3GTPK

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtpK00
2YU9C 3S1MK 4BBSK 2A69A 1I6HK 4BY7C 3CQZK 1I6HC 4MQ9A 4A3FK 3S1QK 4BXXC 4KN7A 3HOVC 3I4NK 3S2HK 2R93C 4BY1C 3PO3K 4Y52C 3GTQK 4C2MK 2JA5C 3H3VD 4BY1K 3PO3C 2VUMK 2BE5A 1XPPA 3FKIC 5TMCA 2NVQK 4X6AC 4XSXA 4A3EK 2JA8C 2VUMC 2JA6C 5FLMK 3GTMC 3RZOC 2Y0SD 4A3FC 3GTGK 3S1RK 4Q4ZA 5D4DA 2A68A 4OIPA 3HOUC 1SMYA 2R93K 1K83K 4A93C 2A6HA 1Y1WC 2E2JK 5IYBK 4A3JC 3S14K 1K83C 4A93K 4Q5SA 5C44K 1TWFK 4LLGA 3S14C 4A3EC 4MEXA 3RZOK 2A6EA 1Y1VK 4A3GC 3S17K 4XSZA 4A3GK 3HKZL 3GTPK 2PA8D 2WB1L 2PA8L 5M3MK 5IYDC 3HOUK 3HOVK 3I4MC 4A3JK 3I4NC 1YNNA 1TWGK 2E2HC 2NVTC 3HOWK 4OIOA 3S15K 2NVXK 1BDFA 1TWGC 4A3MC 2E2HK 3HOWC 3HOYC 1TWAK 4LK0A 3GTLC 2YU9K 4BBSC 4A3MK 1Y1VC 4JK1A 4QJVA 3H0GK 2NVQC 5M3FK 3RZDC 2JA8K 2R7ZC 3DXJA 3HOZK 3GTMK 2E2IC 2O5JA 5IYDK 3WODA 2CW0A 3S1RC 3I4MK 4A3CK 2NVYC 4A3IK 3S1NC 5IP7K 5C4JC 3HOXK 2WB1D 4A3CC 2NVYK 4BBRK 4A3IC 3HOYK 4A3BC 2R92C 4X6AK 4YFKA 5TMFA 1SFOK 2JA6K 3EQLA 3H3VL 1TWCK 4G7HA 2JA7K 3GTGC 3M3YC 1IW7A 1YNJA 1I6VA 4G7ZA 3GTOC 1WCMC 3GTOK 3PO2K 4BBRC 4A3BK 1TWHC 1WCMK 4AYBD 4LJZA 5IYCC 1SFOC 2PPBA 2B63C 3PO2C 3S15C 2Y0SL 5IYCK 1ZYRA 1TWAC 3GTLK 5C4XC 4Y7NK 3H0GC 3GTPC 4Y7NC 4BXXK 1I50K 2E2IK 3S2DC 4A3DK 4KMUA 2NVTK 3M4OK 4C3JK 4YFNA 4A3KC 3GTJC 5C4XK 2NVXC 3S16K 5M5YK 5IP7C 1R9TC 5C4JK 4C3IK 3HOXC 3S16C 3CQZC 4ZH4A 3FKIK 1HQMA 4XLNA 3RZDK 4YFXA 4NOIA 2WAQL 4QIWL 4YG2A 5FLMC 3HOZC 3K7AK 2R7ZK 1I3QK 2PMZD 1TWCC 4XLPA 3S2HC 3S2DK 4A3LK 4G7OA 3S1NK 2JA5K 3GTKC 3GTJK 2WAQD 4A3LC 5IYBC 2R92K 1TWHK 1TWFC 4C3HK 4LK1A 5M5XK 5IP9K 5FJ8K 4MEYA 4QJVB 2B63K 2JA7C 3M3YK 3K7AC 4BY7K 1I3QC 3S17C 3S1QC 3HKZD 5C3EC 1Y1WK 2E2JC 3GTKK 5C3EK 4GZYA 4OIQA 4KN4A 5C44C 1I50C 4A3DC 2O5IA 3GTQC 4Y52K 3M4OC 2PMZL 4A3KK 4OIRA 3S1MC 4QIWD 4OINA 5IP9C 5M5WK 1R9TK 4AYBL
chains in the Genus database with same CATH superfamily
4BBSK 2A69A 4LR2A 3CQZA 1EFWA 4G0UA 1I6HC 5IORA 4BXXC 4KN7A 1XXBA 3PO3K 2ZFZA 2JA5C 3GTKA 3PO3C 3T02A 2NVQK 3FKIC 3BP3A 4XSXA 4A3EK 3GEEA 2GSOA 3GTMC 4P9SA 2A68A 3VA7A 1WOSA 3S0XA 5IYBK 3S14K 2P5MA 4Q5SA 1G51A 1TWFK 3S14C 4A3EC 4A3GC 2PA8D 2PA8L 3HOUK 1YNNA 1J98A 3S15K 3BUEA 4A3MC 1TWGC 1TWAA 4A3MK 4JK1A 3LAJA 2JA6A 1WOPA 3S1RC 1O2AA 4X6AK 2JA6K 1TWCA 3GTGC 1L0WA 2Y3PA 1F93A 3PO2K 4AYBD 5IYCC 5IYCK 1ZYRA 3N3YA 4FZBA 4BXXK 3A8JA 4YFNA 1AB4A 1EH1A 2NVXC 1R9TC 1O25A 1UV7A 1IS1A 1F7VA 3CQZC 4ZH4A 3RZDK 2D6FC 4NOIA 2PMZD 3S2HC 4GTEA 5E68A 4A3LK 3S1NK 2JA5K 3GTKC 3GTJK 4GTBA 2WAQD 3GTOA 1YX2A 3ADAC 1TWHK 1TWFC 4C3HK 4KMAA 3QX3A 5FJ8K 3LPXA 3S17C 3GTPA 2E2JC 1WSRA 3GTKK 1YCLA 4KN4A 1WORA 2KWAA 4M1XA 2XCRB 4OIRA 4QIWD 2CFAA 2YU9C 3CQZK 2GAGC 4AH6A 3S2HK 1TWGA 4C2MK 3H3VD 2VUMK 5TMCA 4X6AC 1JVIA 3TFHA 3RZOC 2E2IA 1B4BA 1O2FB 3GTGK 3S1RK 4Q4ZA 2RGRA 4OIPA 3HOUC 1SMYA 1K83K 2E2JK 3L4KA 1I50A 3GTQA 4MEXA 3RZOK 3GTGA 4KDDA 3AD8C 2JH3A 3MMLB 4GTLA 4A3GK 2WB1L 5M3MK 3CAGA 5TJ3A 2E2HC 3HOWK 3TFIA 2NVXK 2R93A 1BDFA 3HOYC 3TFJA 4C2MC 4LK0A 3RZDC 4KMHA 3WODA 1B4AA 2CW0A 1HI9A 3I4MK 3SZYA 4A3IK 3S1NC 1R9TA 2P8TA 2WB1D 4LOWA 3JSTA 4A3IC 3HOYK 1Y1WA 5TMFA 1SFOK 1F7UA 4C3HC 3OREA 2JA7K 3M3YC 1IW7A 2GSUA 4G7ZA 1WQGA 3GTOC 4GTDA 1WCMC 1O26A 4BBRC 1TWHC 1WCMK 3PO2C 1INNA 1SFOC 2PPBA 2JA7A 3GTLK 3FHZA 1KQ4A 1ZXOA 1Y1VA 1USMA 3LAPA 4BLAA 1WQHA 2R7ZA 1EQRA 4KMUA 2NVTK 4C3JK 3GTJC 1JOEA 3HOXC 2YU9A 2V6SA 4PAAA 3FKIK 3N0CA 1O2BA 1EK8A 4YFXA 2R7ZK 3HOZC 3K7AK 4WJ4A 1I3QK 4XLPA 1O27A 4G7OA 3AH5A 5IOTA 2JA5A 4A3LC 5IYBC 3GDZA 4KM9A 4GT9A 2V6TA 5M5XK 4BKWA 4QJVB 3K7AC 1I3QC 1WOOA 2W7VA 1IL2A 4FM9A 1XXAA 3S1QC 4OIQA 1I50C 4KARA 3TTGA 3A8KA 3GTQC 4Y52K 1XZPB 3S1MC 2VUMC 2CFAB 1J6WA 1VH2A 4C45A 3S1QK 4WJ3M 1IQ0A 1ISEA 2R93C 4BY1C 4Y52C 3AQOA 5JFEA 3GTQK 1O24A 4XCHA 1ZQ1C 2JA8C 2JA6C 5FLMK 2Y0SD 4A3FC 2FQTA 1PJ7A 3A8IA 2R93K 4A93C 4GTCA 2A6HA 4A3JC 1K83C 4LLGA 3GEIA 5EGHA 2A6EA 3G4AA 4PABA 1BS2A 3AQPA 4A3JK 3I4MC 1SFOA 1USOA 2E2HK 3HOWC 3BP8C 3GTLC 4BBSC 3V4GA 3H0GK 5M3FK 2JA8K 4GFQA 3HOZK 3GTMA 4C3JC 3Q3QA 3GTJA 4A3CK 2NVYC 5IP7K 3HOXK 2NVYK 4BBRK 1J6VA 4YFKA 1IBAA 1WQFA 1PJ5A 3G4CA 1WIHA 3GTOK 4A3BK 1TWFA 1DCHA 1BJTA 4LJZA 2Y0SL 1I3QA 1TWAC 4WILA 2EBBA 3OPFA 4Y7NK 4G0WA 3H0GC 4KM8A 3GTPC 4Y7NC 3OEPA 2RH6A 1I50K 3S16K 4O2DA 5M5YK 2VUMA 5IP7C 5C4JK 1HQMA 4XLNA 2R92A 5HL8A 5FLMC 5JVOA 2ZUEA 1DD5A 1O29A 2R92K 3FOFA 4MEYA 2B63A 3GIRA 1PJ6A 1ZBSA 1XXCA 2XCOA 1Y1WK 1X31C 2GAHC 1K83A 4A3DC 2GSNA 4KMDA 2NVXA 2FQOA 5D4DA 4GZYA 5C4XK 3S1MK 1I6HK 1JQWA 4BY7C 5L46A 1DCPA 4GTAA 4MQ9A 4A3FK 3HOVC 3I4NK 2E2HA 3SZZA 3GTLA 4C3IC 4BY1K 2BE5A 1XPPA 5EGEA 1VJEA 4P5AA 2NVYA 1DCOA 1Y1WC 3IPJA 4A93K 5C44K 1XZQB 4KASA 1VLOA 1IE0A 3FOEA 1Y1VK 2PHCB 3N0BA 3S17K 4XSZA 3HKZL 3GTPK 5IYDC 3GEHA 4ILDA 3HOVK 3I4NC 5IOSA 4A3CC 1TWGK 2NVTC 4OIOA 1F9NA 1TWAK 1ZVUA 3NUHA 2YU9K 1Y1VC 4P5BA 3H0GA 4QJVA 4DDQA 2NVQC 3FKIA 2V6UA 3ERED 2R7ZC 3DXJA 3GTMK 2E2IC 2O5JA 5IYDK 1RU0A 4G0VA 5C4JC 3L4JA 4LQYA 4BLBA 4A3BC 1J6XA 4KATA 2R92C 3HXAA 1C0AA 3EQLA 3H3VL 4KB2A 1TWCK 4G7HA 1YNJA 1I6VA 4GTFA 2B63C 3S15C 5C4XC 3T00A 2ZUFA 2XCQA 4A3DK 2E2IK 3S2DC 3M4OK 4A3KC 3GSIA 4C3IK 1GE9A 4KAWX 3S16C 1XZPA 1V5VA 1VRQC 1WSVA 4KB4A 2WAQL 1XZQA 4QIWL 4YG2A 4KC6A 3AD9C 1TWCC 5CHPA 3S2DK 5CJ9A 1WCMA 4J3NA 1TWHA 4LK1A 3T01A 5IP9K 2B63K 2JA7C 3M3YK 3AD7C 4BY7K 4RMFA 1BGWA 3HKZD 5C3EC 1EI6A 5C3EK 5C44C 1VGXA 1O28A 2O5IA 3M4OC 2PMZL 5IOQA 4A3KK 4OINA 5IP9C 5M5WK 1R9TK 4AYBL
chains in the Genus database with same CATH topology
2YU9C 3S1MK 4BBSK 2A69A 1I6HK 4BY7C 3CQZK 1I6HC 4MQ9A 4A3FK 3S1QK 4BXXC 4KN7A 3HOVC 3I4NK 3S2HK 2R93C 4BY1C 3PO3K 4Y52C 3GTQK 4C2MK 2JA5C 3H3VD 4BY1K 3PO3C 2VUMK 2BE5A 1XPPA 3FKIC 5TMCA 2NVQK 4X6AC 4XSXA 4A3EK 2JA8C 2VUMC 2JA6C 5FLMK 3GTMC 3RZOC 2Y0SD 4A3FC 3GTGK 3S1RK 4Q4ZA 5D4DA 2A68A 4OIPA 3HOUC 1SMYA 2R93K 1K83K 4A93C 2A6HA 1Y1WC 2E2JK 5IYBK 4A3JC 3S14K 1K83C 4A93K 4Q5SA 5C44K 1TWFK 4LLGA 3S14C 4A3EC 4MEXA 3RZOK 2A6EA 1Y1VK 4A3GC 3S17K 4XSZA 4A3GK 3HKZL 3GTPK 2PA8D 2WB1L 2PA8L 5M3MK 5IYDC 3HOUK 3HOVK 3I4MC 4A3JK 3I4NC 1YNNA 1TWGK 2E2HC 2NVTC 3HOWK 4OIOA 3S15K 2NVXK 1BDFA 1TWGC 4A3MC 2E2HK 3HOWC 3HOYC 1TWAK 4LK0A 3GTLC 2YU9K 4BBSC 4A3MK 1Y1VC 4JK1A 4QJVA 3H0GK 2NVQC 5M3FK 3RZDC 2JA8K 2R7ZC 3DXJA 3HOZK 3GTMK 2E2IC 2O5JA 5IYDK 3WODA 2CW0A 3S1RC 3I4MK 4A3CK 2NVYC 4A3IK 3S1NC 5IP7K 5C4JC 3HOXK 2WB1D 4A3CC 2NVYK 4BBRK 4A3IC 3HOYK 4A3BC 2R92C 4X6AK 4YFKA 5TMFA 1SFOK 2JA6K 3EQLA 3H3VL 1TWCK 4G7HA 2JA7K 3GTGC 3M3YC 1IW7A 1YNJA 1I6VA 4G7ZA 3GTOC 1WCMC 3GTOK 3PO2K 4BBRC 4A3BK 1TWHC 1WCMK 4AYBD 4LJZA 5IYCC 1SFOC 2PPBA 2B63C 3PO2C 3S15C 2Y0SL 5IYCK 1ZYRA 1TWAC 3GTLK 5C4XC 4Y7NK 3H0GC 3GTPC 4Y7NC 4BXXK 1I50K 2E2IK 3S2DC 4A3DK 4KMUA 2NVTK 3M4OK 4C3JK 4YFNA 4A3KC 3GTJC 5C4XK 2NVXC 3S16K 5M5YK 5IP7C 1R9TC 5C4JK 4C3IK 3HOXC 3S16C 3CQZC 4ZH4A 3FKIK 1HQMA 4XLNA 3RZDK 4YFXA 4NOIA 2WAQL 4QIWL 4YG2A 5FLMC 3HOZC 3K7AK 2R7ZK 1I3QK 2PMZD 1TWCC 4XLPA 3S2HC 3S2DK 4A3LK 4G7OA 3S1NK 2JA5K 3GTKC 3GTJK 2WAQD 4A3LC 5IYBC 2R92K 1TWHK 1TWFC 4C3HK 4LK1A 5M5XK 5IP9K 5FJ8K 4MEYA 4QJVB 2B63K 2JA7C 3M3YK 3K7AC 4BY7K 1I3QC 3S17C 3S1QC 3HKZD 5C3EC 1Y1WK 2E2JC 3GTKK 5C3EK 4GZYA 4OIQA 4KN4A 5C44C 1I50C 4A3DC 2O5IA 3GTQC 4Y52K 3M4OC 2PMZL 4A3KK 4OIRA 3S1MC 4QIWD 4OINA 5IP9C 5M5WK 1R9TK 4AYBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 C;  3S1M K;  4BBS K;  2A69 A;  1I6H K;  4BY7 C;  3CQZ K;  1I6H C;  4MQ9 A;  4A3F K;  3S1Q K;  4BXX C;  4KN7 A;  3HOV C;  3I4N K;  3S2H K;  2R93 C;  4BY1 C;  3PO3 K;  4Y52 C;  3GTQ K;  4C2M K;  2JA5 C;  3H3V D;  4BY1 K;  3PO3 C;  2VUM K;  2BE5 A;  1XPP A;  3FKI C;  5TMC A;  2NVQ K;  4X6A C;  4XSX A;  4A3E K;  2JA8 C;  2VUM C;  2JA6 C;  5FLM K;  3GTM C;  3RZO C;  2Y0S D;  4A3F C;  3GTG K;  3S1R K;  4Q4Z A;  5D4D A;  2A68 A;  4OIP A;  3HOU C;  1SMY A;  2R93 K;  1K83 K;  4A93 C;  2A6H A;  1Y1W C;  2E2J K;  5IYB K;  4A3J C;  3S14 K;  1K83 C;  4A93 K;  4Q5S A;  5C44 K;  1TWF K;  4LLG A;  3S14 C;  4A3E C;  4MEX A;  3RZO K;  2A6E A;  1Y1V K;  4A3G C;  3S17 K;  4XSZ A;  4A3G K;  3HKZ L;  3GTP K;  2PA8 D;  2WB1 L;  2PA8 L;  5M3M K;  5IYD C;  3HOU K;  3HOV K;  3I4M C;  4A3J K;  3I4N C;  1YNN A;  1TWG K;  2E2H C;  2NVT C;  3HOW K;  4OIO A;  3S15 K;  2NVX K;  1BDF A;  1TWG C;  4A3M C;  2E2H K;  3HOW C;  3HOY C;  1TWA K;  4LK0 A;  3GTL C;  2YU9 K;  4BBS C;  4A3M K;  1Y1V C;  4JK1 A;  4QJV A;  3H0G K;  2NVQ C;  5M3F K;  3RZD C;  2JA8 K;  2R7Z C;  3DXJ A;  3HOZ K;  3GTM K;  2E2I C;  2O5J A;  5IYD K;  3WOD A;  2CW0 A;  3S1R C;  3I4M K;  4A3C K;  2NVY C;  4A3I K;  3S1N C;  5IP7 K;  5C4J C;  3HOX K;  2WB1 D;  4A3C C;  2NVY K;  4BBR K;  4A3I C;  3HOY K;  4A3B C;  2R92 C;  4X6A K;  4YFK A;  5TMF A;  1SFO K;  2JA6 K;  3EQL A;  3H3V L;  1TWC K;  4G7H A;  2JA7 K;  3GTG C;  3M3Y C;  1IW7 A;  1YNJ A;  1I6V A;  4G7Z A;  3GTO C;  1WCM C;  3GTO K;  3PO2 K;  4BBR C;  4A3B K;  1TWH C;  1WCM K;  4AYB D;  4LJZ A;  5IYC C;  1SFO C;  2PPB A;  2B63 C;  3PO2 C;  3S15 C;  2Y0S L;  5IYC K;  1ZYR A;  1TWA C;  3GTL K;  5C4X C;  4Y7N K;  3H0G C;  3GTP C;  4Y7N C;  4BXX K;  1I50 K;  2E2I K;  3S2D C;  4A3D K;  4KMU A;  2NVT K;  3M4O K;  4C3J K;  4YFN A;  4A3K C;  3GTJ C;  5C4X K;  2NVX C;  3S16 K;  5M5Y K;  5IP7 C;  1R9T C;  5C4J K;  4C3I K;  3HOX C;  3S16 C;  3CQZ C;  4ZH4 A;  3FKI K;  1HQM A;  4XLN A;  3RZD K;  4YFX A;  4NOI A;  2WAQ L;  4QIW L;  4YG2 A;  5FLM C;  3HOZ C;  3K7A K;  2R7Z K;  1I3Q K;  2PMZ D;  1TWC C;  4XLP A;  3S2H C;  3S2D K;  4A3L K;  4G7O A;  3S1N K;  2JA5 K;  3GTK C;  3GTJ K;  2WAQ D;  4A3L C;  5IYB C;  2R92 K;  1TWH K;  1TWF C;  4C3H K;  4LK1 A;  5M5X K;  5IP9 K;  5FJ8 K;  4MEY A;  4QJV B;  2B63 K;  2JA7 C;  3M3Y K;  3K7A C;  4BY7 K;  1I3Q C;  3S17 C;  3S1Q C;  3HKZ D;  5C3E C;  1Y1W K;  2E2J C;  3GTK K;  5C3E K;  4GZY A;  4OIQ A;  4KN4 A;  5C44 C;  1I50 C;  4A3D C;  2O5I A;  3GTQ C;  4Y52 K;  3M4O C;  2PMZ L;  4A3K K;  4OIR A;  3S1M C;  4QIW D;  4OIN A;  5IP9 C;  5M5W K;  1R9T K;  4AYB L; 
#chains in the Genus database with same CATH topology
 4BBS K;  2A69 A;  4LR2 A;  3CQZ A;  1EFW A;  4G0U A;  1I6H C;  5IOR A;  4BXX C;  4KN7 A;  1XXB A;  3PO3 K;  2ZFZ A;  2JA5 C;  3GTK A;  3PO3 C;  3T02 A;  2NVQ K;  3FKI C;  3BP3 A;  4XSX A;  4A3E K;  3GEE A;  2GSO A;  3GTM C;  4P9S A;  2A68 A;  3VA7 A;  1WOS A;  3S0X A;  5IYB K;  3S14 K;  2P5M A;  4Q5S A;  1G51 A;  1TWF K;  3S14 C;  4A3E C;  4A3G C;  2PA8 D;  2PA8 L;  3HOU K;  1YNN A;  1J98 A;  3S15 K;  3BUE A;  4A3M C;  1TWG C;  1TWA A;  4A3M K;  4JK1 A;  3LAJ A;  2JA6 A;  1WOP A;  3S1R C;  1O2A A;  4X6A K;  2JA6 K;  1TWC A;  3GTG C;  1L0W A;  2Y3P A;  1F93 A;  3PO2 K;  4AYB D;  5IYC C;  5IYC K;  1ZYR A;  3N3Y A;  4FZB A;  4BXX K;  3A8J A;  4YFN A;  1AB4 A;  1EH1 A;  2NVX C;  1R9T C;  1O25 A;  1UV7 A;  1IS1 A;  1F7V A;  3CQZ C;  4ZH4 A;  3RZD K;  2D6F C;  4NOI A;  2PMZ D;  3S2H C;  4GTE A;  5E68 A;  4A3L K;  3S1N K;  2JA5 K;  3GTK C;  3GTJ K;  4GTB A;  2WAQ D;  3GTO A;  1YX2 A;  3ADA C;  1TWH K;  1TWF C;  4C3H K;  4KMA A;  3QX3 A;  5FJ8 K;  3LPX A;  3S17 C;  3GTP A;  2E2J C;  1WSR A;  3GTK K;  1YCL A;  4KN4 A;  1WOR A;  2KWA A;  4M1X A;  2XCR B;  4OIR A;  4QIW D;  2CFA A;  2YU9 C;  3CQZ K;  2GAG C;  4AH6 A;  3S2H K;  1TWG A;  4C2M K;  3H3V D;  2VUM K;  5TMC A;  4X6A C;  1JVI A;  3TFH A;  3RZO C;  2E2I A;  1B4B A;  1O2F B;  3GTG K;  3S1R K;  4Q4Z A;  2RGR A;  4OIP A;  3HOU C;  1SMY A;  1K83 K;  2E2J K;  3L4K A;  1I50 A;  3GTQ A;  4MEX A;  3RZO K;  3GTG A;  4KDD A;  3AD8 C;  2JH3 A;  3MML B;  4GTL A;  4A3G K;  2WB1 L;  5M3M K;  3CAG A;  5TJ3 A;  2E2H C;  3HOW K;  3TFI A;  2NVX K;  2R93 A;  1BDF A;  3HOY C;  3TFJ A;  4C2M C;  4LK0 A;  3RZD C;  4KMH A;  3WOD A;  1B4A A;  2CW0 A;  1HI9 A;  3I4M K;  3SZY A;  4A3I K;  3S1N C;  1R9T A;  2P8T A;  2WB1 D;  4LOW A;  3JST A;  4A3I C;  3HOY K;  1Y1W A;  5TMF A;  1SFO K;  1F7U A;  4C3H C;  3ORE A;  2JA7 K;  3M3Y C;  1IW7 A;  2GSU A;  4G7Z A;  1WQG A;  3GTO C;  4GTD A;  1WCM C;  1O26 A;  4BBR C;  1TWH C;  1WCM K;  3PO2 C;  1INN A;  1SFO C;  2PPB A;  2JA7 A;  3GTL K;  3FHZ A;  1KQ4 A;  1ZXO A;  1Y1V A;  1USM A;  3LAP A;  4BLA A;  1WQH A;  2R7Z A;  1EQR A;  4KMU A;  2NVT K;  4C3J K;  3GTJ C;  1JOE A;  3HOX C;  2YU9 A;  2V6S A;  4PAA A;  3FKI K;  3N0C A;  1O2B A;  1EK8 A;  4YFX A;  2R7Z K;  3HOZ C;  3K7A K;  4WJ4 A;  1I3Q K;  4XLP A;  1O27 A;  4G7O A;  3AH5 A;  5IOT A;  2JA5 A;  4A3L C;  5IYB C;  3GDZ A;  4KM9 A;  4GT9 A;  2V6T A;  5M5X K;  4BKW A;  4QJV B;  3K7A C;  1I3Q C;  1WOO A;  2W7V A;  1IL2 A;  4FM9 A;  1XXA A;  3S1Q C;  4OIQ A;  1I50 C;  4KAR A;  3TTG A;  3A8K A;  3GTQ C;  4Y52 K;  1XZP B;  3S1M C;  2VUM C;  2CFA B;  1J6W A;  1VH2 A;  4C45 A;  3S1Q K;  4WJ3 M;  1IQ0 A;  1ISE A;  2R93 C;  4BY1 C;  4Y52 C;  3AQO A;  5JFE A;  3GTQ K;  1O24 A;  4XCH A;  1ZQ1 C;  2JA8 C;  2JA6 C;  5FLM K;  2Y0S D;  4A3F C;  2FQT A;  1PJ7 A;  3A8I A;  2R93 K;  4A93 C;  4GTC A;  2A6H A;  4A3J C;  1K83 C;  4LLG A;  3GEI A;  5EGH A;  2A6E A;  3G4A A;  4PAB A;  1BS2 A;  3AQP A;  4A3J K;  3I4M C;  1SFO A;  1USO A;  2E2H K;  3HOW C;  3BP8 C;  3GTL C;  4BBS C;  3V4G A;  3H0G K;  5M3F K;  2JA8 K;  4GFQ A;  3HOZ K;  3GTM A;  4C3J C;  3Q3Q A;  3GTJ A;  4A3C K;  2NVY C;  5IP7 K;  3HOX K;  2NVY K;  4BBR K;  1J6V A;  4YFK A;  1IBA A;  1WQF A;  1PJ5 A;  3G4C A;  1WIH A;  3GTO K;  4A3B K;  1TWF A;  1DCH A;  1BJT A;  4LJZ A;  2Y0S L;  1I3Q A;  1TWA C;  4WIL A;  2EBB A;  3OPF A;  4Y7N K;  4G0W A;  3H0G C;  4KM8 A;  3GTP C;  4Y7N C;  3OEP A;  2RH6 A;  1I50 K;  3S16 K;  4O2D A;  5M5Y K;  2VUM A;  5IP7 C;  5C4J K;  1HQM A;  4XLN A;  2R92 A;  5HL8 A;  5FLM C;  5JVO A;  2ZUE A;  1DD5 A;  1O29 A;  2R92 K;  3FOF A;  4MEY A;  2B63 A;  3GIR A;  1PJ6 A;  1ZBS A;  1XXC A;  2XCO A;  1Y1W K;  1X31 C;  2GAH C;  1K83 A;  4A3D C;  2GSN A;  4KMD A;  2NVX A;  2FQO A;  5D4D A;  4GZY A;  5C4X K;  3S1M K;  1I6H K;  1JQW A;  4BY7 C;  5L46 A;  1DCP A;  4GTA A;  4MQ9 A;  4A3F K;  3HOV C;  3I4N K;  2E2H A;  3SZZ A;  3GTL A;  4C3I C;  4BY1 K;  2BE5 A;  1XPP A;  5EGE A;  1VJE A;  4P5A A;  2NVY A;  1DCO A;  1Y1W C;  3IPJ A;  4A93 K;  5C44 K;  1XZQ B;  4KAS A;  1VLO A;  1IE0 A;  3FOE A;  1Y1V K;  2PHC B;  3N0B A;  3S17 K;  4XSZ A;  3HKZ L;  3GTP K;  5IYD C;  3GEH A;  4ILD A;  3HOV K;  3I4N C;  5IOS A;  4A3C C;  1TWG K;  2NVT C;  4OIO A;  1F9N A;  1TWA K;  1ZVU A;  3NUH A;  2YU9 K;  1Y1V C;  4P5B A;  3H0G A;  4QJV A;  4DDQ A;  2NVQ C;  3FKI A;  2V6U A;  3ERE D;  2R7Z C;  3DXJ A;  3GTM K;  2E2I C;  2O5J A;  5IYD K;  1RU0 A;  4G0V A;  5C4J C;  3L4J A;  4LQY A;  4BLB A;  4A3B C;  1J6X A;  4KAT A;  2R92 C;  3HXA A;  1C0A A;  3EQL A;  3H3V L;  4KB2 A;  1TWC K;  4G7H A;  1YNJ A;  1I6V A;  4GTF A;  2B63 C;  3S15 C;  5C4X C;  3T00 A;  2ZUF A;  2XCQ A;  4A3D K;  2E2I K;  3S2D C;  3M4O K;  4A3K C;  3GSI A;  4C3I K;  1GE9 A;  4KAW X;  3S16 C;  1XZP A;  1V5V A;  1VRQ C;  1WSV A;  4KB4 A;  2WAQ L;  1XZQ A;  4QIW L;  4YG2 A;  4KC6 A;  3AD9 C;  1TWC C;  5CHP A;  3S2D K;  5CJ9 A;  1WCM A;  4J3N A;  1TWH A;  4LK1 A;  3T01 A;  5IP9 K;  2B63 K;  2JA7 C;  3M3Y K;  3AD7 C;  4BY7 K;  4RMF A;  1BGW A;  3HKZ D;  5C3E C;  1EI6 A;  5C3E K;  5C44 C;  1VGX A;  1O28 A;  2O5I A;  3M4O C;  2PMZ L;  5IOQ A;  4A3K K;  4OIN A;  5IP9 C;  5M5W K;  1R9T K;  4AYB L; 
#chains in the Genus database with same CATH homology
 2YU9 C;  3S1M K;  4BBS K;  2A69 A;  1I6H K;  4BY7 C;  3CQZ K;  1I6H C;  4MQ9 A;  4A3F K;  3S1Q K;  4BXX C;  4KN7 A;  3HOV C;  3I4N K;  3S2H K;  2R93 C;  4BY1 C;  3PO3 K;  4Y52 C;  3GTQ K;  4C2M K;  2JA5 C;  3H3V D;  4BY1 K;  3PO3 C;  2VUM K;  2BE5 A;  1XPP A;  3FKI C;  5TMC A;  2NVQ K;  4X6A C;  4XSX A;  4A3E K;  2JA8 C;  2VUM C;  2JA6 C;  5FLM K;  3GTM C;  3RZO C;  2Y0S D;  4A3F C;  3GTG K;  3S1R K;  4Q4Z A;  5D4D A;  2A68 A;  4OIP A;  3HOU C;  1SMY A;  2R93 K;  1K83 K;  4A93 C;  2A6H A;  1Y1W C;  2E2J K;  5IYB K;  4A3J C;  3S14 K;  1K83 C;  4A93 K;  4Q5S A;  5C44 K;  1TWF K;  4LLG A;  3S14 C;  4A3E C;  4MEX A;  3RZO K;  2A6E A;  1Y1V K;  4A3G C;  3S17 K;  4XSZ A;  4A3G K;  3HKZ L;  3GTP K;  2PA8 D;  2WB1 L;  2PA8 L;  5M3M K;  5IYD C;  3HOU K;  3HOV K;  3I4M C;  4A3J K;  3I4N C;  1YNN A;  1TWG K;  2E2H C;  2NVT C;  3HOW K;  4OIO A;  3S15 K;  2NVX K;  1BDF A;  1TWG C;  4A3M C;  2E2H K;  3HOW C;  3HOY C;  1TWA K;  4LK0 A;  3GTL C;  2YU9 K;  4BBS C;  4A3M K;  1Y1V C;  4JK1 A;  4QJV A;  3H0G K;  2NVQ C;  5M3F K;  3RZD C;  2JA8 K;  2R7Z C;  3DXJ A;  3HOZ K;  3GTM K;  2E2I C;  2O5J A;  5IYD K;  3WOD A;  2CW0 A;  3S1R C;  3I4M K;  4A3C K;  2NVY C;  4A3I K;  3S1N C;  5IP7 K;  5C4J C;  3HOX K;  2WB1 D;  4A3C C;  2NVY K;  4BBR K;  4A3I C;  3HOY K;  4A3B C;  2R92 C;  4X6A K;  4YFK A;  5TMF A;  1SFO K;  2JA6 K;  3EQL A;  3H3V L;  1TWC K;  4G7H A;  2JA7 K;  3GTG C;  3M3Y C;  1IW7 A;  1YNJ A;  1I6V A;  4G7Z A;  3GTO C;  1WCM C;  3GTO K;  3PO2 K;  4BBR C;  4A3B K;  1TWH C;  1WCM K;  4AYB D;  4LJZ A;  5IYC C;  1SFO C;  2PPB A;  2B63 C;  3PO2 C;  3S15 C;  2Y0S L;  5IYC K;  1ZYR A;  1TWA C;  3GTL K;  5C4X C;  4Y7N K;  3H0G C;  3GTP C;  4Y7N C;  4BXX K;  1I50 K;  2E2I K;  3S2D C;  4A3D K;  4KMU A;  2NVT K;  3M4O K;  4C3J K;  4YFN A;  4A3K C;  3GTJ C;  5C4X K;  2NVX C;  3S16 K;  5M5Y K;  5IP7 C;  1R9T C;  5C4J K;  4C3I K;  3HOX C;  3S16 C;  3CQZ C;  4ZH4 A;  3FKI K;  1HQM A;  4XLN A;  3RZD K;  4YFX A;  4NOI A;  2WAQ L;  4QIW L;  4YG2 A;  5FLM C;  3HOZ C;  3K7A K;  2R7Z K;  1I3Q K;  2PMZ D;  1TWC C;  4XLP A;  3S2H C;  3S2D K;  4A3L K;  4G7O A;  3S1N K;  2JA5 K;  3GTK C;  3GTJ K;  2WAQ D;  4A3L C;  5IYB C;  2R92 K;  1TWH K;  1TWF C;  4C3H K;  4LK1 A;  5M5X K;  5IP9 K;  5FJ8 K;  4MEY A;  4QJV B;  2B63 K;  2JA7 C;  3M3Y K;  3K7A C;  4BY7 K;  1I3Q C;  3S17 C;  3S1Q C;  3HKZ D;  5C3E C;  1Y1W K;  2E2J C;  3GTK K;  5C3E K;  4GZY A;  4OIQ A;  4KN4 A;  5C44 C;  1I50 C;  4A3D C;  2O5I A;  3GTQ C;  4Y52 K;  3M4O C;  2PMZ L;  4A3K K;  4OIR A;  3S1M C;  4QIW D;  4OIN A;  5IP9 C;  5M5W K;  1R9T K;  4AYB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...