46A 3I4MC 3AQOA 3GTOC 3V4GA 3H3VD 4KDDA 2JH3A 3HOVK 2CFAA 4KM8A 3HOWK 1WQHA 1WOSA 4C3IC 4KN7A 3M3YC 2JA7A 4KN4A 3M4OK 1R9TA 2NVXC 1IBAA 4GZYA 3LAJA 3H0GC 2R7ZK 5CHPA 4A3BC 2V6UA 3CQZC 4BBSC 2KWAA 4C3JC 4A3EC 2Y0SL 3GTMA 1TWHC 1DD5A 1UV7A 3S16K 3AD8C 1VGXA 5IOTA 3S1QC 2CW0A 1ZQ1C 3K7AK 5TJ3A 3FOEA 4KMAA 2JA6A 4A3DK 4X6AK 1V5VA 1JVIA 1Y1WA 2JA7K 4BKWA 2R7ZC 5IP9K 5C4XK 4A3LK 5FLMC 4BY7K 2P5MA 4QJVB 4AYBD 2E2JK 3S17C 3S16C 2NVQC 4KC6A 4BBRK 1IQ0A 3IPJA 5TMCA 2FQTA 3GTOA 3S2HK 5JVOA 3GTPK 3S2DC 2FQOA 3K7AC 3FHZA 2XCQA 1IS1A 1O26A 1INNA 5M3FK 1I6VA 3S1MK 1XZPB 1F93A 1WSRA 3H0GA 2EBBA 1WQFA 1J98A 1I50K 3N0BA 4A3GK 5C4XC 3CQZA 3GSIA 4KB4A 4A3LC 4BY7C 5IYBK 1TWHA 5CJ9A 2VUMK 4LK1A 4XLPA 4BBRC 4GFQA 3A8KA 4MQ9A 3S1RK 2W7VA 3BUEA 5M5XK 1XZQA 3GTPC 4KASA 1DCPA 3GTOK 5C44C 3A8IA 1RU0A 3RZDC 1WQGA 5M5WK 3S1MC 2E2IK 4AH6A 4C3IK
chains in the Genus database with same CATH topology
3HOVK 1TWAK 3HOWK 3M3YK 1I50C 4A3MC 2WAQD 4KN7A 3HOVC 4A3GC 3H3VD 1TWAC 2NVXK 3HOWC 3M3YC 4KMUA 4A93K 3GTQC 4KN4A 5IYBC 3M4OK 2NVXC 4MEYA 5IP7K 1HQMA 2VUMC 4OINA 4A3BK 3GTKK 3M4OC 4GZYA 3H0GC 3CQZK 4BBSK 4C3JK 2R7ZK 4A3BC 4XSZA 5IYDK 3CQZC 4BBSC 3S14C 2BE5A 2YU9K 4A3EC 2PMZL 2Y0SL 1TWHC 5C3EK 1R9TK 4Y7NC 2YU9C 3S16K 4G7HA 2Y0SD 2PMZD 2R93K 3FKIK 4A3IC 3HOYK 3I4NC 4JK1A 1BDFA 3RZOC 3FKIC 1ZYRA 2WAQL 3HOYC 2A69A 3S1QK 3GTMK 4A3LK 1SMYA 2E2IC 3S1QC 2CW0A 3S1MC 1K83K 3K7AK 3PO2K 3GTGK 1K83C 1TWCK 3HOUC 3GTGC 3PO2C 4A93C 4YFKA 5D4DA 5IP7C 4A3KK 1TWCC 4C3HK 4A3DK 4X6AK 1YNJA 3GTKC 3WODA 1IW7A 3GTLK 4A3KC 4BY1K 2JA7K 2R7ZC 1WCMK 4A3DC 4BY7K 4X6AC 5IYDC 5C4JK 5IP9K 4OIOA 5FLMK 2JA7C 4AYBL 1WCMC 5C4XK 5IP9C 5TMFA 3S17K 5FLMC 4LLGA 5C3EC 1R9TC 2JA8K 2NVQK 1TWFK 2JA6K 3PO3K 3S1NC 4QJVB 4AYBD 2E2JK 4G7ZA 3S17C 3S16C 2R92K 2JA8C 4MEXA 2NVQC 3S15K 1TWFC 4BBRK 3DXJA 1Y1WK 2E2JC 3HOZK 2R93C 5IYCK 4Q5SA 5TMCA 2JA5K 3HOZC 4A3FK 2O5JA 1I3QK 4Y52K 3GTMC 2JA5C 4A3FC 1TWGK 3S2HK 3S2DK 4XSXA 3GTPK 3S2HC 3S2DC 3K7AC 3HOXK 5M3MK 4A3CK 3I4MK 4A3CC 2A6EA 4LJZA 4A3JK 4XLNA 1Y1VK 4NOIA 4QJVA 2NVYK 5M3FK 2B63K 2O5IA 1I6VA 4A3JC 4OIQA 1YNNA 3S1MK 3GTLC 2NVYC 4LK0A 4BY1C 2B63C 4BXXK 5C4JC 2A6HA 1I50K 2PPBA 4A3MK 4A3GK 5C4XC 3EQLA 2WB1L 4A3LC 4C2MK 4BY7C 4QIWD 3GTQK 5IYBK 1SFOK 2JA6C 3GTJK 3PO3C 2E2HK 2WB1D 2R92C 3S15C 2VUMK 4LK1A 4XLPA 4BBRC 1Y1WC 1SFOC 1XPPA 4MQ9A 3GTJC 5IYCC 2E2HC 3H0GK 4BXXC 4YFNA 4YFXA 4G7OA 3S1RK 4ZH4A 1I3QC 4Y52C 3S14K 3S1RC 3HKZL 3S1NK 1TWGC 2A68A 4A3EK 5M5XK 1TWHK 1I6HK 2PA8L 4Y7NK 3GTPC 3HKZD 3HOXC 5C44K 1I6HC 4Q4ZA 4OIPA 2NVTK 4A3IK 2PA8D 3GTOK 3I4MC 3I4NK 5C44C 5M5YK 3RZDK 4OIRA 1Y1VC 2NVTC 3H3VL 3RZOK 3GTOC 3HOUK 3RZDC 5M5WK 5FJ8K 4QIWL 2E2IK 4C3IK 4YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV K;  1TWA K;  3HOW K;  3M3Y K;  1I50 C;  4A3M C;  2WAQ D;  4KN7 A;  3HOV C;  4A3G C;  3H3V D;  1TWA C;  2NVX K;  3HOW C;  3M3Y C;  4KMU A;  4A93 K;  3GTQ C;  4KN4 A;  5IYB C;  3M4O K;  2NVX C;  4MEY A;  5IP7 K;  1HQM A;  2VUM C;  4OIN A;  4A3B K;  3GTK K;  3M4O C;  4GZY A;  3H0G C;  3CQZ K;  4BBS K;  4C3J K;  2R7Z K;  4A3B C;  4XSZ A;  5IYD K;  3CQZ C;  4BBS C;  3S14 C;  2BE5 A;  2YU9 K;  4A3E C;  2PMZ L;  2Y0S L;  1TWH C;  5C3E K;  1R9T K;  4Y7N C;  2YU9 C;  3S16 K;  4G7H A;  2Y0S D;  2PMZ D;  2R93 K;  3FKI K;  4A3I C;  3HOY K;  3I4N C;  4JK1 A;  1BDF A;  3RZO C;  3FKI C;  1ZYR A;  2WAQ L;  3HOY C;  2A69 A;  3S1Q K;  3GTM K;  4A3L K;  1SMY A;  2E2I C;  3S1Q C;  2CW0 A;  3S1M C;  1K83 K;  3K7A K;  3PO2 K;  3GTG K;  1K83 C;  1TWC K;  3HOU C;  3GTG C;  3PO2 C;  4A93 C;  4YFK A;  5D4D A;  5IP7 C;  4A3K K;  1TWC C;  4C3H K;  4A3D K;  4X6A K;  1YNJ A;  3GTK C;  3WOD A;  1IW7 A;  3GTL K;  4A3K C;  4BY1 K;  2JA7 K;  2R7Z C;  1WCM K;  4A3D C;  4BY7 K;  4X6A C;  5IYD C;  5C4J K;  5IP9 K;  4OIO A;  5FLM K;  2JA7 C;  4AYB L;  1WCM C;  5C4X K;  5IP9 C;  5TMF A;  3S17 K;  5FLM C;  4LLG A;  5C3E C;  1R9T C;  2JA8 K;  2NVQ K;  1TWF K;  2JA6 K;  3PO3 K;  3S1N C;  4QJV B;  4AYB D;  2E2J K;  4G7Z A;  3S17 C;  3S16 C;  2R92 K;  2JA8 C;  4MEX A;  2NVQ C;  3S15 K;  1TWF C;  4BBR K;  3DXJ A;  1Y1W K;  2E2J C;  3HOZ K;  2R93 C;  5IYC K;  4Q5S A;  5TMC A;  2JA5 K;  3HOZ C;  4A3F K;  2O5J A;  1I3Q K;  4Y52 K;  3GTM C;  2JA5 C;  4A3F C;  1TWG K;  3S2H K;  3S2D K;  4XSX A;  3GTP K;  3S2H C;  3S2D C;  3K7A C;  3HOX K;  5M3M K;  4A3C K;  3I4M K;  4A3C C;  2A6E A;  4LJZ A;  4A3J K;  4XLN A;  1Y1V K;  4NOI A;  4QJV A;  2NVY K;  5M3F K;  2B63 K;  2O5I A;  1I6V A;  4A3J C;  4OIQ A;  1YNN A;  3S1M K;  3GTL C;  2NVY C;  4LK0 A;  4BY1 C;  2B63 C;  4BXX K;  5C4J C;  2A6H A;  1I50 K;  2PPB A;  4A3M K;  4A3G K;  5C4X C;  3EQL A;  2WB1 L;  4A3L C;  4C2M K;  4BY7 C;  4QIW D;  3GTQ K;  5IYB K;  1SFO K;  2JA6 C;  3GTJ K;  3PO3 C;  2E2H K;  2WB1 D;  2R92 C;  3S15 C;  2VUM K;  4LK1 A;  4XLP A;  4BBR C;  1Y1W C;  1SFO C;  1XPP A;  4MQ9 A;  3GTJ C;  5IYC C;  2E2H C;  3H0G K;  4BXX C;  4YFN A;  4YFX A;  4G7O A;  3S1R K;  4ZH4 A;  1I3Q C;  4Y52 C;  3S14 K;  3S1R C;  3HKZ L;  3S1N K;  1TWG C;  2A68 A;  4A3E K;  5M5X K;  1TWH K;  1I6H K;  2PA8 L;  4Y7N K;  3GTP C;  3HKZ D;  3HOX C;  5C44 K;  1I6H C;  4Q4Z A;  4OIP A;  2NVT K;  4A3I K;  2PA8 D;  3GTO K;  3I4M C;  3I4N K;  5C44 C;  5M5Y K;  3RZD K;  4OIR A;  1Y1V C;  2NVT C;  3H3V L;  3RZO K;  3GTO C;  3HOU K;  3RZD C;  5M5W K;  5FJ8 K;  4QIW L;  2E2I K;  4C3I K;  4YG2 A; 
#chains in the Genus database with same CATH topology
 3M3Y K;  1I50 C;  2R7Z A;  4A3G C;  2NVX K;  4GTC A;  2GSU A;  1IE0 A;  4A93 K;  2V6S A;  5IYB C;  3G4C A;  3NUH A;  1O2F B;  3AQP A;  1HQM A;  3LPX A;  3FOF A;  4OIN A;  2VUM C;  4GTL A;  3GTK K;  4A3B K;  3CQZ K;  4J3N A;  4BBS K;  4C3J K;  4P5B A;  2PMZ L;  2Y0S D;  1O2A A;  2R93 K;  4FM9 A;  1ZXO A;  4JK1 A;  1BDF A;  4PAA A;  3HOY C;  2A69 A;  3S1Q K;  1SMY A;  2E2I C;  1WIH A;  1B4B A;  1VH2 A;  1K83 C;  5HL8 A;  4KAW X;  3PO2 C;  4A93 C;  5D4D A;  3GTK C;  2RGR A;  3WOD A;  3TTG A;  1BS2 A;  1IW7 A;  3SZZ A;  4C3H C;  4BY1 K;  5FLM K;  1EH1 A;  2GAH C;  1WCM C;  3S17 K;  5E68 A;  2NVQ K;  3A8J A;  3JST A;  2R92 K;  2JA8 C;  4P9S A;  3GTP A;  2R93 C;  1XXB A;  3HOZ C;  3S0X A;  2ZUE A;  4FZB A;  1I3Q K;  4Y52 K;  3AD7 C;  1TWG K;  3GIR A;  3S2D K;  1VRQ C;  2GSO A;  3T00 A;  5IOQ A;  1WOO A;  2GSN A;  5M3M K;  1I50 A;  1IL2 A;  1EQR A;  2A6E A;  4XLN A;  2XCR B;  1BGW A;  4GTB A;  3QX3 A;  1AB4 A;  2VUM A;  2NVY C;  1X31 C;  4LK0 A;  4BY1 C;  2B63 C;  2D6F C;  1O2B A;  4A3M K;  1J6X A;  3BP3 A;  4LR2 A;  2XCO A;  1F9N A;  4QIW D;  3GTQ K;  3CAG A;  2R92 C;  3GTJ C;  1BJT A;  2E2H C;  2V6T A;  3ERE D;  1I3Q C;  4Y52 C;  3S14 K;  1TWG C;  4KMH A;  3L4K A;  1YCL A;  2PA8 L;  2E2I A;  5C44 K;  1I6H C;  4Q4Z A;  4A3I K;  4LOW A;  1K83 A;  2NVX A;  5M5Y K;  3RZD K;  5FJ8 K;  4QIW L;  3HOU C;  3GTK A;  3N0C A;  1F7U A;  4A3M C;  1PJ6 A;  1TWA C;  1WCM A;  3GTQ C;  4GT9 A;  1YX2 A;  3LAP A;  1PJ5 A;  4MEY A;  2CFA B;  5IP7 K;  1KQ4 A;  2R93 A;  1VLO A;  4DDQ A;  1ISE A;  3S14 C;  2BE5 A;  5C3E K;  3ORE A;  1USO A;  2YU9 C;  2PMZ D;  4A3I C;  4KB2 A;  3HOY K;  3HXA A;  3FKI C;  4WJ4 A;  1GE9 A;  1K83 K;  2NVY A;  3GEH A;  1L0W A;  4XCH A;  2B63 A;  3PO2 K;  1O28 A;  3GTG C;  5IP7 C;  1TWC C;  4C3H K;  1VJE A;  5EGH A;  2R92 A;  3GTL K;  4A3K C;  4GTA A;  1WCM K;  2GAG C;  2E2H A;  1WOP A;  4OIO A;  5EGE A;  5TMF A;  1I3Q A;  5C3E C;  2JA8 K;  1TWG A;  3PO3 K;  3S1N C;  3OPF A;  1TWF C;  3GEE A;  3DXJ A;  3HOZ K;  5IYC K;  4Q5S A;  3ADA C;  2O5J A;  4GTE A;  2JA5 C;  4A3F C;  4KM9 A;  1XZP A;  4A3C C;  4LJZ A;  1Y1V K;  3VA7 A;  3GTQ A;  2O5I A;  2NVY K;  2B63 K;  3T02 A;  4A3J C;  5JFE A;  1O29 A;  1DCO A;  3GTL C;  4KAR A;  4BXX K;  2A6H A;  2RH6 A;  2WB1 L;  4C2M K;  4G0U A;  1XXC A;  3PO3 C;  2PHC B;  3GTJ K;  4KMD A;  2E2H K;  1SFO C;  3Q3Q A;  2YU9 A;  5IYC C;  3T01 A;  4YFX A;  1ZBS A;  1WSV A;  3GDZ A;  4G7O A;  3SZY A;  3FKI A;  1EFW A;  3HKZ L;  3BP8 C;  1O24 A;  1I6H K;  4Y7N K;  1C0A A;  3AD9 C;  2PA8 D;  2ZUF A;  3I4N K;  4OIR A;  1Y1V C;  2NVT C;  3H3V L;  3RZO K;  3GTG A;  3HOU K;  1XZQ B;  1TWC A;  4G0V A;  1PJ7 A;  4YG2 A;  4BXX C;  1ZVU A;  1TWA K;  2WAQ D;  3HOV C;  3HOW C;  4C2M C;  3AH5 A;  4KMU A;  4WIL A;  3OEP A;  4P5A A;  1G51 A;  3M4O C;  1TWF A;  1J6V A;  4XSZ A;  5IYD K;  1HI9 A;  1JQW A;  4GTF A;  2YU9 K;  2JA5 A;  1R9T K;  4Y7N C;  1EI6 A;  4BLA A;  4G7H A;  3FKI K;  3I4N C;  4ILD A;  3RZO C;  1ZYR A;  4KAT A;  2WAQ L;  4WJ3 M;  3GTM K;  1O27 A;  3GTL A;  3GTG K;  1TWC K;  4YFK A;  3TFH A;  4A3K K;  3L4J A;  1YNJ A;  4G0W A;  1SFO A;  4RMF A;  4A3D C;  4X6A C;  1XXA A;  5IYD C;  1JOE A;  5C4J K;  2JA7 C;  4AYB L;  1USM A;  3GEI A;  2ZFZ A;  4LQY A;  4C45 A;  5IP9 C;  3S1N K;  4LLG A;  1R9T C;  1TWF K;  2JA6 K;  4G7Z A;  3S15 K;  4MEX A;  1J6W A;  1Y1W K;  4BLB A;  2E2J C;  3G4A A;  2JA5 K;  4A3F K;  1Y1V A;  3GTM C;  5IOR A;  1B4A A;  4M1X A;  2P8T A;  4XSX A;  3S2H C;  3HOX K;  4A3C K;  3N3Y A;  3I4M K;  4A3J K;  3MML B;  4NOI A;  1O25 A;  4QJV A;  3GTJ A;  4OIQ A;  1YNN A;  3TFJ A;  5C4J C;  2PPB A;  3TFI A;  4GTD A;  3EQL A;  4PAB A;  1F7V A;  1SFO K;  2JA6 C;  2WB1 D;  3S15 C;  5IOS A;  2Y3P A;  1Y1W C;  1XPP A;  3H0G K;  4YFN A;  1WOR A;  4ZH4 A;  1EK8 A;  3S1R C;  2A68 A;  1DCH A;  4A3E K;  1TWH K;  4O2D A;  3HKZ D;  3HOX C;  1TWA A;  4OIP A;  2NVT K;  5L46 A;  3I4M C;  3AQO A;  3GTO C;  3V4G A;  3H3V D;  4KDD A;  2JH3 A;  3HOV K;  2CFA A;  4KM8 A;  3HOW K;  1WQH A;  1WOS A;  4C3I C;  4KN7 A;  3M3Y C;  2JA7 A;  4KN4 A;  3M4O K;  1R9T A;  2NVX C;  1IBA A;  4GZY A;  3LAJ A;  3H0G C;  2R7Z K;  5CHP A;  4A3B C;  2V6U A;  3CQZ C;  4BBS C;  2KWA A;  4C3J C;  4A3E C;  2Y0S L;  3GTM A;  1TWH C;  1DD5 A;  1UV7 A;  3S16 K;  3AD8 C;  1VGX A;  5IOT A;  3S1Q C;  2CW0 A;  1ZQ1 C;  3K7A K;  5TJ3 A;  3FOE A;  4KMA A;  2JA6 A;  4A3D K;  4X6A K;  1V5V A;  1JVI A;  1Y1W A;  2JA7 K;  4BKW A;  2R7Z C;  5IP9 K;  5C4X K;  4A3L K;  5FLM C;  4BY7 K;  2P5M A;  4QJV B;  4AYB D;  2E2J K;  3S17 C;  3S16 C;  2NVQ C;  4KC6 A;  4BBR K;  1IQ0 A;  3IPJ A;  5TMC A;  2FQT A;  3GTO A;  3S2H K;  5JVO A;  3GTP K;  3S2D C;  2FQO A;  3K7A C;  3FHZ A;  2XCQ A;  1IS1 A;  1O26 A;  1INN A;  5M3F K;  1I6V A;  3S1M K;  1XZP B;  1F93 A;  1WSR A;  3H0G A;  2EBB A;  1WQF A;  1J98 A;  1I50 K;  3N0B A;  4A3G K;  5C4X C;  3CQZ A;  3GSI A;  4KB4 A;  4A3L C;  4BY7 C;  5IYB K;  1TWH A;  5CJ9 A;  2VUM K;  4LK1 A;  4XLP A;  4BBR C;  4GFQ A;  3A8K A;  4MQ9 A;  3S1R K;  2W7V A;  3BUE A;  5M5X K;  1XZQ A;  3GTP C;  4KAS A;  1DCP A;  3GTO K;  5C44 C;  3A8I A;  1RU0 A;  3RZD C;  1WQG A;  5M5W K;  3S1M C;  2E2I K;  4AH6 A;  4C3I K; 
#chains in the Genus database with same CATH homology
 3HOV K;  1TWA K;  3HOW K;  3M3Y K;  1I50 C;  4A3M C;  2WAQ D;  4KN7 A;  3HOV C;  4A3G C;  3H3V D;  1TWA C;  2NVX K;  3HOW C;  3M3Y C;  4KMU A;  4A93 K;  3GTQ C;  4KN4 A;  5IYB C;  3M4O K;  2NVX C;  4MEY A;  5IP7 K;  1HQM A;  2VUM C;  4OIN A;  4A3B K;  3GTK K;  3M4O C;  4GZY A;  3H0G C;  3CQZ K;  4BBS K;  4C3J K;  2R7Z K;  4A3B C;  4XSZ A;  5IYD K;  3CQZ C;  4BBS C;  3S14 C;  2BE5 A;  2YU9 K;  4A3E C;  2PMZ L;  2Y0S L;  1TWH C;  5C3E K;  1R9T K;  4Y7N C;  2YU9 C;  3S16 K;  4G7H A;  2Y0S D;  2PMZ D;  2R93 K;  3FKI K;  4A3I C;  3HOY K;  3I4N C;  4JK1 A;  1BDF A;  3RZO C;  3FKI C;  1ZYR A;  2WAQ L;  3HOY C;  2A69 A;  3S1Q K;  3GTM K;  4A3L K;  1SMY A;  2E2I C;  3S1Q C;  2CW0 A;  3S1M C;  1K83 K;  3K7A K;  3PO2 K;  3GTG K;  1K83 C;  1TWC K;  3HOU C;  3GTG C;  3PO2 C;  4A93 C;  4YFK A;  5D4D A;  5IP7 C;  4A3K K;  1TWC C;  4C3H K;  4A3D K;  4X6A K;  1YNJ A;  3GTK C;  3WOD A;  1IW7 A;  3GTL K;  4A3K C;  4BY1 K;  2JA7 K;  2R7Z C;  1WCM K;  4A3D C;  4BY7 K;  4X6A C;  5IYD C;  5C4J K;  5IP9 K;  4OIO A;  5FLM K;  2JA7 C;  4AYB L;  1WCM C;  5C4X K;  5IP9 C;  5TMF A;  3S17 K;  5FLM C;  4LLG A;  5C3E C;  1R9T C;  2JA8 K;  2NVQ K;  1TWF K;  2JA6 K;  3PO3 K;  3S1N C;  4QJV B;  4AYB D;  2E2J K;  4G7Z A;  3S17 C;  3S16 C;  2R92 K;  2JA8 C;  4MEX A;  2NVQ C;  3S15 K;  1TWF C;  4BBR K;  3DXJ A;  1Y1W K;  2E2J C;  3HOZ K;  2R93 C;  5IYC K;  4Q5S A;  5TMC A;  2JA5 K;  3HOZ C;  4A3F K;  2O5J A;  1I3Q K;  4Y52 K;  3GTM C;  2JA5 C;  4A3F C;  1TWG K;  3S2H K;  3S2D K;  4XSX A;  3GTP K;  3S2H C;  3S2D C;  3K7A C;  3HOX K;  5M3M K;  4A3C K;  3I4M K;  4A3C C;  2A6E A;  4LJZ A;  4A3J K;  4XLN A;  1Y1V K;  4NOI A;  4QJV A;  2NVY K;  5M3F K;  2B63 K;  2O5I A;  1I6V A;  4A3J C;  4OIQ A;  1YNN A;  3S1M K;  3GTL C;  2NVY C;  4LK0 A;  4BY1 C;  2B63 C;  4BXX K;  5C4J C;  2A6H A;  1I50 K;  2PPB A;  4A3M K;  4A3G K;  5C4X C;  3EQL A;  2WB1 L;  4A3L C;  4C2M K;  4BY7 C;  4QIW D;  3GTQ K;  5IYB K;  1SFO K;  2JA6 C;  3GTJ K;  3PO3 C;  2E2H K;  2WB1 D;  2R92 C;  3S15 C;  2VUM K;  4LK1 A;  4XLP A;  4BBR C;  1Y1W C;  1SFO C;  1XPP A;  4MQ9 A;  3GTJ C;  5IYC C;  2E2H C;  3H0G K;  4BXX C;  4YFN A;  4YFX A;  4G7O A;  3S1R K;  4ZH4 A;  1I3Q C;  4Y52 C;  3S14 K;  3S1R C;  3HKZ L;  3S1N K;  1TWG C;  2A68 A;  4A3E K;  5M5X K;  1TWH K;  1I6H K;  2PA8 L;  4Y7N K;  3GTP C;  3HKZ D;  3HOX C;  5C44 K;  1I6H C;  4Q4Z A;  4OIP A;  2NVT K;  4A3I K;  2PA8 D;  3GTO K;  3I4M C;  3I4N K;  5C44 C;  5M5Y K;  3RZD K;  4OIR A;  1Y1V C;  2NVT C;  3H3V L;  3RZO K;  3GTO C;  3HOU K;  3RZD C;  5M5W K;  5FJ8 K;  4QIW L;  2E2I K;  4C3I K;  4YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...