3GTPK

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna-rna hybrid
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtpK00
5M3MK 4A3IK 3S1QC 1WCMC 1Y1VC 3HOZK 4OIOA 1TWCK 3GTKK 3HOUK 3GTOC 3HOVC 4QJVA 2B63K 3I4MK 3S16K 4A3DC 2A6EA 5M5XK 2PMZD 3HOYK 4XLNA 4MEXA 2R92K 1Y1WC 3H3VL 2A69A 4G7ZA 4A3MK 4A3KC 5M5WK 2O5JA 3EQLA 2JA7C 3GTJK 2JA5C 3M3YC 4Q4ZA 4ZH4A 5TMFA 4Y52C 4G7HA 2JA8C 4XSZA 4AYBL 3PO2K 4BY7K 3S1NK 5C3EC 5IP7C 2PPBA 1K83K 2Y0SL 1YNJA 3CQZC 2B63C 5IYCC 4LK1A 3S16C 4A3FK 3H0GK 4A93K 4OIQA 4C2MK 4YFXA 5TMCA 2E2JC 4BY1K 4QIWD 2JA6K 3H3VD 3GTMK 3RZDK 2VUMC 3GTLK 3I4NK 3S15C 3GTJC 2E2HC 4A3JK 4A3CK 4A3IC 4A3GK 5IP9C 4OINA 1WCMK 4A3LC 3GTOK 3HOWK 3S14K 3S2DK 1TWAK 3DXJA 4X6AC 2R93K 4BBRC 5IYCK 2Y0SD 2PMZL 3H0GC 1IW7A 4MQ9A 4A3KK 4A3MC 1TWFK 2E2JK 2R7ZK 3S15K 2E2IK 1BDFA 1XPPA 3M3YK 4MEYA 3K7AC 2YU9C 5C4XC 5IYDC 2WB1L 3FKIC 4Y52K 3S1NC 1TWCC 3GTKC 5IP7K 4A3LK 5C3EK 3HOVK 1YNNA 4C3JK 1SFOK 2NVYC 3S2HC 4G7OA 3S1RK 3RZOC 4BBRK 2WAQL 2BE5A 4Q5SA 5M3FK 3M4OC 4BY1C 1TWFC 3GTGC 3GTPK 2E2IC 1I6HK 4C3HK 4A3GC 5IYBC 4BY7C 5IYDK 5IP9K 4Y7NC 3HOWC 3S2DC 2NVXK 3GTQC 2NVQC 1TWAC 4X6AK 4YG2A 4NOIA 5C4JK 4A3EC 3S1RC 4BXXC 3HKZD 4XLPA 2O5IA 2CW0A 1R9TC 4KN7A 4BBSK 2VUMK 2NVTC 3S1MC 4GZYA 4A3BC 1I6HC 3K7AK 4QJVB 5C4XK 1I50K 2YU9K 2PA8L 1TWHC 2WB1D 3FKIK 4YFKA 3HOZC 2PA8D 4LLGA 1I6VA 2NVYK 3S2HK 5D4DA 5C4JC 4A3EK 4A3DK 5C44C 4BXXK 3HOXK 2R7ZC 1TWGK 2R92C 1I3QK 5FJ8K 3GTGK 2JA7K 4OIPA 4A3BK 3RZDC 2A6HA 5IYBK 1Y1VK 4Y7NK 3S1QK 3WODA 4KMUA 3HOUC 2NVXC 1SFOC 2NVQK 3I4MC 4KN4A 4YFNA 3RZOK 3HKZL 4QIWL 3S17C 1Y1WK 5C44K 3M4OK 4OIRA 2JA6C 1TWGC 4XSXA 5FLMC 3GTMC 1I3QC 3GTPC 3PO3C 4BBSC 4JK1A 2JA5K 4C3IK 3GTLC 4A3JC 4A3CC 1I50C 4LK0A 4AYBD 3PO2C 2JA8K 1TWHK 1K83C 3GTQK 3S14C 4LJZA 3CQZK 2R93C 4A3FC 4A93C 1SMYA 1HQMA 3HOYC 2WAQD 3S17K 3HOXC 1R9TK 3I4NC 5FLMK 3PO3K 2NVTK 3S1MK 2A68A 1ZYRA 2E2HK 5M5YK
chains in the Genus database with same CATH superfamily
3S1QC 4GFQA 3GTKK 4KM8A 1WSVA 3HOVC 2B63K 5M5XK 4LQYA 1TWAA 2R92K 4G7ZA 4A3MK 3GTJK 1R9TA 1BS2A 3M3YC 4ZH4A 5TMFA 3H0GA 4G7HA 1WQGA 4BY7K 4KMAA 5C3EC 1USOA 1I3QA 2PPBA 4C3JC 4G0VA 5IYCC 3S16C 1F7VA 1YX2A 2JA6K 5EGHA 2ZUEA 2FQTA 1XXAA 3RZDK 4P5AA 3GTLK 5JFEA 1F7UA 5IP9C 3CQZA 1WIHA 1TWAK 1PJ5A 3DXJA 2R92A 4X6AC 2Y0SD 1DD5A 1IW7A 3GSIA 4A3MC 2E2JK 1TWFK 2RH6A 1IS1A 1IL2A 1O26A 1UV7A 5E68A 3S0XA 2YU9C 5IYDC 4Y52K 3GTKC 2V6UA 5IP7K 4C3JK 3S2HC 2JA6A 3AD7C 3ADAC 3OEPA 2WAQL 2BE5A 4Q5SA 5M3FK 2JH3A 4BY1C 2NVXA 1B4BA 1EK8A 1WQFA 4KAWX 5IYDK 2JA7A 4Y7NC 1AB4A 4A3EC 3T00A 2CFAB 3GEEA 3HKZD 4BBSK 2VUMK 3S1MC 4GZYA 4A3BC 4QJVB 1JVIA 2CFAA 2YU9K 2PA8L 3FKIK 3A8IA 3HOZC 3VA7A 2NVYK 1TWCA 4J3NA 5C4JC 1TWGK 3AQPA 1DCPA 2JA7K 4C3HC 4KC6A 3GIRA 2VUMA 1WOSA 4KMUA 3HOUC 4DDQA 3RZOK 4G0UA 1EI6A 3HKZL 5C44K 2NVYA 1TWGC 3GTOA 5IOQA 3GTPC 5HL8A 3FKIA 4C3IK 1TWGA 5IORA 1I50C 4LK0A 4GTFA 3TFIA 3S14C 4A93C 2WAQD 1ZQ1C 4RMFA 3RZDC 5M5YK 1PJ7A 3HOUK 3NUHA 4QJVA 3I4MK 2A69A 3EQLA 2Y0SL 1YNJA 2R7ZA 2B63C 1I50A 4A93K 3H0GK 4OIQA 4C2MK 4YFXA 5TMCA 2E2JC 4GTEA 4GTDA 3I4NK 5IOSA 4KASA 3L4JA 4OINA 1WORA 5IYCK 1O25A 4P9SA 4MQ9A 2R7ZK 1VRQC 3T02A 4A3KK 1BDFA 3M3YK 3K7AC 1TWCC 4A3LK 4C45A 3AD8C 3OREA 3RZOC 2V6TA 1TWFC 3JSTA 1PJ6A 4C3HK 5IYBC 4BY7C 3AH5A 2JA5A 1XZPB 1L0WA 2NVXK 5C4JK 3S1RC 4BXXC 2O5IA 1J6XA 2CW0A 1R9TC 4GTAA 1ZBSA 1Y1VA 5CJ9A 1I6HC 5C4XK 4KB4A 3G4AA 4YFKA 2PA8D 3V4GA 4LLGA 2ZFZA 3GTKA 4A3EK 4A3DK 4LOWA 2R7ZC 3SZYA 2E2IA 5FJ8K 4M1XA 5TJ3A 4OIPA 1DCOA 1Y1VK 4Y7NK 3IPJA 3WODA 1IQ0A 1O29A 1TWFA 2NVQK 4KN4A 4YFNA 1VLOA 1Y1WK 4C2MC 3GEHA 4KATA 4BBSC 4JK1A 3AQOA 1RU0A 1XZQA 1K83C 3Q3QA 4LJZA 3CQZK 3FOEA 3HOYC 1HQMA 1V5VA 5FLMK 3A8JA 2NVTK 3A8KA 3S15C 5M3MK 4A3IK 1Y1VC 4OIOA 3GTPA 3GTOC 1O2AA 3S16K 4XLNA 2YU9A 2B63A 4BLBA 1K83A 5M5WK 2JA5C 3TTGA 4XSZA 3S1NK 5IP7C 3CQZC 2D6FC 3LAJA 4A3GK 4A3IC 4BLAA 1WQHA 2GSNA 3BP8C 4A3LC 4GTBA 3GTOK 3HOWK 3S14K 4WJ4A 1SFOA 2R93K 4BBRC 4FM9A 2PMZL 3H0GC 2P8TA 2GSOA 4MEYA 2RGRA 2WB1L 1O2FB 3FKIC 5C3EK 3HOVK 2NVYC 4G7OA 2GAGC 3S1RK 4BBRK 1VH2A 3FOFA 3GTJA 3TFHA 3T01A 1I6HK 4C3IC 1IE0A 1WSRA 4A3GC 3QX3A 5JVOA 2R93A 3S2DC 5EGEA 4KB2A 2XCQA 3GTQC 4NOIA 1BGWA 1DCHA 1EH1A 4XLPA 3GTLA 3LAPA 1GE9A 2NVTC 3K7AK 1I50K 2FQOA 4GTCA 1TWHC 1JQWA 1WOOA 3FHZA 3S2HK 5D4DA 1KQ4A 5C44C 4BXXK 3HOXK 1I3QK 3G4CA 4A3BK 4PABA 2A6HA 5IYBK 1XZQB 2V6SA 2NVXC 3I4MC 1J6VA 5L46A 3M4OK 2JA6C 2E2HA 3PO3C 4A3JC 4A3CC 1TWHK 1ZXOA 2GSUA 4A3FC 3AD9C 3S17K 3N0CA 4P5BA 3HOXC 4FZBA 3PO3K 4WJ3M 1JOEA 2A68A 3GTGA 2E2HK 1ISEA 1O28A 1EQRA 1WCMC 3HOZK 1TWCK 1J6WA 1USMA 2ZUFA 4A3DC 1TWHA 2A6EA 4LR2A 5CHPA 2PMZD 3HOYK 4MEXA 4G0WA 1Y1WC 3CAGA 3H3VL 4A3KC 2O5JA 2JA7C 2W7VA 4KM9A 4Q4ZA 1G51A 4KDDA 4Y52C 3TFJA 2JA8C 4PAAA 4AYBL 3PO2K 1VJEA 1K83K 3GTQA 1ZVUA 4KARA 1INNA 4LK1A 4A3FK 3GTMK 4BY1K 4QIWD 3H3VD 3L4KA 1WOPA 2VUMC 1B4AA 3BP3A 4XCHA 3GTJC 4A3JK 2E2HC 4A3CK 1WCMK 3S2DK 3N0BA 4AH6A 2XCOA 3S15K 2E2IK 1XPPA 2P5MA 5C4XC 4BKWA 3S1NC 4KMDA 1YNNA 1SFOK 3GTMA 2PHCB 1XXCA 1WCMA 4KMHA 1C0AA 3M4OC 1O2BA 3GTGC 3GTPK 1VGXA 2XCRB 1J98A 3GDZA 1IBAA 5IP9K 2GAHC 3HOWC 2NVQC 1TWAC 4X6AK 4YG2A 1EFWA 3HXAA 4ILDA 4KN7A 1XZPA 1O24A 1BJTA 1YCLA 2WB1D 1I6VA 2EBBA 1X31C 2R92C 1F9NA 3GTGK 3SZZA 1O27A 3MMLB 3S1QK 3LPXA 3BUEA 1SFOC 4WILA 1Y1WA 3OPFA 4GT9A 4GTLA 3ERED 3N3YA 4QIWL 3S17C 4OIRA 3GTMC 4XSXA 5FLMC 1I3QC 1F93A 1HI9A 2JA5K 3GTLC 3GEIA 2Y3PA 4AYBD 3PO2C 2JA8K 5IOTA 3GTQK 2R93C 1SMYA 1R9TK 2KWAA 3I4NC 1XXBA 3S1MK 4O2DA 1ZYRA 2E2IC
chains in the Genus database with same CATH topology
5M3MK 4A3IK 3S1QC 1WCMC 1Y1VC 3HOZK 4OIOA 1TWCK 3GTKK 3HOUK 3GTOC 3HOVC 4QJVA 2B63K 3I4MK 3S16K 4A3DC 2A6EA 5M5XK 2PMZD 3HOYK 4XLNA 4MEXA 2R92K 1Y1WC 3H3VL 2A69A 4G7ZA 4A3MK 4A3KC 5M5WK 2O5JA 3EQLA 2JA7C 3GTJK 2JA5C 3M3YC 4Q4ZA 4ZH4A 5TMFA 4Y52C 4G7HA 2JA8C 4XSZA 4AYBL 3PO2K 4BY7K 3S1NK 5C3EC 5IP7C 2PPBA 1K83K 2Y0SL 1YNJA 3CQZC 2B63C 5IYCC 4LK1A 3S16C 4A3FK 3H0GK 4A93K 4OIQA 4C2MK 4YFXA 5TMCA 2E2JC 4BY1K 4QIWD 2JA6K 3H3VD 3GTMK 3RZDK 2VUMC 3GTLK 3I4NK 3S15C 3GTJC 2E2HC 4A3JK 4A3CK 4A3IC 4A3GK 5IP9C 4OINA 1WCMK 4A3LC 3GTOK 3HOWK 3S14K 3S2DK 1TWAK 3DXJA 4X6AC 2R93K 4BBRC 5IYCK 2Y0SD 2PMZL 3H0GC 1IW7A 4MQ9A 4A3KK 4A3MC 1TWFK 2E2JK 2R7ZK 3S15K 2E2IK 1BDFA 1XPPA 3M3YK 4MEYA 3K7AC 2YU9C 5C4XC 5IYDC 2WB1L 3FKIC 4Y52K 3S1NC 1TWCC 3GTKC 5IP7K 4A3LK 5C3EK 3HOVK 1YNNA 4C3JK 1SFOK 2NVYC 3S2HC 4G7OA 3S1RK 3RZOC 4BBRK 2WAQL 2BE5A 4Q5SA 5M3FK 3M4OC 4BY1C 1TWFC 3GTGC 3GTPK 2E2IC 1I6HK 4C3HK 4A3GC 5IYBC 4BY7C 5IYDK 5IP9K 4Y7NC 3HOWC 3S2DC 2NVXK 3GTQC 2NVQC 1TWAC 4X6AK 4YG2A 4NOIA 5C4JK 4A3EC 3S1RC 4BXXC 3HKZD 4XLPA 2O5IA 2CW0A 1R9TC 4KN7A 4BBSK 2VUMK 2NVTC 3S1MC 4GZYA 4A3BC 1I6HC 3K7AK 4QJVB 5C4XK 1I50K 2YU9K 2PA8L 1TWHC 2WB1D 3FKIK 4YFKA 3HOZC 2PA8D 4LLGA 1I6VA 2NVYK 3S2HK 5D4DA 5C4JC 4A3EK 4A3DK 5C44C 4BXXK 3HOXK 2R7ZC 1TWGK 2R92C 1I3QK 5FJ8K 3GTGK 2JA7K 4OIPA 4A3BK 3RZDC 2A6HA 5IYBK 1Y1VK 4Y7NK 3S1QK 3WODA 4KMUA 3HOUC 2NVXC 1SFOC 2NVQK 3I4MC 4KN4A 4YFNA 3RZOK 3HKZL 4QIWL 3S17C 1Y1WK 5C44K 3M4OK 4OIRA 2JA6C 1TWGC 4XSXA 5FLMC 3GTMC 1I3QC 3GTPC 3PO3C 4BBSC 4JK1A 2JA5K 4C3IK 3GTLC 4A3JC 4A3CC 1I50C 4LK0A 4AYBD 3PO2C 2JA8K 1TWHK 1K83C 3GTQK 3S14C 4LJZA 3CQZK 2R93C 4A3FC 4A93C 1SMYA 1HQMA 3HOYC 2WAQD 3S17K 3HOXC 1R9TK 3I4NC 5FLMK 3PO3K 2NVTK 3S1MK 2A68A 1ZYRA 2E2HK 5M5YK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M K;  4A3I K;  3S1Q C;  1WCM C;  1Y1V C;  3HOZ K;  4OIO A;  1TWC K;  3GTK K;  3HOU K;  3GTO C;  3HOV C;  4QJV A;  2B63 K;  3I4M K;  3S16 K;  4A3D C;  2A6E A;  5M5X K;  2PMZ D;  3HOY K;  4XLN A;  4MEX A;  2R92 K;  1Y1W C;  3H3V L;  2A69 A;  4G7Z A;  4A3M K;  4A3K C;  5M5W K;  2O5J A;  3EQL A;  2JA7 C;  3GTJ K;  2JA5 C;  3M3Y C;  4Q4Z A;  4ZH4 A;  5TMF A;  4Y52 C;  4G7H A;  2JA8 C;  4XSZ A;  4AYB L;  3PO2 K;  4BY7 K;  3S1N K;  5C3E C;  5IP7 C;  2PPB A;  1K83 K;  2Y0S L;  1YNJ A;  3CQZ C;  2B63 C;  5IYC C;  4LK1 A;  3S16 C;  4A3F K;  3H0G K;  4A93 K;  4OIQ A;  4C2M K;  4YFX A;  5TMC A;  2E2J C;  4BY1 K;  4QIW D;  2JA6 K;  3H3V D;  3GTM K;  3RZD K;  2VUM C;  3GTL K;  3I4N K;  3S15 C;  3GTJ C;  2E2H C;  4A3J K;  4A3C K;  4A3I C;  4A3G K;  5IP9 C;  4OIN A;  1WCM K;  4A3L C;  3GTO K;  3HOW K;  3S14 K;  3S2D K;  1TWA K;  3DXJ A;  4X6A C;  2R93 K;  4BBR C;  5IYC K;  2Y0S D;  2PMZ L;  3H0G C;  1IW7 A;  4MQ9 A;  4A3K K;  4A3M C;  1TWF K;  2E2J K;  2R7Z K;  3S15 K;  2E2I K;  1BDF A;  1XPP A;  3M3Y K;  4MEY A;  3K7A C;  2YU9 C;  5C4X C;  5IYD C;  2WB1 L;  3FKI C;  4Y52 K;  3S1N C;  1TWC C;  3GTK C;  5IP7 K;  4A3L K;  5C3E K;  3HOV K;  1YNN A;  4C3J K;  1SFO K;  2NVY C;  3S2H C;  4G7O A;  3S1R K;  3RZO C;  4BBR K;  2WAQ L;  2BE5 A;  4Q5S A;  5M3F K;  3M4O C;  4BY1 C;  1TWF C;  3GTG C;  3GTP K;  2E2I C;  1I6H K;  4C3H K;  4A3G C;  5IYB C;  4BY7 C;  5IYD K;  5IP9 K;  4Y7N C;  3HOW C;  3S2D C;  2NVX K;  3GTQ C;  2NVQ C;  1TWA C;  4X6A K;  4YG2 A;  4NOI A;  5C4J K;  4A3E C;  3S1R C;  4BXX C;  3HKZ D;  4XLP A;  2O5I A;  2CW0 A;  1R9T C;  4KN7 A;  4BBS K;  2VUM K;  2NVT C;  3S1M C;  4GZY A;  4A3B C;  1I6H C;  3K7A K;  4QJV B;  5C4X K;  1I50 K;  2YU9 K;  2PA8 L;  1TWH C;  2WB1 D;  3FKI K;  4YFK A;  3HOZ C;  2PA8 D;  4LLG A;  1I6V A;  2NVY K;  3S2H K;  5D4D A;  5C4J C;  4A3E K;  4A3D K;  5C44 C;  4BXX K;  3HOX K;  2R7Z C;  1TWG K;  2R92 C;  1I3Q K;  5FJ8 K;  3GTG K;  2JA7 K;  4OIP A;  4A3B K;  3RZD C;  2A6H A;  5IYB K;  1Y1V K;  4Y7N K;  3S1Q K;  3WOD A;  4KMU A;  3HOU C;  2NVX C;  1SFO C;  2NVQ K;  3I4M C;  4KN4 A;  4YFN A;  3RZO K;  3HKZ L;  4QIW L;  3S17 C;  1Y1W K;  5C44 K;  3M4O K;  4OIR A;  2JA6 C;  1TWG C;  4XSX A;  5FLM C;  3GTM C;  1I3Q C;  3GTP C;  3PO3 C;  4BBS C;  4JK1 A;  2JA5 K;  4C3I K;  3GTL C;  4A3J C;  4A3C C;  1I50 C;  4LK0 A;  4AYB D;  3PO2 C;  2JA8 K;  1TWH K;  1K83 C;  3GTQ K;  3S14 C;  4LJZ A;  3CQZ K;  2R93 C;  4A3F C;  4A93 C;  1SMY A;  1HQM A;  3HOY C;  2WAQ D;  3S17 K;  3HOX C;  1R9T K;  3I4N C;  5FLM K;  3PO3 K;  2NVT K;  3S1M K;  2A68 A;  1ZYR A;  2E2H K;  5M5Y K; 
#chains in the Genus database with same CATH topology
 3S1Q C;  4GFQ A;  3GTK K;  4KM8 A;  1WSV A;  3HOV C;  2B63 K;  5M5X K;  4LQY A;  1TWA A;  2R92 K;  4G7Z A;  4A3M K;  3GTJ K;  1R9T A;  1BS2 A;  3M3Y C;  4ZH4 A;  5TMF A;  3H0G A;  4G7H A;  1WQG A;  4BY7 K;  4KMA A;  5C3E C;  1USO A;  1I3Q A;  2PPB A;  4C3J C;  4G0V A;  5IYC C;  3S16 C;  1F7V A;  1YX2 A;  2JA6 K;  5EGH A;  2ZUE A;  2FQT A;  1XXA A;  3RZD K;  4P5A A;  3GTL K;  5JFE A;  1F7U A;  5IP9 C;  3CQZ A;  1WIH A;  1TWA K;  1PJ5 A;  3DXJ A;  2R92 A;  4X6A C;  2Y0S D;  1DD5 A;  1IW7 A;  3GSI A;  4A3M C;  2E2J K;  1TWF K;  2RH6 A;  1IS1 A;  1IL2 A;  1O26 A;  1UV7 A;  5E68 A;  3S0X A;  2YU9 C;  5IYD C;  4Y52 K;  3GTK C;  2V6U A;  5IP7 K;  4C3J K;  3S2H C;  2JA6 A;  3AD7 C;  3ADA C;  3OEP A;  2WAQ L;  2BE5 A;  4Q5S A;  5M3F K;  2JH3 A;  4BY1 C;  2NVX A;  1B4B A;  1EK8 A;  1WQF A;  4KAW X;  5IYD K;  2JA7 A;  4Y7N C;  1AB4 A;  4A3E C;  3T00 A;  2CFA B;  3GEE A;  3HKZ D;  4BBS K;  2VUM K;  3S1M C;  4GZY A;  4A3B C;  4QJV B;  1JVI A;  2CFA A;  2YU9 K;  2PA8 L;  3FKI K;  3A8I A;  3HOZ C;  3VA7 A;  2NVY K;  1TWC A;  4J3N A;  5C4J C;  1TWG K;  3AQP A;  1DCP A;  2JA7 K;  4C3H C;  4KC6 A;  3GIR A;  2VUM A;  1WOS A;  4KMU A;  3HOU C;  4DDQ A;  3RZO K;  4G0U A;  1EI6 A;  3HKZ L;  5C44 K;  2NVY A;  1TWG C;  3GTO A;  5IOQ A;  3GTP C;  5HL8 A;  3FKI A;  4C3I K;  1TWG A;  5IOR A;  1I50 C;  4LK0 A;  4GTF A;  3TFI A;  3S14 C;  4A93 C;  2WAQ D;  1ZQ1 C;  4RMF A;  3RZD C;  5M5Y K;  1PJ7 A;  3HOU K;  3NUH A;  4QJV A;  3I4M K;  2A69 A;  3EQL A;  2Y0S L;  1YNJ A;  2R7Z A;  2B63 C;  1I50 A;  4A93 K;  3H0G K;  4OIQ A;  4C2M K;  4YFX A;  5TMC A;  2E2J C;  4GTE A;  4GTD A;  3I4N K;  5IOS A;  4KAS A;  3L4J A;  4OIN A;  1WOR A;  5IYC K;  1O25 A;  4P9S A;  4MQ9 A;  2R7Z K;  1VRQ C;  3T02 A;  4A3K K;  1BDF A;  3M3Y K;  3K7A C;  1TWC C;  4A3L K;  4C45 A;  3AD8 C;  3ORE A;  3RZO C;  2V6T A;  1TWF C;  3JST A;  1PJ6 A;  4C3H K;  5IYB C;  4BY7 C;  3AH5 A;  2JA5 A;  1XZP B;  1L0W A;  2NVX K;  5C4J K;  3S1R C;  4BXX C;  2O5I A;  1J6X A;  2CW0 A;  1R9T C;  4GTA A;  1ZBS A;  1Y1V A;  5CJ9 A;  1I6H C;  5C4X K;  4KB4 A;  3G4A A;  4YFK A;  2PA8 D;  3V4G A;  4LLG A;  2ZFZ A;  3GTK A;  4A3E K;  4A3D K;  4LOW A;  2R7Z C;  3SZY A;  2E2I A;  5FJ8 K;  4M1X A;  5TJ3 A;  4OIP A;  1DCO A;  1Y1V K;  4Y7N K;  3IPJ A;  3WOD A;  1IQ0 A;  1O29 A;  1TWF A;  2NVQ K;  4KN4 A;  4YFN A;  1VLO A;  1Y1W K;  4C2M C;  3GEH A;  4KAT A;  4BBS C;  4JK1 A;  3AQO A;  1RU0 A;  1XZQ A;  1K83 C;  3Q3Q A;  4LJZ A;  3CQZ K;  3FOE A;  3HOY C;  1HQM A;  1V5V A;  5FLM K;  3A8J A;  2NVT K;  3A8K A;  3S15 C;  5M3M K;  4A3I K;  1Y1V C;  4OIO A;  3GTP A;  3GTO C;  1O2A A;  3S16 K;  4XLN A;  2YU9 A;  2B63 A;  4BLB A;  1K83 A;  5M5W K;  2JA5 C;  3TTG A;  4XSZ A;  3S1N K;  5IP7 C;  3CQZ C;  2D6F C;  3LAJ A;  4A3G K;  4A3I C;  4BLA A;  1WQH A;  2GSN A;  3BP8 C;  4A3L C;  4GTB A;  3GTO K;  3HOW K;  3S14 K;  4WJ4 A;  1SFO A;  2R93 K;  4BBR C;  4FM9 A;  2PMZ L;  3H0G C;  2P8T A;  2GSO A;  4MEY A;  2RGR A;  2WB1 L;  1O2F B;  3FKI C;  5C3E K;  3HOV K;  2NVY C;  4G7O A;  2GAG C;  3S1R K;  4BBR K;  1VH2 A;  3FOF A;  3GTJ A;  3TFH A;  3T01 A;  1I6H K;  4C3I C;  1IE0 A;  1WSR A;  4A3G C;  3QX3 A;  5JVO A;  2R93 A;  3S2D C;  5EGE A;  4KB2 A;  2XCQ A;  3GTQ C;  4NOI A;  1BGW A;  1DCH A;  1EH1 A;  4XLP A;  3GTL A;  3LAP A;  1GE9 A;  2NVT C;  3K7A K;  1I50 K;  2FQO A;  4GTC A;  1TWH C;  1JQW A;  1WOO A;  3FHZ A;  3S2H K;  5D4D A;  1KQ4 A;  5C44 C;  4BXX K;  3HOX K;  1I3Q K;  3G4C A;  4A3B K;  4PAB A;  2A6H A;  5IYB K;  1XZQ B;  2V6S A;  2NVX C;  3I4M C;  1J6V A;  5L46 A;  3M4O K;  2JA6 C;  2E2H A;  3PO3 C;  4A3J C;  4A3C C;  1TWH K;  1ZXO A;  2GSU A;  4A3F C;  3AD9 C;  3S17 K;  3N0C A;  4P5B A;  3HOX C;  4FZB A;  3PO3 K;  4WJ3 M;  1JOE A;  2A68 A;  3GTG A;  2E2H K;  1ISE A;  1O28 A;  1EQR A;  1WCM C;  3HOZ K;  1TWC K;  1J6W A;  1USM A;  2ZUF A;  4A3D C;  1TWH A;  2A6E A;  4LR2 A;  5CHP A;  2PMZ D;  3HOY K;  4MEX A;  4G0W A;  1Y1W C;  3CAG A;  3H3V L;  4A3K C;  2O5J A;  2JA7 C;  2W7V A;  4KM9 A;  4Q4Z A;  1G51 A;  4KDD A;  4Y52 C;  3TFJ A;  2JA8 C;  4PAA A;  4AYB L;  3PO2 K;  1VJE A;  1K83 K;  3GTQ A;  1ZVU A;  4KAR A;  1INN A;  4LK1 A;  4A3F K;  3GTM K;  4BY1 K;  4QIW D;  3H3V D;  3L4K A;  1WOP A;  2VUM C;  1B4A A;  3BP3 A;  4XCH A;  3GTJ C;  4A3J K;  2E2H C;  4A3C K;  1WCM K;  3S2D K;  3N0B A;  4AH6 A;  2XCO A;  3S15 K;  2E2I K;  1XPP A;  2P5M A;  5C4X C;  4BKW A;  3S1N C;  4KMD A;  1YNN A;  1SFO K;  3GTM A;  2PHC B;  1XXC A;  1WCM A;  4KMH A;  1C0A A;  3M4O C;  1O2B A;  3GTG C;  3GTP K;  1VGX A;  2XCR B;  1J98 A;  3GDZ A;  1IBA A;  5IP9 K;  2GAH C;  3HOW C;  2NVQ C;  1TWA C;  4X6A K;  4YG2 A;  1EFW A;  3HXA A;  4ILD A;  4KN7 A;  1XZP A;  1O24 A;  1BJT A;  1YCL A;  2WB1 D;  1I6V A;  2EBB A;  1X31 C;  2R92 C;  1F9N A;  3GTG K;  3SZZ A;  1O27 A;  3MML B;  3S1Q K;  3LPX A;  3BUE A;  1SFO C;  4WIL A;  1Y1W A;  3OPF A;  4GT9 A;  4GTL A;  3ERE D;  3N3Y A;  4QIW L;  3S17 C;  4OIR A;  3GTM C;  4XSX A;  5FLM C;  1I3Q C;  1F93 A;  1HI9 A;  2JA5 K;  3GTL C;  3GEI A;  2Y3P A;  4AYB D;  3PO2 C;  2JA8 K;  5IOT A;  3GTQ K;  2R93 C;  1SMY A;  1R9T K;  2KWA A;  3I4N C;  1XXB A;  3S1M K;  4O2D A;  1ZYR A;  2E2I C; 
#chains in the Genus database with same CATH homology
 5M3M K;  4A3I K;  3S1Q C;  1WCM C;  1Y1V C;  3HOZ K;  4OIO A;  1TWC K;  3GTK K;  3HOU K;  3GTO C;  3HOV C;  4QJV A;  2B63 K;  3I4M K;  3S16 K;  4A3D C;  2A6E A;  5M5X K;  2PMZ D;  3HOY K;  4XLN A;  4MEX A;  2R92 K;  1Y1W C;  3H3V L;  2A69 A;  4G7Z A;  4A3M K;  4A3K C;  5M5W K;  2O5J A;  3EQL A;  2JA7 C;  3GTJ K;  2JA5 C;  3M3Y C;  4Q4Z A;  4ZH4 A;  5TMF A;  4Y52 C;  4G7H A;  2JA8 C;  4XSZ A;  4AYB L;  3PO2 K;  4BY7 K;  3S1N K;  5C3E C;  5IP7 C;  2PPB A;  1K83 K;  2Y0S L;  1YNJ A;  3CQZ C;  2B63 C;  5IYC C;  4LK1 A;  3S16 C;  4A3F K;  3H0G K;  4A93 K;  4OIQ A;  4C2M K;  4YFX A;  5TMC A;  2E2J C;  4BY1 K;  4QIW D;  2JA6 K;  3H3V D;  3GTM K;  3RZD K;  2VUM C;  3GTL K;  3I4N K;  3S15 C;  3GTJ C;  2E2H C;  4A3J K;  4A3C K;  4A3I C;  4A3G K;  5IP9 C;  4OIN A;  1WCM K;  4A3L C;  3GTO K;  3HOW K;  3S14 K;  3S2D K;  1TWA K;  3DXJ A;  4X6A C;  2R93 K;  4BBR C;  5IYC K;  2Y0S D;  2PMZ L;  3H0G C;  1IW7 A;  4MQ9 A;  4A3K K;  4A3M C;  1TWF K;  2E2J K;  2R7Z K;  3S15 K;  2E2I K;  1BDF A;  1XPP A;  3M3Y K;  4MEY A;  3K7A C;  2YU9 C;  5C4X C;  5IYD C;  2WB1 L;  3FKI C;  4Y52 K;  3S1N C;  1TWC C;  3GTK C;  5IP7 K;  4A3L K;  5C3E K;  3HOV K;  1YNN A;  4C3J K;  1SFO K;  2NVY C;  3S2H C;  4G7O A;  3S1R K;  3RZO C;  4BBR K;  2WAQ L;  2BE5 A;  4Q5S A;  5M3F K;  3M4O C;  4BY1 C;  1TWF C;  3GTG C;  3GTP K;  2E2I C;  1I6H K;  4C3H K;  4A3G C;  5IYB C;  4BY7 C;  5IYD K;  5IP9 K;  4Y7N C;  3HOW C;  3S2D C;  2NVX K;  3GTQ C;  2NVQ C;  1TWA C;  4X6A K;  4YG2 A;  4NOI A;  5C4J K;  4A3E C;  3S1R C;  4BXX C;  3HKZ D;  4XLP A;  2O5I A;  2CW0 A;  1R9T C;  4KN7 A;  4BBS K;  2VUM K;  2NVT C;  3S1M C;  4GZY A;  4A3B C;  1I6H C;  3K7A K;  4QJV B;  5C4X K;  1I50 K;  2YU9 K;  2PA8 L;  1TWH C;  2WB1 D;  3FKI K;  4YFK A;  3HOZ C;  2PA8 D;  4LLG A;  1I6V A;  2NVY K;  3S2H K;  5D4D A;  5C4J C;  4A3E K;  4A3D K;  5C44 C;  4BXX K;  3HOX K;  2R7Z C;  1TWG K;  2R92 C;  1I3Q K;  5FJ8 K;  3GTG K;  2JA7 K;  4OIP A;  4A3B K;  3RZD C;  2A6H A;  5IYB K;  1Y1V K;  4Y7N K;  3S1Q K;  3WOD A;  4KMU A;  3HOU C;  2NVX C;  1SFO C;  2NVQ K;  3I4M C;  4KN4 A;  4YFN A;  3RZO K;  3HKZ L;  4QIW L;  3S17 C;  1Y1W K;  5C44 K;  3M4O K;  4OIR A;  2JA6 C;  1TWG C;  4XSX A;  5FLM C;  3GTM C;  1I3Q C;  3GTP C;  3PO3 C;  4BBS C;  4JK1 A;  2JA5 K;  4C3I K;  3GTL C;  4A3J C;  4A3C C;  1I50 C;  4LK0 A;  4AYB D;  3PO2 C;  2JA8 K;  1TWH K;  1K83 C;  3GTQ K;  3S14 C;  4LJZ A;  3CQZ K;  2R93 C;  4A3F C;  4A93 C;  1SMY A;  1HQM A;  3HOY C;  2WAQ D;  3S17 K;  3HOX C;  1R9T K;  3I4N C;  5FLM K;  3PO3 K;  2NVT K;  3S1M K;  2A68 A;  1ZYR A;  2E2H K;  5M5Y K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...