3GTPK

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtpK00
5C4JK 3HOUK 2YU9K 3S14C 5M5YK 4BBSK 5C4JC 2JA6K 2YU9C 2NVTK 3HOUC 2E2HK 3GTLK 2JA6C 3HOXK 2E2HC 3GTJK 1WCMK 2NVXK 3HOXC 4LJZA 1K83K 3GTQK 3GTJC 2NVXC 5FLMK 2R92K 1K83C 3GTQC 5FLMC 5M5WK 1I6VA 3H3VD 5TMFA 3GTKC 3GTPK 3I4NK 2BE5A 4LK1A 3GTPC 4OINA 3I4NC 2PMZD 4BY7C 2JA7K 4A3EK 4A3CC 2O5IA 2JA5K 3WODA 1YNJA 4JK1A 4Y7NK 2JA7C 3HKZL 4A3EC 4X6AK 1I50K 3FKIK 2JA5C 4ZH4A 3HOZK 3S2DK 4XLPA 3PO2K 4A3LC 4X6AC 1I50C 3FKIC 3PO2C 2WB1D 4BXXK 3GTGC 2WAQL 1SFOK 4A3JK 5IP9K 4A3MK 5IYBC 1SFOC 3S17K 4A3JC 4A3FK 4QJVB 4KN7A 4A3IC 3S17C 2A69A 4A3FC 2R7ZK 4BBSC 4G7ZA 3S1MK 4LK0A 1TWFK 2NVTC 1ZYRA 4AYBD 3S1RK 4QIWL 3GTLC 3S1MC 1TWFC 4LLGA 4YFXA 3S1RC 1I3QK 1WCMC 5TMCA 2A6HA 1TWCK 1I3QC 2VUMK 5C44K 4Q5SA 2R92C 1TWCC 4KMUA 5M5XK 2JA8K 4XSZA 5C44C 1XPPA 2JA8C 2Y0SL 1Y1VK 1R9TK 4KN4A 3HKZD 4YFNA 1Y1VC 4A3BK 1R9TC 3HOVK 4Y7NC 5M3FK 4MEXA 5IP7K 4A3BC 3CQZK 3HOVC 2R93K 4BY1K 3RZOK 5IP7C 3HOZC 3CQZC 3GTMK 3S2DC 4A3DK 2WAQD 2R93C 4BY1C 3RZOC 3GTMC 3HOWK 1TWHK 4G7OA 4BXXC 3H0GK 2PA8L 1TWHC 4YG2A 5IP9C 5C3EK 3M4OK 5IYDK 4A3MC 3H0GC 2A6EA 5C3EC 5IYDC 3HOYK 5FJ8K 4QIWD 3HOYC 2R7ZC 2E2JK 1TWGK 4C2MK 3S1QK 4Y52K 4MEYA 3H3VL 2E2JC 3S1QC 1I6HK 1TWAK 4Y52C 3S16K 4OIQA 4G7HA 1TWAC 3S1NK 1I6HC 3S16C 2VUMC 3S2HK 4OIPA 4A3GK 2B63K 2Y0SD 4A3KK 4A3GC 2B63C 4A93K 3I4MK 4Q4ZA 2CW0A 4GZYA 4C3HK 4A93C 3I4MC 3GTOK 2NVYK 3S15K 5C4XK 3K7AK 4QJVA 3GTOC 2NVYC 1YNNA 3S14K 5C4XC 3EQLA 3K7AC 4C3JK 4C3IK 2E2IK 4A3DC 3DXJA 4YFKA 1SMYA 2PA8D 2E2IC 4MQ9A 2O5JA 3HOWC 2A68A 4XSXA 3M3YK 5IYCK 4AYBL 3M3YC 3M4OC 5IYCC 4OIRA 4XLNA 5D4DA 4OIOA 1Y1WK 1TWGC 4BY7K 1Y1WC 4A3CK 3RZDK 1IW7A 2PMZL 4BBRK 3S1NC 3RZDC 4A3LK 3S2HC 4BBRC 4A3KC 5M3MK 3PO3K 3GTGK 2PPBA 2NVQK 3PO3C 4NOIA 1BDFA 2WB1L 5IYBK 3GTKK 1HQMA 2NVQC 3S15C 4A3IK
chains in the Genus database with same CATH superfamily
1O26A 3BP3A 5C4JC 3GTLK 2JA6C 4KMAA 3HOXC 4LJZA 1K83K 1YX2A 3LPXA 1USOA 3GTPK 2BE5A 1XZQB 3A8KA 4Y7NK 3Q3QA 4JK1A 4KATA 4A3EC 4X6AK 1F7VA 2JA5C 4ZH4A 3PO2K 1I50C 3FKIC 3GTGA 4ILDA 3GTKA 4BXXK 4A3JK 5IYBC 1SFOC 4A3FK 4KM8A 2JA6A 5L46A 4A3IC 4G0VA 2NVTC 1TWFK 1ZYRA 1F7UA 1WCMC 5TMCA 1XZPB 1I3QC 5C44K 3TFJA 1TWCC 2R92C 1IS1A 3QX3A 3N0CA 4XSZA 1XPPA 4M1XA 1Y1VK 2GSOA 2JA5A 1X31C 3HKZD 2D6FC 1I50A 1RU0A 3FKIA 1R9TC 5M3FK 1DD5A 1HI9A 1ZBSA 5IP7C 3GTMK 1WORA 3S2DC 3TFIA 1SFOA 3RZOC 3V4GA 1ZXOA 3GEIA 4O2DA 5C3EK 1TWHC 4YG2A 1ZQ1C 2A6EA 3HOYC 2R7ZC 2E2JK 1TWGK 1XZQA 4MEYA 1I3QA 1KQ4A 4KMDA 1TWCA 3GIRA 1YCLA 1TWAC 1WSVA 4A3GK 4GTDA 1F93A 4A3KK 4GTCA 4P9SA 2GAHC 3AD8C 1R9TA 4C3HK 2P8TA 3BUEA 2NVYK 3S15K 3GTOC 5C4XC 1EH1A 4C3JC 4A3DC 1TWHA 2E2IC 2XCRB 1JVIA 2O5JA 3HOWC 4WJ3M 1BGWA 1PJ5A 1XZPA 3L4KA 4XLNA 2KWAA 4AH6A 5IORA 1TWAA 1B4AA 1XXBA 4LQYA 3RZDC 1O24A 3T00A 3BP8C 1BS2A 4GFQA 5M3MK 3GTOA 1DCPA 3PO3C 5IYBK 4KASA 2NVQC 4A3IK 3HOUK 2E2IA 3S14C 4P5BA 2YU9C 2NVTK 2E2HK 1V5VA 1WCMK 1WSRA 3GTQK 3GTJC 2NVXC 2R92K 1AB4A 3SZYA 5FLMC 5M5WK 1I6VA 1O25A 3I4NC 2CFAB 2JA7K 3ERED 5HL8A 3HKZL 1WOPA 3S2DK 4XLPA 3G4CA 3GTGC 3AD7C 2YU9A 3S17K 3FOEA 4KN7A 2A69A 2JH3A 1O29A 2R7ZK 3S1MK 3GTJA 2NVXA 3S1RK 4LLGA 1VLOA 2A6HA 4Q5SA 2EBBA 5JVOA 2JA8K 4FZBA 3N0BA 3AH5A 1VH2A 3GEHA 4KN4A 4YFNA 2PHCB 1GE9A 4G0UA 4C45A 3HOVK 4A3BC 4BY1K 4A3DK 3HOZC 3CQZC 2R93C 2WAQD 1J6VA 3HOWK 2ZUEA 4A3MC 3H0GC 5IYDC 4QIWD 3S1QK 3H3VL 2CFAA 4C2MC 4Y52C 2VUMA 3S16K 4G7HA 1I6HC 2FQTA 4OIPA 2GAGC 2B63C 3I4MK 2CW0A 4A93C 3CQZA 4BLAA 2R93A 3S14K 1J6XA 3EQLA 3JSTA 3K7AC 4WJ4A 4C3IC 3DXJA 3G4AA 3H0GA 3L4JA 1O27A 1BJTA 3M3YK 5IYCK 4AYBL 1G51A 4PAAA 3TFHA 3FOFA 3M4OC 1WQGA 2RH6A 5D4DA 4OIOA 1WIHA 1Y1WC 1XXAA 1IQ0A 3NUHA 3SZZA 2B63A 3S1NC 3FHZA 4LR2A 4BBRC 3ADAC 3GEEA 3GTGK 1VJEA 3GTKK 1HQMA 1UV7A 5C4JK 5M5YK 1DCHA 2JA6K 1ZVUA 3HOXK 3GDZA 4PABA 1K83C 4BLBA 3H3VD 1Y1WA 1WQHA 1O2BA 4KC6A 1EQRA 4LK1A 3GTPC 4BY7C 4RMFA 4A3CC 4A3EK 1F9NA 2JA5K 3WODA 1YNJA 5E68A 2O5IA 1I50K 3FKIK 2XCQA 3HOZK 4X6AC 1PJ7A 5IOTA 3PO2C 2WB1D 3CAGA 2WAQL 1SFOK 4A3MK 4A3JC 4QJVB 4A3FC 1EFWA 3GTLA 4BBSC 4AYBD 4KMHA 4QIWL 1K83A 1TWFC 1I3QK 2W7VA 1TWCK 2V6SA 4KDDA 3GTPA 4KMUA 5C44C 1R9TK 3HXAA 1O2AA 1EI6A 1Y1VC 2RGRA 5IP7K 4KAWX 4G0WA 3RZOK 3OEPA 3GTMC 1TWHK 4KB2A 5IP9C 3M4OK 1USMA 5C3EC 3HOYK 3T02A 1TWFA 4J3NA 3IPJA 2E2JC 1TWAK 1IE0A 4OIQA 3S1NK 4DDQA 1WOOA 4BKWA 2VUMC 1L0WA 4GTBA 3LAPA 2Y0SD 3A8JA 4A3GC 1Y1VA 3GTOK 5C4XK 4QJVA 2NVYC 1YNNA 4C3JK 3GTMA 2E2IK 2PA8D 1IBAA 4MQ9A 4GTFA 4WILA 4OIRA 1TWGA 2GSUA 4LOWA 4BY7K 4A3CK 2XCOA 3RZDK 1IW7A 1VRQC 1EK8A 4GTAA 2Y3PA 2ZFZA 3S2HC 3PO3K 2NVYA 2NVQK 1BDFA 2WB1L 2YU9K 3GSIA 4BBSK 3HOUC 2E2HC 3GTJK 1B4BA 4FM9A 2NVXK 1O28A 3AQOA 5FLMK 3GTQC 1XXCA 5TMFA 3T01A 3I4NK 3OREA 4OINA 2PMZD 2P5MA 3AD9C 2JA7C 1DCOA 4KARA 4A3LC 5IP9K 4P5AA 1J6WA 3S17C 2E2HA 1JQWA 4G7ZA 4LK0A 1WCMA 2ZUFA 3GTLC 3S1MC 3GTQA 1WOSA 4YFXA 3S1RC 2R92A 3N3YA 2VUMK 1JOEA 5M5XK 5TJ3A 3LAJA 1J98A 4KB4A 2JA8C 2Y0SL 2JA7A 5EGEA 4A3BK 2V6TA 4Y7NC 4MEXA 3CQZK 3HOVC 2R93K 1ISEA 1PJ6A 4BY1C 4G7OA 4BXXC 5IOSA 3H0GK 2PA8L 5IYDK 2R7ZA 3VA7A 5FJ8K 3TTGA 5CHPA 4C2MK 4XCHA 4Y52K 1VGXA 4GTLA 3S1QC 1I6HK 1O2FB 3S16C 1IL2A 3MMLB 3S2HK 2B63K 4A93K 4GZYA 3A8IA 3S0XA 4Q4ZA 1C0AA 4KM9A 3I4MC 3K7AK 5JFEA 4GTEA 4C3IK 5CJ9A 3AQPA 4YFKA 1SMYA 4GT9A 2A68A 4XSXA 3M3YC 5IYCC 5IOQA 2GSNA 1Y1WK 1TWGC 2PMZL 4BBRK 4A3LK 5EGHA 1WQFA 4A3KC 1INNA 2PPBA 4C3HC 2FQOA 4NOIA 2V6UA 3S15C 3OPFA 3GTKC
chains in the Genus database with same CATH topology
5C4JK 3HOUK 2YU9K 3S14C 5M5YK 4BBSK 5C4JC 2JA6K 2YU9C 2NVTK 3HOUC 2E2HK 3GTLK 2JA6C 3HOXK 2E2HC 3GTJK 1WCMK 2NVXK 3HOXC 4LJZA 1K83K 3GTQK 3GTJC 2NVXC 5FLMK 2R92K 1K83C 3GTQC 5FLMC 5M5WK 1I6VA 3H3VD 5TMFA 3GTKC 3GTPK 3I4NK 2BE5A 4LK1A 3GTPC 4OINA 3I4NC 2PMZD 4BY7C 2JA7K 4A3EK 4A3CC 2O5IA 2JA5K 3WODA 1YNJA 4JK1A 4Y7NK 2JA7C 3HKZL 4A3EC 4X6AK 1I50K 3FKIK 2JA5C 4ZH4A 3HOZK 3S2DK 4XLPA 3PO2K 4A3LC 4X6AC 1I50C 3FKIC 3PO2C 2WB1D 4BXXK 3GTGC 2WAQL 1SFOK 4A3JK 5IP9K 4A3MK 5IYBC 1SFOC 3S17K 4A3JC 4A3FK 4QJVB 4KN7A 4A3IC 3S17C 2A69A 4A3FC 2R7ZK 4BBSC 4G7ZA 3S1MK 4LK0A 1TWFK 2NVTC 1ZYRA 4AYBD 3S1RK 4QIWL 3GTLC 3S1MC 1TWFC 4LLGA 4YFXA 3S1RC 1I3QK 1WCMC 5TMCA 2A6HA 1TWCK 1I3QC 2VUMK 5C44K 4Q5SA 2R92C 1TWCC 4KMUA 5M5XK 2JA8K 4XSZA 5C44C 1XPPA 2JA8C 2Y0SL 1Y1VK 1R9TK 4KN4A 3HKZD 4YFNA 1Y1VC 4A3BK 1R9TC 3HOVK 4Y7NC 5M3FK 4MEXA 5IP7K 4A3BC 3CQZK 3HOVC 2R93K 4BY1K 3RZOK 5IP7C 3HOZC 3CQZC 3GTMK 3S2DC 4A3DK 2WAQD 2R93C 4BY1C 3RZOC 3GTMC 3HOWK 1TWHK 4G7OA 4BXXC 3H0GK 2PA8L 1TWHC 4YG2A 5IP9C 5C3EK 3M4OK 5IYDK 4A3MC 3H0GC 2A6EA 5C3EC 5IYDC 3HOYK 5FJ8K 4QIWD 3HOYC 2R7ZC 2E2JK 1TWGK 4C2MK 3S1QK 4Y52K 4MEYA 3H3VL 2E2JC 3S1QC 1I6HK 1TWAK 4Y52C 3S16K 4OIQA 4G7HA 1TWAC 3S1NK 1I6HC 3S16C 2VUMC 3S2HK 4OIPA 4A3GK 2B63K 2Y0SD 4A3KK 4A3GC 2B63C 4A93K 3I4MK 4Q4ZA 2CW0A 4GZYA 4C3HK 4A93C 3I4MC 3GTOK 2NVYK 3S15K 5C4XK 3K7AK 4QJVA 3GTOC 2NVYC 1YNNA 3S14K 5C4XC 3EQLA 3K7AC 4C3JK 4C3IK 2E2IK 4A3DC 3DXJA 4YFKA 1SMYA 2PA8D 2E2IC 4MQ9A 2O5JA 3HOWC 2A68A 4XSXA 3M3YK 5IYCK 4AYBL 3M3YC 3M4OC 5IYCC 4OIRA 4XLNA 5D4DA 4OIOA 1Y1WK 1TWGC 4BY7K 1Y1WC 4A3CK 3RZDK 1IW7A 2PMZL 4BBRK 3S1NC 3RZDC 4A3LK 3S2HC 4BBRC 4A3KC 5M3MK 3PO3K 3GTGK 2PPBA 2NVQK 3PO3C 4NOIA 1BDFA 2WB1L 5IYBK 3GTKK 1HQMA 2NVQC 3S15C 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4J K;  3HOU K;  2YU9 K;  3S14 C;  5M5Y K;  4BBS K;  5C4J C;  2JA6 K;  2YU9 C;  2NVT K;  3HOU C;  2E2H K;  3GTL K;  2JA6 C;  3HOX K;  2E2H C;  3GTJ K;  1WCM K;  2NVX K;  3HOX C;  4LJZ A;  1K83 K;  3GTQ K;  3GTJ C;  2NVX C;  5FLM K;  2R92 K;  1K83 C;  3GTQ C;  5FLM C;  5M5W K;  1I6V A;  3H3V D;  5TMF A;  3GTK C;  3GTP K;  3I4N K;  2BE5 A;  4LK1 A;  3GTP C;  4OIN A;  3I4N C;  2PMZ D;  4BY7 C;  2JA7 K;  4A3E K;  4A3C C;  2O5I A;  2JA5 K;  3WOD A;  1YNJ A;  4JK1 A;  4Y7N K;  2JA7 C;  3HKZ L;  4A3E C;  4X6A K;  1I50 K;  3FKI K;  2JA5 C;  4ZH4 A;  3HOZ K;  3S2D K;  4XLP A;  3PO2 K;  4A3L C;  4X6A C;  1I50 C;  3FKI C;  3PO2 C;  2WB1 D;  4BXX K;  3GTG C;  2WAQ L;  1SFO K;  4A3J K;  5IP9 K;  4A3M K;  5IYB C;  1SFO C;  3S17 K;  4A3J C;  4A3F K;  4QJV B;  4KN7 A;  4A3I C;  3S17 C;  2A69 A;  4A3F C;  2R7Z K;  4BBS C;  4G7Z A;  3S1M K;  4LK0 A;  1TWF K;  2NVT C;  1ZYR A;  4AYB D;  3S1R K;  4QIW L;  3GTL C;  3S1M C;  1TWF C;  4LLG A;  4YFX A;  3S1R C;  1I3Q K;  1WCM C;  5TMC A;  2A6H A;  1TWC K;  1I3Q C;  2VUM K;  5C44 K;  4Q5S A;  2R92 C;  1TWC C;  4KMU A;  5M5X K;  2JA8 K;  4XSZ A;  5C44 C;  1XPP A;  2JA8 C;  2Y0S L;  1Y1V K;  1R9T K;  4KN4 A;  3HKZ D;  4YFN A;  1Y1V C;  4A3B K;  1R9T C;  3HOV K;  4Y7N C;  5M3F K;  4MEX A;  5IP7 K;  4A3B C;  3CQZ K;  3HOV C;  2R93 K;  4BY1 K;  3RZO K;  5IP7 C;  3HOZ C;  3CQZ C;  3GTM K;  3S2D C;  4A3D K;  2WAQ D;  2R93 C;  4BY1 C;  3RZO C;  3GTM C;  3HOW K;  1TWH K;  4G7O A;  4BXX C;  3H0G K;  2PA8 L;  1TWH C;  4YG2 A;  5IP9 C;  5C3E K;  3M4O K;  5IYD K;  4A3M C;  3H0G C;  2A6E A;  5C3E C;  5IYD C;  3HOY K;  5FJ8 K;  4QIW D;  3HOY C;  2R7Z C;  2E2J K;  1TWG K;  4C2M K;  3S1Q K;  4Y52 K;  4MEY A;  3H3V L;  2E2J C;  3S1Q C;  1I6H K;  1TWA K;  4Y52 C;  3S16 K;  4OIQ A;  4G7H A;  1TWA C;  3S1N K;  1I6H C;  3S16 C;  2VUM C;  3S2H K;  4OIP A;  4A3G K;  2B63 K;  2Y0S D;  4A3K K;  4A3G C;  2B63 C;  4A93 K;  3I4M K;  4Q4Z A;  2CW0 A;  4GZY A;  4C3H K;  4A93 C;  3I4M C;  3GTO K;  2NVY K;  3S15 K;  5C4X K;  3K7A K;  4QJV A;  3GTO C;  2NVY C;  1YNN A;  3S14 K;  5C4X C;  3EQL A;  3K7A C;  4C3J K;  4C3I K;  2E2I K;  4A3D C;  3DXJ A;  4YFK A;  1SMY A;  2PA8 D;  2E2I C;  4MQ9 A;  2O5J A;  3HOW C;  2A68 A;  4XSX A;  3M3Y K;  5IYC K;  4AYB L;  3M3Y C;  3M4O C;  5IYC C;  4OIR A;  4XLN A;  5D4D A;  4OIO A;  1Y1W K;  1TWG C;  4BY7 K;  1Y1W C;  4A3C K;  3RZD K;  1IW7 A;  2PMZ L;  4BBR K;  3S1N C;  3RZD C;  4A3L K;  3S2H C;  4BBR C;  4A3K C;  5M3M K;  3PO3 K;  3GTG K;  2PPB A;  2NVQ K;  3PO3 C;  4NOI A;  1BDF A;  2WB1 L;  5IYB K;  3GTK K;  1HQM A;  2NVQ C;  3S15 C;  4A3I K; 
#chains in the Genus database with same CATH topology
 1O26 A;  3BP3 A;  5C4J C;  3GTL K;  2JA6 C;  4KMA A;  3HOX C;  4LJZ A;  1K83 K;  1YX2 A;  3LPX A;  1USO A;  3GTP K;  2BE5 A;  1XZQ B;  3A8K A;  4Y7N K;  3Q3Q A;  4JK1 A;  4KAT A;  4A3E C;  4X6A K;  1F7V A;  2JA5 C;  4ZH4 A;  3PO2 K;  1I50 C;  3FKI C;  3GTG A;  4ILD A;  3GTK A;  4BXX K;  4A3J K;  5IYB C;  1SFO C;  4A3F K;  4KM8 A;  2JA6 A;  5L46 A;  4A3I C;  4G0V A;  2NVT C;  1TWF K;  1ZYR A;  1F7U A;  1WCM C;  5TMC A;  1XZP B;  1I3Q C;  5C44 K;  3TFJ A;  1TWC C;  2R92 C;  1IS1 A;  3QX3 A;  3N0C A;  4XSZ A;  1XPP A;  4M1X A;  1Y1V K;  2GSO A;  2JA5 A;  1X31 C;  3HKZ D;  2D6F C;  1I50 A;  1RU0 A;  3FKI A;  1R9T C;  5M3F K;  1DD5 A;  1HI9 A;  1ZBS A;  5IP7 C;  3GTM K;  1WOR A;  3S2D C;  3TFI A;  1SFO A;  3RZO C;  3V4G A;  1ZXO A;  3GEI A;  4O2D A;  5C3E K;  1TWH C;  4YG2 A;  1ZQ1 C;  2A6E A;  3HOY C;  2R7Z C;  2E2J K;  1TWG K;  1XZQ A;  4MEY A;  1I3Q A;  1KQ4 A;  4KMD A;  1TWC A;  3GIR A;  1YCL A;  1TWA C;  1WSV A;  4A3G K;  4GTD A;  1F93 A;  4A3K K;  4GTC A;  4P9S A;  2GAH C;  3AD8 C;  1R9T A;  4C3H K;  2P8T A;  3BUE A;  2NVY K;  3S15 K;  3GTO C;  5C4X C;  1EH1 A;  4C3J C;  4A3D C;  1TWH A;  2E2I C;  2XCR B;  1JVI A;  2O5J A;  3HOW C;  4WJ3 M;  1BGW A;  1PJ5 A;  1XZP A;  3L4K A;  4XLN A;  2KWA A;  4AH6 A;  5IOR A;  1TWA A;  1B4A A;  1XXB A;  4LQY A;  3RZD C;  1O24 A;  3T00 A;  3BP8 C;  1BS2 A;  4GFQ A;  5M3M K;  3GTO A;  1DCP A;  3PO3 C;  5IYB K;  4KAS A;  2NVQ C;  4A3I K;  3HOU K;  2E2I A;  3S14 C;  4P5B A;  2YU9 C;  2NVT K;  2E2H K;  1V5V A;  1WCM K;  1WSR A;  3GTQ K;  3GTJ C;  2NVX C;  2R92 K;  1AB4 A;  3SZY A;  5FLM C;  5M5W K;  1I6V A;  1O25 A;  3I4N C;  2CFA B;  2JA7 K;  3ERE D;  5HL8 A;  3HKZ L;  1WOP A;  3S2D K;  4XLP A;  3G4C A;  3GTG C;  3AD7 C;  2YU9 A;  3S17 K;  3FOE A;  4KN7 A;  2A69 A;  2JH3 A;  1O29 A;  2R7Z K;  3S1M K;  3GTJ A;  2NVX A;  3S1R K;  4LLG A;  1VLO A;  2A6H A;  4Q5S A;  2EBB A;  5JVO A;  2JA8 K;  4FZB A;  3N0B A;  3AH5 A;  1VH2 A;  3GEH A;  4KN4 A;  4YFN A;  2PHC B;  1GE9 A;  4G0U A;  4C45 A;  3HOV K;  4A3B C;  4BY1 K;  4A3D K;  3HOZ C;  3CQZ C;  2R93 C;  2WAQ D;  1J6V A;  3HOW K;  2ZUE A;  4A3M C;  3H0G C;  5IYD C;  4QIW D;  3S1Q K;  3H3V L;  2CFA A;  4C2M C;  4Y52 C;  2VUM A;  3S16 K;  4G7H A;  1I6H C;  2FQT A;  4OIP A;  2GAG C;  2B63 C;  3I4M K;  2CW0 A;  4A93 C;  3CQZ A;  4BLA A;  2R93 A;  3S14 K;  1J6X A;  3EQL A;  3JST A;  3K7A C;  4WJ4 A;  4C3I C;  3DXJ A;  3G4A A;  3H0G A;  3L4J A;  1O27 A;  1BJT A;  3M3Y K;  5IYC K;  4AYB L;  1G51 A;  4PAA A;  3TFH A;  3FOF A;  3M4O C;  1WQG A;  2RH6 A;  5D4D A;  4OIO A;  1WIH A;  1Y1W C;  1XXA A;  1IQ0 A;  3NUH A;  3SZZ A;  2B63 A;  3S1N C;  3FHZ A;  4LR2 A;  4BBR C;  3ADA C;  3GEE A;  3GTG K;  1VJE A;  3GTK K;  1HQM A;  1UV7 A;  5C4J K;  5M5Y K;  1DCH A;  2JA6 K;  1ZVU A;  3HOX K;  3GDZ A;  4PAB A;  1K83 C;  4BLB A;  3H3V D;  1Y1W A;  1WQH A;  1O2B A;  4KC6 A;  1EQR A;  4LK1 A;  3GTP C;  4BY7 C;  4RMF A;  4A3C C;  4A3E K;  1F9N A;  2JA5 K;  3WOD A;  1YNJ A;  5E68 A;  2O5I A;  1I50 K;  3FKI K;  2XCQ A;  3HOZ K;  4X6A C;  1PJ7 A;  5IOT A;  3PO2 C;  2WB1 D;  3CAG A;  2WAQ L;  1SFO K;  4A3M K;  4A3J C;  4QJV B;  4A3F C;  1EFW A;  3GTL A;  4BBS C;  4AYB D;  4KMH A;  4QIW L;  1K83 A;  1TWF C;  1I3Q K;  2W7V A;  1TWC K;  2V6S A;  4KDD A;  3GTP A;  4KMU A;  5C44 C;  1R9T K;  3HXA A;  1O2A A;  1EI6 A;  1Y1V C;  2RGR A;  5IP7 K;  4KAW X;  4G0W A;  3RZO K;  3OEP A;  3GTM C;  1TWH K;  4KB2 A;  5IP9 C;  3M4O K;  1USM A;  5C3E C;  3HOY K;  3T02 A;  1TWF A;  4J3N A;  3IPJ A;  2E2J C;  1TWA K;  1IE0 A;  4OIQ A;  3S1N K;  4DDQ A;  1WOO A;  4BKW A;  2VUM C;  1L0W A;  4GTB A;  3LAP A;  2Y0S D;  3A8J A;  4A3G C;  1Y1V A;  3GTO K;  5C4X K;  4QJV A;  2NVY C;  1YNN A;  4C3J K;  3GTM A;  2E2I K;  2PA8 D;  1IBA A;  4MQ9 A;  4GTF A;  4WIL A;  4OIR A;  1TWG A;  2GSU A;  4LOW A;  4BY7 K;  4A3C K;  2XCO A;  3RZD K;  1IW7 A;  1VRQ C;  1EK8 A;  4GTA A;  2Y3P A;  2ZFZ A;  3S2H C;  3PO3 K;  2NVY A;  2NVQ K;  1BDF A;  2WB1 L;  2YU9 K;  3GSI A;  4BBS K;  3HOU C;  2E2H C;  3GTJ K;  1B4B A;  4FM9 A;  2NVX K;  1O28 A;  3AQO A;  5FLM K;  3GTQ C;  1XXC A;  5TMF A;  3T01 A;  3I4N K;  3ORE A;  4OIN A;  2PMZ D;  2P5M A;  3AD9 C;  2JA7 C;  1DCO A;  4KAR A;  4A3L C;  5IP9 K;  4P5A A;  1J6W A;  3S17 C;  2E2H A;  1JQW A;  4G7Z A;  4LK0 A;  1WCM A;  2ZUF A;  3GTL C;  3S1M C;  3GTQ A;  1WOS A;  4YFX A;  3S1R C;  2R92 A;  3N3Y A;  2VUM K;  1JOE A;  5M5X K;  5TJ3 A;  3LAJ A;  1J98 A;  4KB4 A;  2JA8 C;  2Y0S L;  2JA7 A;  5EGE A;  4A3B K;  2V6T A;  4Y7N C;  4MEX A;  3CQZ K;  3HOV C;  2R93 K;  1ISE A;  1PJ6 A;  4BY1 C;  4G7O A;  4BXX C;  5IOS A;  3H0G K;  2PA8 L;  5IYD K;  2R7Z A;  3VA7 A;  5FJ8 K;  3TTG A;  5CHP A;  4C2M K;  4XCH A;  4Y52 K;  1VGX A;  4GTL A;  3S1Q C;  1I6H K;  1O2F B;  3S16 C;  1IL2 A;  3MML B;  3S2H K;  2B63 K;  4A93 K;  4GZY A;  3A8I A;  3S0X A;  4Q4Z A;  1C0A A;  4KM9 A;  3I4M C;  3K7A K;  5JFE A;  4GTE A;  4C3I K;  5CJ9 A;  3AQP A;  4YFK A;  1SMY A;  4GT9 A;  2A68 A;  4XSX A;  3M3Y C;  5IYC C;  5IOQ A;  2GSN A;  1Y1W K;  1TWG C;  2PMZ L;  4BBR K;  4A3L K;  5EGH A;  1WQF A;  4A3K C;  1INN A;  2PPB A;  4C3H C;  2FQO A;  4NOI A;  2V6U A;  3S15 C;  3OPF A;  3GTK C; 
#chains in the Genus database with same CATH homology
 5C4J K;  3HOU K;  2YU9 K;  3S14 C;  5M5Y K;  4BBS K;  5C4J C;  2JA6 K;  2YU9 C;  2NVT K;  3HOU C;  2E2H K;  3GTL K;  2JA6 C;  3HOX K;  2E2H C;  3GTJ K;  1WCM K;  2NVX K;  3HOX C;  4LJZ A;  1K83 K;  3GTQ K;  3GTJ C;  2NVX C;  5FLM K;  2R92 K;  1K83 C;  3GTQ C;  5FLM C;  5M5W K;  1I6V A;  3H3V D;  5TMF A;  3GTK C;  3GTP K;  3I4N K;  2BE5 A;  4LK1 A;  3GTP C;  4OIN A;  3I4N C;  2PMZ D;  4BY7 C;  2JA7 K;  4A3E K;  4A3C C;  2O5I A;  2JA5 K;  3WOD A;  1YNJ A;  4JK1 A;  4Y7N K;  2JA7 C;  3HKZ L;  4A3E C;  4X6A K;  1I50 K;  3FKI K;  2JA5 C;  4ZH4 A;  3HOZ K;  3S2D K;  4XLP A;  3PO2 K;  4A3L C;  4X6A C;  1I50 C;  3FKI C;  3PO2 C;  2WB1 D;  4BXX K;  3GTG C;  2WAQ L;  1SFO K;  4A3J K;  5IP9 K;  4A3M K;  5IYB C;  1SFO C;  3S17 K;  4A3J C;  4A3F K;  4QJV B;  4KN7 A;  4A3I C;  3S17 C;  2A69 A;  4A3F C;  2R7Z K;  4BBS C;  4G7Z A;  3S1M K;  4LK0 A;  1TWF K;  2NVT C;  1ZYR A;  4AYB D;  3S1R K;  4QIW L;  3GTL C;  3S1M C;  1TWF C;  4LLG A;  4YFX A;  3S1R C;  1I3Q K;  1WCM C;  5TMC A;  2A6H A;  1TWC K;  1I3Q C;  2VUM K;  5C44 K;  4Q5S A;  2R92 C;  1TWC C;  4KMU A;  5M5X K;  2JA8 K;  4XSZ A;  5C44 C;  1XPP A;  2JA8 C;  2Y0S L;  1Y1V K;  1R9T K;  4KN4 A;  3HKZ D;  4YFN A;  1Y1V C;  4A3B K;  1R9T C;  3HOV K;  4Y7N C;  5M3F K;  4MEX A;  5IP7 K;  4A3B C;  3CQZ K;  3HOV C;  2R93 K;  4BY1 K;  3RZO K;  5IP7 C;  3HOZ C;  3CQZ C;  3GTM K;  3S2D C;  4A3D K;  2WAQ D;  2R93 C;  4BY1 C;  3RZO C;  3GTM C;  3HOW K;  1TWH K;  4G7O A;  4BXX C;  3H0G K;  2PA8 L;  1TWH C;  4YG2 A;  5IP9 C;  5C3E K;  3M4O K;  5IYD K;  4A3M C;  3H0G C;  2A6E A;  5C3E C;  5IYD C;  3HOY K;  5FJ8 K;  4QIW D;  3HOY C;  2R7Z C;  2E2J K;  1TWG K;  4C2M K;  3S1Q K;  4Y52 K;  4MEY A;  3H3V L;  2E2J C;  3S1Q C;  1I6H K;  1TWA K;  4Y52 C;  3S16 K;  4OIQ A;  4G7H A;  1TWA C;  3S1N K;  1I6H C;  3S16 C;  2VUM C;  3S2H K;  4OIP A;  4A3G K;  2B63 K;  2Y0S D;  4A3K K;  4A3G C;  2B63 C;  4A93 K;  3I4M K;  4Q4Z A;  2CW0 A;  4GZY A;  4C3H K;  4A93 C;  3I4M C;  3GTO K;  2NVY K;  3S15 K;  5C4X K;  3K7A K;  4QJV A;  3GTO C;  2NVY C;  1YNN A;  3S14 K;  5C4X C;  3EQL A;  3K7A C;  4C3J K;  4C3I K;  2E2I K;  4A3D C;  3DXJ A;  4YFK A;  1SMY A;  2PA8 D;  2E2I C;  4MQ9 A;  2O5J A;  3HOW C;  2A68 A;  4XSX A;  3M3Y K;  5IYC K;  4AYB L;  3M3Y C;  3M4O C;  5IYC C;  4OIR A;  4XLN A;  5D4D A;  4OIO A;  1Y1W K;  1TWG C;  4BY7 K;  1Y1W C;  4A3C K;  3RZD K;  1IW7 A;  2PMZ L;  4BBR K;  3S1N C;  3RZD C;  4A3L K;  3S2H C;  4BBR C;  4A3K C;  5M3M K;  3PO3 K;  3GTG K;  2PPB A;  2NVQ K;  3PO3 C;  4NOI A;  1BDF A;  2WB1 L;  5IYB K;  3GTK K;  1HQM A;  2NVQ C;  3S15 C;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...