3GTPK

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtpK00
3S1NC 2JA7C 4XLPA 4LLGA 3K7AK 3I4NK 5IP9C 3H3VL 3M4OK 1I6VA 5IYBK 3H3VD 1I50C 1SMYA 4YFXA 4BY1C 4OIRA 4A3JC 3HKZD 2O5JA 4BXXC 3GTKC 4GZYA 5TMFA 4LK1A 4QIWD 4A3MC 2JA6K 4X6AC 2A6HA 4XLNA 3HOXK 4C2MK 4A3EC 3HOZC 3S1QC 2NVTC 1Y1WK 1WCMK 3GTOC 3S16K 4G7OA 2R93C 3GTLK 1TWHK 4A3CK 2JA5K 2YU9C 1TWAC 1TWFC 2B63K 2O5IA 4KN7A 5D4DA 3GTGK 4A3GC 5C3EK 2R92K 2WB1L 4BBSC 1HQMA 3DXJA 4KMUA 2PMZD 4Y7NC 4A3KK 3HOUC 4G7ZA 3I4MC 3PO2C 3S14C 4A3FK 4A3IC 3S2HK 4A3BK 1I6HC 1K83K 5IP7C 2NVYC 2WB1D 2E2IK 4OINA 3PO3K 4LJZA 3S2DK 4ZH4A 3GTMC 3HKZL 3WODA 5C44K 5IYDC 3FKIC 5C4XC 2NVXC 4QIWL 3EQLA 3GTJK 3S1RK 3HOYK 4YFNA 4MQ9A 1SFOK 3K7AC 5C4JC 3M4OC 3HOVC 3CQZK 4BBRK 1Y1VK 4C3IK 4AYBL 3GTQK 5M3MK 3GTPK 4A3LK 1I3QC 2PA8L 4OIPA 1R9TK 4A3DK 3S1MC 2PMZL 2JA6C 3S1NK 1IW7A 2JA7K 2E2JK 4AYBD 5FJ8K 5M5WK 2R7ZC 4KN4A 4QJVA 2PA8D 1WCMC 2JA8K 1YNNA 5M3FK 4A93K 1TWHC 4OIOA 4A3JK 2E2HC 2VUMC 1TWGK 4XSXA 4A3CC 3GTGC 2WAQL 3RZDC 2Y0SL 4BY7C 3RZOC 1XPPA 3S1QK 4A3KC 4YG2A 3HOWC 4A3BC 4JK1A 3S15C 3S2HC 4A3FC 2WAQD 1K83C 5IYCC 2Y0SD 2E2IC 4Y52K 5M5YK 3M3YK 2NVQC 3S2DC 1TWAK 4MEXA 5FLMK 4A3GK 4Y7NK 1TWCK 3PO2K 3I4NC 3HOUK 3H0GK 5IYBC 3S14K 4A3IK 3GTJC 4OIQA 3S1RC 3HOYC 4YFKA 4XSZA 4BBSK 3S17K 4BBRC 3GTMK 2PPBA 1Y1VC 3HOXC 5IYDK 3FKIK 5IP9K 3GTQC 4LK0A 1Y1WC 2NVXK 3S16C 1I50K 3GTLC 4BY1K 4A3DC 2BE5A 2JA5C 4BXXK 3GTKK 2E2JC 4Q5SA 2B63C 5C4JK 2A6EA 2A69A 4A3MK 3HOVK 5C3EC 4Q4ZA 2JA8C 2R92C 3HOZK 1YNJA 4A3EK 4A93C 4X6AK 4C3HK 1TWGC 2NVTK 3GTOK 1I3QK 2R93K 4NOIA 3S1MK 2YU9K 3PO3C 1TWFK 2R7ZK 4QJVB 5C44C 2E2HK 2VUMK 3I4MK 4C3JK 4Y52C 1I6HK 3M3YC 5M5XK 5IP7K 2NVYK 5FLMC 3RZDK 2A68A 1BDFA 1SFOC 3RZOK 1ZYRA 4BY7K 1TWCC 2CW0A 4G7HA 3CQZC 3HOWK 3H0GC 3S15K 4MEYA 5IYCK 5TMCA 5C4XK 3GTPC 4A3LC 2NVQK 1R9TC 3S17C
chains in the Genus database with same CATH superfamily
3S1NC 1DCOA 1VRQC 4BLAA 4XLPA 1G51A 5L46A 3GTGA 5IYBK 1EH1A 2R92A 4YFXA 5EGEA 4KAWX 1XZQB 5TMFA 4P5BA 4QIWD 4A3EC 3HOXK 3S1QC 4C3HC 1WCMK 1EQRA 4G7OA 1UV7A 1VH2A 2JA5K 3N0CA 1USMA 1TWFC 2O5IA 4KN7A 5D4DA 1WOPA 2PMZD 3I4MC 4C3JC 3HOUC 1I6HC 2JH3A 4ILDA 4A3IC 1Y1WA 4ZH4A 3T02A 1R9TA 1XXAA 3AD8C 3BUEA 4J3NA 4QIWL 4KDDA 4MQ9A 1SFOK 3K7AC 3M4OC 3HOVC 3CQZK 1J6XA 1Y1VK 3A8KA 5M3MK 4A3LK 2PA8L 1J98A 2RGRA 2PMZL 3S1NK 3S1MC 4AYBD 3TFJA 5M5WK 5FJ8K 1IQ0A 1YNNA 4A93K 4OIOA 3RZDC 4BY7C 3RZOC 3S1QK 4YG2A 1WOSA 2Y0SD 3M3YK 2NVQC 3S2DC 5FLMK 4GTBA 1XXBA 1ZBSA 3GIRA 3HOUK 1IS1A 1WSVA 4A3IK 1F7VA 1L0WA 4AH6A 3S1RC 3OPFA 3GTOA 2R93A 4BBSK 4KMHA 1TWAA 4LK0A 3S16C 3GTLC 4BY1K 4A3DC 2E2HA 3A8JA 2GSOA 3GTKK 4BXXK 2XCRB 3BP8C 3HOVK 2NVYA 5C3EC 4PAAA 4NOIA 2GSNA 3S1MK 4KM9A 2ZUFA 4GTDA 3RZDK 4G0VA 5CJ9A 1BDFA 3RZOK 4BY7K 3LAJA 1TWCC 3H0GC 3N3YA 3OEPA 4MEYA 5C4XK 1WCMA 3GSIA 2NVQK 3S17C 2P8TA 1GE9A 5IP9C 1IL2A 1I50C 1SMYA 4OIRA 4GZYA 3T00A 1O24A 4X6AC 1O2BA 1O28A 3HOZC 2CFAB 4P5AA 3S16K 3GTLK 2YU9C 4GTLA 2RH6A 5C3EK 2WB1L 1HQMA 4Y7NC 4A3KK 3S14C 4A3BK 3CQZA 4A3FK 1K83K 1IE0A 1Y1VA 2V6UA 2E2IK 4OINA 4LJZA 2XCQA 1VGXA 5HL8A 2V6TA 1EI6A 1O27A 3GEHA 4LQYA 5TJ3A 3QX3A 3GTMC 3FKIC 2W7VA 1USOA 3EQLA 3GTJK 3HOYK 4YFNA 4BBRK 1F7UA 3GTQK 5JVOA 1I3QC 1O25A 1IBAA 2JA6C 3FOFA 5IOQA 4C2MC 1PJ6A 2PA8D 3LPXA 4QJVA 2JA8K 5M3FK 4XCHA 1TWHC 2VUMC 4A3CC 1TWGK 3GEEA 3GTGC 2WAQL 1EK8A 4FM9A 4JK1A 3S2HC 2JA7A 3GTKA 1BJTA 4Y7NK 3S14K 1WQHA 4GTAA 3FOEA 4OIQA 1XZQA 3AD9C 4XSZA 4DDQA 1WQFA 2GAHC 3GTMK 4C3IC 3FKIK 3JSTA 1PJ5A 4GTFA 1Y1WC 3VA7A 2E2JC 5IOSA 2B63C 2A6EA 1O2AA 4O2DA 3CAGA 4Q4ZA 1YNJA 4A3EK 4C3HK 1I3QK 4KMDA 2D6FC 4KC6A 3GEIA 1TWFK 3AD7C 2VUMK 3I4MK 2GSUA 3V4GA 3TFHA 4C3JK 4Y52C 1I6HK 5M5XK 3G4AA 2A68A 2CW0A 4G7HA 3GTPC 1ISEA 1O29A 3GDZA 3H3VL 4LLGA 3K7AK 4LOWA 3M4OK 4KARA 1DCHA 4A3JC 3HKZD 1J6VA 2O5JA 2Y3PA 1K83A 4LK1A 4A3MC 2E2IA 4KM8A 5CHPA 2A6HA 3ADAC 4KMAA 4P9SA 1Y1WK 2NVTC 3GTOC 2R93C 1TWAC 2B63K 3GTJA 3SZYA 4WILA 3DXJA 1JOEA 5IP7C 2NVYC 2WB1D 3GTQA 1INNA 3S0XA 3S2DK 1C0AA 1KQ4A 2JA5A 3AQPA 3HKZL 3MMLB 1XZPA 5IYDC 2NVXC 1TWGA 3S1RK 1B4AA 4FZBA 3TTGA 4BKWA 4KATA 3GTPK 3LAPA 3BP3A 1PJ7A 1JQWA 2V6SA 4OIPA 5E68A 4A3DK 4GTCA 2R7ZC 1WCMC 1SFOA 4A3JK 4KB4A 4XSXA 3G4CA 1AB4A 3SZZA 1XPPA 3GTMA 2WAQD 5IYCC 3FKIA 5M5YK 1TWAK 4MEXA 1BGWA 4RMFA 3I4NC 1TWCK 3H0GK 4G0UA 3HXAA 4YFKA 4KASA 1I3QA 4WJ3M 1ZQ1C 3S17K 2PPBA 1Y1VC 2CFAA 1TWFA 5IYDK 5IP9K 2NVXK 1I50K 2BE5A 2A69A 5JFEA 2R92C 4X6AK 3HOZK 1F9NA 4A93C 1DCPA 2YU9K 3PO3C 1ZVUA 2R7ZK 5C44C 3M3YC 4GT9A 2EBBA 5FLMC 3IPJA 4GFQA 5IYCK 4LR2A 1R9TC 4BBSC 2JA7C 2B63A 3I4NK 1I6VA 3H3VD 4M1XA 4BY1C 4BXXC 3GTKC 3AH5A 2JA6K 2ZUEA 2PHCB 4XLNA 4C2MK 1TWHK 4A3CK 3GTGK 5IOTA 4A3GC 1V5VA 2R92K 3PO2C 4KMUA 2KWAA 4G7ZA 1F93A 3S2HK 2VUMA 3GTPA 1J6WA 4GTEA 3PO3K 3GTLA 2FQOA 3FHZA 3WODA 5C44K 5C4XC 3TFIA 3Q3QA 1YX2A 3A8IA 1HI9A 5C4JC 3AQOA 1VLOA 4C3IK 4AYBL 1R9TK 1IW7A 2JA7K 5IORA 4BLBA 2E2JK 1XZPB 2P5MA 4KN4A 2E2HC 1JVIA 1TWCA 1EFWA 3H0GA 1RU0A 3N0BA 1ZXOA 1VJEA 2Y0SL 4G0WA 4A3KC 3HOWC 4A3BC 3S15C 4A3FC 1K83C 2E2IC 4Y52K 1B4BA 1WIHA 1X31C 2NVXA 3L4JA 2GAGC 1I50A 4A3GK 1BS2A 3PO2K 1DD5A 1WOOA 5IYBC 3GTJC 3HOYC 1O2FB 4BBRC 2YU9A 3L4KA 3HOXC 2FQTA 3GTQC 2R7ZA 5EGHA 4C45A 1WSRA 2JA5C 4Q5SA 1WQGA 2ZFZA 5C4JK 4A3MK 2JA8C 3NUHA 1TWGC 4WJ4A 2NVTK 3GTOK 2R93K 2XCOA 4PABA 4KB2A 4QJVB 2E2HK 1WORA 1XXCA 5IP7K 2NVYK 3T01A 1SFOC 1ZYRA 1YCLA 1O26A 3CQZC 3ERED 3HOWK 3S15K 2JA6A 5TMCA 4A3LC 3OREA 1TWHA
chains in the Genus database with same CATH topology
3S1NC 2JA7C 4XLPA 4LLGA 3K7AK 3I4NK 5IP9C 3H3VL 3M4OK 1I6VA 5IYBK 3H3VD 1I50C 1SMYA 4YFXA 4BY1C 4OIRA 4A3JC 3HKZD 2O5JA 4BXXC 3GTKC 4GZYA 5TMFA 4LK1A 4QIWD 4A3MC 2JA6K 4X6AC 2A6HA 4XLNA 3HOXK 4C2MK 4A3EC 3HOZC 3S1QC 2NVTC 1Y1WK 1WCMK 3GTOC 3S16K 4G7OA 2R93C 3GTLK 1TWHK 4A3CK 2JA5K 2YU9C 1TWAC 1TWFC 2B63K 2O5IA 4KN7A 5D4DA 3GTGK 4A3GC 5C3EK 2R92K 2WB1L 4BBSC 1HQMA 3DXJA 4KMUA 2PMZD 4Y7NC 4A3KK 3HOUC 4G7ZA 3I4MC 3PO2C 3S14C 4A3FK 4A3IC 3S2HK 4A3BK 1I6HC 1K83K 5IP7C 2NVYC 2WB1D 2E2IK 4OINA 3PO3K 4LJZA 3S2DK 4ZH4A 3GTMC 3HKZL 3WODA 5C44K 5IYDC 3FKIC 5C4XC 2NVXC 4QIWL 3EQLA 3GTJK 3S1RK 3HOYK 4YFNA 4MQ9A 1SFOK 3K7AC 5C4JC 3M4OC 3HOVC 3CQZK 4BBRK 1Y1VK 4C3IK 4AYBL 3GTQK 5M3MK 3GTPK 4A3LK 1I3QC 2PA8L 4OIPA 1R9TK 4A3DK 3S1MC 2PMZL 2JA6C 3S1NK 1IW7A 2JA7K 2E2JK 4AYBD 5FJ8K 5M5WK 2R7ZC 4KN4A 4QJVA 2PA8D 1WCMC 2JA8K 1YNNA 5M3FK 4A93K 1TWHC 4OIOA 4A3JK 2E2HC 2VUMC 1TWGK 4XSXA 4A3CC 3GTGC 2WAQL 3RZDC 2Y0SL 4BY7C 3RZOC 1XPPA 3S1QK 4A3KC 4YG2A 3HOWC 4A3BC 4JK1A 3S15C 3S2HC 4A3FC 2WAQD 1K83C 5IYCC 2Y0SD 2E2IC 4Y52K 5M5YK 3M3YK 2NVQC 3S2DC 1TWAK 4MEXA 5FLMK 4A3GK 4Y7NK 1TWCK 3PO2K 3I4NC 3HOUK 3H0GK 5IYBC 3S14K 4A3IK 3GTJC 4OIQA 3S1RC 3HOYC 4YFKA 4XSZA 4BBSK 3S17K 4BBRC 3GTMK 2PPBA 1Y1VC 3HOXC 5IYDK 3FKIK 5IP9K 3GTQC 4LK0A 1Y1WC 2NVXK 3S16C 1I50K 3GTLC 4BY1K 4A3DC 2BE5A 2JA5C 4BXXK 3GTKK 2E2JC 4Q5SA 2B63C 5C4JK 2A6EA 2A69A 4A3MK 3HOVK 5C3EC 4Q4ZA 2JA8C 2R92C 3HOZK 1YNJA 4A3EK 4A93C 4X6AK 4C3HK 1TWGC 2NVTK 3GTOK 1I3QK 2R93K 4NOIA 3S1MK 2YU9K 3PO3C 1TWFK 2R7ZK 4QJVB 5C44C 2E2HK 2VUMK 3I4MK 4C3JK 4Y52C 1I6HK 3M3YC 5M5XK 5IP7K 2NVYK 5FLMC 3RZDK 2A68A 1BDFA 1SFOC 3RZOK 1ZYRA 4BY7K 1TWCC 2CW0A 4G7HA 3CQZC 3HOWK 3H0GC 3S15K 4MEYA 5IYCK 5TMCA 5C4XK 3GTPC 4A3LC 2NVQK 1R9TC 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N C;  2JA7 C;  4XLP A;  4LLG A;  3K7A K;  3I4N K;  5IP9 C;  3H3V L;  3M4O K;  1I6V A;  5IYB K;  3H3V D;  1I50 C;  1SMY A;  4YFX A;  4BY1 C;  4OIR A;  4A3J C;  3HKZ D;  2O5J A;  4BXX C;  3GTK C;  4GZY A;  5TMF A;  4LK1 A;  4QIW D;  4A3M C;  2JA6 K;  4X6A C;  2A6H A;  4XLN A;  3HOX K;  4C2M K;  4A3E C;  3HOZ C;  3S1Q C;  2NVT C;  1Y1W K;  1WCM K;  3GTO C;  3S16 K;  4G7O A;  2R93 C;  3GTL K;  1TWH K;  4A3C K;  2JA5 K;  2YU9 C;  1TWA C;  1TWF C;  2B63 K;  2O5I A;  4KN7 A;  5D4D A;  3GTG K;  4A3G C;  5C3E K;  2R92 K;  2WB1 L;  4BBS C;  1HQM A;  3DXJ A;  4KMU A;  2PMZ D;  4Y7N C;  4A3K K;  3HOU C;  4G7Z A;  3I4M C;  3PO2 C;  3S14 C;  4A3F K;  4A3I C;  3S2H K;  4A3B K;  1I6H C;  1K83 K;  5IP7 C;  2NVY C;  2WB1 D;  2E2I K;  4OIN A;  3PO3 K;  4LJZ A;  3S2D K;  4ZH4 A;  3GTM C;  3HKZ L;  3WOD A;  5C44 K;  5IYD C;  3FKI C;  5C4X C;  2NVX C;  4QIW L;  3EQL A;  3GTJ K;  3S1R K;  3HOY K;  4YFN A;  4MQ9 A;  1SFO K;  3K7A C;  5C4J C;  3M4O C;  3HOV C;  3CQZ K;  4BBR K;  1Y1V K;  4C3I K;  4AYB L;  3GTQ K;  5M3M K;  3GTP K;  4A3L K;  1I3Q C;  2PA8 L;  4OIP A;  1R9T K;  4A3D K;  3S1M C;  2PMZ L;  2JA6 C;  3S1N K;  1IW7 A;  2JA7 K;  2E2J K;  4AYB D;  5FJ8 K;  5M5W K;  2R7Z C;  4KN4 A;  4QJV A;  2PA8 D;  1WCM C;  2JA8 K;  1YNN A;  5M3F K;  4A93 K;  1TWH C;  4OIO A;  4A3J K;  2E2H C;  2VUM C;  1TWG K;  4XSX A;  4A3C C;  3GTG C;  2WAQ L;  3RZD C;  2Y0S L;  4BY7 C;  3RZO C;  1XPP A;  3S1Q K;  4A3K C;  4YG2 A;  3HOW C;  4A3B C;  4JK1 A;  3S15 C;  3S2H C;  4A3F C;  2WAQ D;  1K83 C;  5IYC C;  2Y0S D;  2E2I C;  4Y52 K;  5M5Y K;  3M3Y K;  2NVQ C;  3S2D C;  1TWA K;  4MEX A;  5FLM K;  4A3G K;  4Y7N K;  1TWC K;  3PO2 K;  3I4N C;  3HOU K;  3H0G K;  5IYB C;  3S14 K;  4A3I K;  3GTJ C;  4OIQ A;  3S1R C;  3HOY C;  4YFK A;  4XSZ A;  4BBS K;  3S17 K;  4BBR C;  3GTM K;  2PPB A;  1Y1V C;  3HOX C;  5IYD K;  3FKI K;  5IP9 K;  3GTQ C;  4LK0 A;  1Y1W C;  2NVX K;  3S16 C;  1I50 K;  3GTL C;  4BY1 K;  4A3D C;  2BE5 A;  2JA5 C;  4BXX K;  3GTK K;  2E2J C;  4Q5S A;  2B63 C;  5C4J K;  2A6E A;  2A69 A;  4A3M K;  3HOV K;  5C3E C;  4Q4Z A;  2JA8 C;  2R92 C;  3HOZ K;  1YNJ A;  4A3E K;  4A93 C;  4X6A K;  4C3H K;  1TWG C;  2NVT K;  3GTO K;  1I3Q K;  2R93 K;  4NOI A;  3S1M K;  2YU9 K;  3PO3 C;  1TWF K;  2R7Z K;  4QJV B;  5C44 C;  2E2H K;  2VUM K;  3I4M K;  4C3J K;  4Y52 C;  1I6H K;  3M3Y C;  5M5X K;  5IP7 K;  2NVY K;  5FLM C;  3RZD K;  2A68 A;  1BDF A;  1SFO C;  3RZO K;  1ZYR A;  4BY7 K;  1TWC C;  2CW0 A;  4G7H A;  3CQZ C;  3HOW K;  3H0G C;  3S15 K;  4MEY A;  5IYC K;  5TMC A;  5C4X K;  3GTP C;  4A3L C;  2NVQ K;  1R9T C;  3S17 C; 
#chains in the Genus database with same CATH topology
 3S1N C;  1DCO A;  1VRQ C;  4BLA A;  4XLP A;  1G51 A;  5L46 A;  3GTG A;  5IYB K;  1EH1 A;  2R92 A;  4YFX A;  5EGE A;  4KAW X;  1XZQ B;  5TMF A;  4P5B A;  4QIW D;  4A3E C;  3HOX K;  3S1Q C;  4C3H C;  1WCM K;  1EQR A;  4G7O A;  1UV7 A;  1VH2 A;  2JA5 K;  3N0C A;  1USM A;  1TWF C;  2O5I A;  4KN7 A;  5D4D A;  1WOP A;  2PMZ D;  3I4M C;  4C3J C;  3HOU C;  1I6H C;  2JH3 A;  4ILD A;  4A3I C;  1Y1W A;  4ZH4 A;  3T02 A;  1R9T A;  1XXA A;  3AD8 C;  3BUE A;  4J3N A;  4QIW L;  4KDD A;  4MQ9 A;  1SFO K;  3K7A C;  3M4O C;  3HOV C;  3CQZ K;  1J6X A;  1Y1V K;  3A8K A;  5M3M K;  4A3L K;  2PA8 L;  1J98 A;  2RGR A;  2PMZ L;  3S1N K;  3S1M C;  4AYB D;  3TFJ A;  5M5W K;  5FJ8 K;  1IQ0 A;  1YNN A;  4A93 K;  4OIO A;  3RZD C;  4BY7 C;  3RZO C;  3S1Q K;  4YG2 A;  1WOS A;  2Y0S D;  3M3Y K;  2NVQ C;  3S2D C;  5FLM K;  4GTB A;  1XXB A;  1ZBS A;  3GIR A;  3HOU K;  1IS1 A;  1WSV A;  4A3I K;  1F7V A;  1L0W A;  4AH6 A;  3S1R C;  3OPF A;  3GTO A;  2R93 A;  4BBS K;  4KMH A;  1TWA A;  4LK0 A;  3S16 C;  3GTL C;  4BY1 K;  4A3D C;  2E2H A;  3A8J A;  2GSO A;  3GTK K;  4BXX K;  2XCR B;  3BP8 C;  3HOV K;  2NVY A;  5C3E C;  4PAA A;  4NOI A;  2GSN A;  3S1M K;  4KM9 A;  2ZUF A;  4GTD A;  3RZD K;  4G0V A;  5CJ9 A;  1BDF A;  3RZO K;  4BY7 K;  3LAJ A;  1TWC C;  3H0G C;  3N3Y A;  3OEP A;  4MEY A;  5C4X K;  1WCM A;  3GSI A;  2NVQ K;  3S17 C;  2P8T A;  1GE9 A;  5IP9 C;  1IL2 A;  1I50 C;  1SMY A;  4OIR A;  4GZY A;  3T00 A;  1O24 A;  4X6A C;  1O2B A;  1O28 A;  3HOZ C;  2CFA B;  4P5A A;  3S16 K;  3GTL K;  2YU9 C;  4GTL A;  2RH6 A;  5C3E K;  2WB1 L;  1HQM A;  4Y7N C;  4A3K K;  3S14 C;  4A3B K;  3CQZ A;  4A3F K;  1K83 K;  1IE0 A;  1Y1V A;  2V6U A;  2E2I K;  4OIN A;  4LJZ A;  2XCQ A;  1VGX A;  5HL8 A;  2V6T A;  1EI6 A;  1O27 A;  3GEH A;  4LQY A;  5TJ3 A;  3QX3 A;  3GTM C;  3FKI C;  2W7V A;  1USO A;  3EQL A;  3GTJ K;  3HOY K;  4YFN A;  4BBR K;  1F7U A;  3GTQ K;  5JVO A;  1I3Q C;  1O25 A;  1IBA A;  2JA6 C;  3FOF A;  5IOQ A;  4C2M C;  1PJ6 A;  2PA8 D;  3LPX A;  4QJV A;  2JA8 K;  5M3F K;  4XCH A;  1TWH C;  2VUM C;  4A3C C;  1TWG K;  3GEE A;  3GTG C;  2WAQ L;  1EK8 A;  4FM9 A;  4JK1 A;  3S2H C;  2JA7 A;  3GTK A;  1BJT A;  4Y7N K;  3S14 K;  1WQH A;  4GTA A;  3FOE A;  4OIQ A;  1XZQ A;  3AD9 C;  4XSZ A;  4DDQ A;  1WQF A;  2GAH C;  3GTM K;  4C3I C;  3FKI K;  3JST A;  1PJ5 A;  4GTF A;  1Y1W C;  3VA7 A;  2E2J C;  5IOS A;  2B63 C;  2A6E A;  1O2A A;  4O2D A;  3CAG A;  4Q4Z A;  1YNJ A;  4A3E K;  4C3H K;  1I3Q K;  4KMD A;  2D6F C;  4KC6 A;  3GEI A;  1TWF K;  3AD7 C;  2VUM K;  3I4M K;  2GSU A;  3V4G A;  3TFH A;  4C3J K;  4Y52 C;  1I6H K;  5M5X K;  3G4A A;  2A68 A;  2CW0 A;  4G7H A;  3GTP C;  1ISE A;  1O29 A;  3GDZ A;  3H3V L;  4LLG A;  3K7A K;  4LOW A;  3M4O K;  4KAR A;  1DCH A;  4A3J C;  3HKZ D;  1J6V A;  2O5J A;  2Y3P A;  1K83 A;  4LK1 A;  4A3M C;  2E2I A;  4KM8 A;  5CHP A;  2A6H A;  3ADA C;  4KMA A;  4P9S A;  1Y1W K;  2NVT C;  3GTO C;  2R93 C;  1TWA C;  2B63 K;  3GTJ A;  3SZY A;  4WIL A;  3DXJ A;  1JOE A;  5IP7 C;  2NVY C;  2WB1 D;  3GTQ A;  1INN A;  3S0X A;  3S2D K;  1C0A A;  1KQ4 A;  2JA5 A;  3AQP A;  3HKZ L;  3MML B;  1XZP A;  5IYD C;  2NVX C;  1TWG A;  3S1R K;  1B4A A;  4FZB A;  3TTG A;  4BKW A;  4KAT A;  3GTP K;  3LAP A;  3BP3 A;  1PJ7 A;  1JQW A;  2V6S A;  4OIP A;  5E68 A;  4A3D K;  4GTC A;  2R7Z C;  1WCM C;  1SFO A;  4A3J K;  4KB4 A;  4XSX A;  3G4C A;  1AB4 A;  3SZZ A;  1XPP A;  3GTM A;  2WAQ D;  5IYC C;  3FKI A;  5M5Y K;  1TWA K;  4MEX A;  1BGW A;  4RMF A;  3I4N C;  1TWC K;  3H0G K;  4G0U A;  3HXA A;  4YFK A;  4KAS A;  1I3Q A;  4WJ3 M;  1ZQ1 C;  3S17 K;  2PPB A;  1Y1V C;  2CFA A;  1TWF A;  5IYD K;  5IP9 K;  2NVX K;  1I50 K;  2BE5 A;  2A69 A;  5JFE A;  2R92 C;  4X6A K;  3HOZ K;  1F9N A;  4A93 C;  1DCP A;  2YU9 K;  3PO3 C;  1ZVU A;  2R7Z K;  5C44 C;  3M3Y C;  4GT9 A;  2EBB A;  5FLM C;  3IPJ A;  4GFQ A;  5IYC K;  4LR2 A;  1R9T C;  4BBS C;  2JA7 C;  2B63 A;  3I4N K;  1I6V A;  3H3V D;  4M1X A;  4BY1 C;  4BXX C;  3GTK C;  3AH5 A;  2JA6 K;  2ZUE A;  2PHC B;  4XLN A;  4C2M K;  1TWH K;  4A3C K;  3GTG K;  5IOT A;  4A3G C;  1V5V A;  2R92 K;  3PO2 C;  4KMU A;  2KWA A;  4G7Z A;  1F93 A;  3S2H K;  2VUM A;  3GTP A;  1J6W A;  4GTE A;  3PO3 K;  3GTL A;  2FQO A;  3FHZ A;  3WOD A;  5C44 K;  5C4X C;  3TFI A;  3Q3Q A;  1YX2 A;  3A8I A;  1HI9 A;  5C4J C;  3AQO A;  1VLO A;  4C3I K;  4AYB L;  1R9T K;  1IW7 A;  2JA7 K;  5IOR A;  4BLB A;  2E2J K;  1XZP B;  2P5M A;  4KN4 A;  2E2H C;  1JVI A;  1TWC A;  1EFW A;  3H0G A;  1RU0 A;  3N0B A;  1ZXO A;  1VJE A;  2Y0S L;  4G0W A;  4A3K C;  3HOW C;  4A3B C;  3S15 C;  4A3F C;  1K83 C;  2E2I C;  4Y52 K;  1B4B A;  1WIH A;  1X31 C;  2NVX A;  3L4J A;  2GAG C;  1I50 A;  4A3G K;  1BS2 A;  3PO2 K;  1DD5 A;  1WOO A;  5IYB C;  3GTJ C;  3HOY C;  1O2F B;  4BBR C;  2YU9 A;  3L4K A;  3HOX C;  2FQT A;  3GTQ C;  2R7Z A;  5EGH A;  4C45 A;  1WSR A;  2JA5 C;  4Q5S A;  1WQG A;  2ZFZ A;  5C4J K;  4A3M K;  2JA8 C;  3NUH A;  1TWG C;  4WJ4 A;  2NVT K;  3GTO K;  2R93 K;  2XCO A;  4PAB A;  4KB2 A;  4QJV B;  2E2H K;  1WOR A;  1XXC A;  5IP7 K;  2NVY K;  3T01 A;  1SFO C;  1ZYR A;  1YCL A;  1O26 A;  3CQZ C;  3ERE D;  3HOW K;  3S15 K;  2JA6 A;  5TMC A;  4A3L C;  3ORE A;  1TWH A; 
#chains in the Genus database with same CATH homology
 3S1N C;  2JA7 C;  4XLP A;  4LLG A;  3K7A K;  3I4N K;  5IP9 C;  3H3V L;  3M4O K;  1I6V A;  5IYB K;  3H3V D;  1I50 C;  1SMY A;  4YFX A;  4BY1 C;  4OIR A;  4A3J C;  3HKZ D;  2O5J A;  4BXX C;  3GTK C;  4GZY A;  5TMF A;  4LK1 A;  4QIW D;  4A3M C;  2JA6 K;  4X6A C;  2A6H A;  4XLN A;  3HOX K;  4C2M K;  4A3E C;  3HOZ C;  3S1Q C;  2NVT C;  1Y1W K;  1WCM K;  3GTO C;  3S16 K;  4G7O A;  2R93 C;  3GTL K;  1TWH K;  4A3C K;  2JA5 K;  2YU9 C;  1TWA C;  1TWF C;  2B63 K;  2O5I A;  4KN7 A;  5D4D A;  3GTG K;  4A3G C;  5C3E K;  2R92 K;  2WB1 L;  4BBS C;  1HQM A;  3DXJ A;  4KMU A;  2PMZ D;  4Y7N C;  4A3K K;  3HOU C;  4G7Z A;  3I4M C;  3PO2 C;  3S14 C;  4A3F K;  4A3I C;  3S2H K;  4A3B K;  1I6H C;  1K83 K;  5IP7 C;  2NVY C;  2WB1 D;  2E2I K;  4OIN A;  3PO3 K;  4LJZ A;  3S2D K;  4ZH4 A;  3GTM C;  3HKZ L;  3WOD A;  5C44 K;  5IYD C;  3FKI C;  5C4X C;  2NVX C;  4QIW L;  3EQL A;  3GTJ K;  3S1R K;  3HOY K;  4YFN A;  4MQ9 A;  1SFO K;  3K7A C;  5C4J C;  3M4O C;  3HOV C;  3CQZ K;  4BBR K;  1Y1V K;  4C3I K;  4AYB L;  3GTQ K;  5M3M K;  3GTP K;  4A3L K;  1I3Q C;  2PA8 L;  4OIP A;  1R9T K;  4A3D K;  3S1M C;  2PMZ L;  2JA6 C;  3S1N K;  1IW7 A;  2JA7 K;  2E2J K;  4AYB D;  5FJ8 K;  5M5W K;  2R7Z C;  4KN4 A;  4QJV A;  2PA8 D;  1WCM C;  2JA8 K;  1YNN A;  5M3F K;  4A93 K;  1TWH C;  4OIO A;  4A3J K;  2E2H C;  2VUM C;  1TWG K;  4XSX A;  4A3C C;  3GTG C;  2WAQ L;  3RZD C;  2Y0S L;  4BY7 C;  3RZO C;  1XPP A;  3S1Q K;  4A3K C;  4YG2 A;  3HOW C;  4A3B C;  4JK1 A;  3S15 C;  3S2H C;  4A3F C;  2WAQ D;  1K83 C;  5IYC C;  2Y0S D;  2E2I C;  4Y52 K;  5M5Y K;  3M3Y K;  2NVQ C;  3S2D C;  1TWA K;  4MEX A;  5FLM K;  4A3G K;  4Y7N K;  1TWC K;  3PO2 K;  3I4N C;  3HOU K;  3H0G K;  5IYB C;  3S14 K;  4A3I K;  3GTJ C;  4OIQ A;  3S1R C;  3HOY C;  4YFK A;  4XSZ A;  4BBS K;  3S17 K;  4BBR C;  3GTM K;  2PPB A;  1Y1V C;  3HOX C;  5IYD K;  3FKI K;  5IP9 K;  3GTQ C;  4LK0 A;  1Y1W C;  2NVX K;  3S16 C;  1I50 K;  3GTL C;  4BY1 K;  4A3D C;  2BE5 A;  2JA5 C;  4BXX K;  3GTK K;  2E2J C;  4Q5S A;  2B63 C;  5C4J K;  2A6E A;  2A69 A;  4A3M K;  3HOV K;  5C3E C;  4Q4Z A;  2JA8 C;  2R92 C;  3HOZ K;  1YNJ A;  4A3E K;  4A93 C;  4X6A K;  4C3H K;  1TWG C;  2NVT K;  3GTO K;  1I3Q K;  2R93 K;  4NOI A;  3S1M K;  2YU9 K;  3PO3 C;  1TWF K;  2R7Z K;  4QJV B;  5C44 C;  2E2H K;  2VUM K;  3I4M K;  4C3J K;  4Y52 C;  1I6H K;  3M3Y C;  5M5X K;  5IP7 K;  2NVY K;  5FLM C;  3RZD K;  2A68 A;  1BDF A;  1SFO C;  3RZO K;  1ZYR A;  4BY7 K;  1TWC C;  2CW0 A;  4G7H A;  3CQZ C;  3HOW K;  3H0G C;  3S15 K;  4MEY A;  5IYC K;  5TMC A;  5C4X K;  3GTP C;  4A3L C;  2NVQ K;  1R9T C;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...