3S16K

Rna polymerase ii initiation complex with an 8-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s16K00
3GTJC 2NVXK 1I3QC 3GTOC 3HOUC 3M4OC 3HOXK 4XLNA 4A3DC 5M3FK 1TWFK 4Y7NK 1IW7A 4LK0A 2E2JK 3GTPC 3GTJK 4X6AK 5C4XC 3HOUK 2Y0SD 1BDFA 2NVQC 2JA7K 3K7AK 1TWCC 5M3MK 3S1QC 2B63C 3GTLC 5IYBC 3S2DK 2A68A 2R7ZK 3WODA 3PO3K 2BE5A 3GTGC 2NVQK 2A6HA 2YU9C 3I4MC 3GTKC 1I50C 3HOWC 4BBRC 5IP9K 2JA8K 4QJVB 3H0GC 4QJVA 3RZOK 1I6HC 2E2IC 4JK1A 3I4MK 4A93C 1WCMK 5M5XK 3GTKK 1I50K 4BBRK 2PA8L 4A3BC 1Y1VK 3PO2K 4MEXA 4Y52K 2E2IK 3FKIK 1TWHC 4OIOA 3S16C 3CQZK 5C4JC 3S17K 5FLMK 2A69A 4BXXC 5C3EK 5M5YK 1R9TK 3HOVC 3S15C 1TWHK 3S16K 4NOIA 2CW0A 3S1RC 5C44C 5C4JK 2R92K 4BBSK 4BXXK 5IYCC 5IP7C 1I3QK 4G7ZA 3GTOK 3M4OK 4KMUA 4C3HK 2JA5C 4A3DK 4A3EC 4YG2A 1SFOC 4KN7A 4OINA 3I4NC 4C3JK 3GTPK 5C4XK 2O5IA 4A3GC 2R93C 3S1QK 4A3LC 1TWCK 1K83C 1Y1WC 4A3EK 4A3KC 1SFOK 2B63K 5IYBK 3GTLK 3I4NK 3GTGK 2YU9K 4A3KK 4A3MC 3HOWK 2PA8D 3RZDC 4KN4A 3H0GK 5TMFA 1I6HK 4AYBD 4AYBL 2VUMC 4GZYA 5D4DA 4A93K 4A3MK 3S2HC 4A3BK 3RZDK 4A3CC 5TMCA 5M5WK 2NVYC 1TWGC 4A3FC 3GTQC 2O5JA 2E2HC 3HOVK 3S15K 4BY7C 4A3FK 3S1RK 5C44K 5IYDC 3GTQK 3M3YC 3DXJA 2PPBA 5IYCK 4MQ9A 4XSZA 5IP7K 4A3JC 2JA5K 4Q5SA 3HKZL 1YNJA 5IYDK 4A3IC 2NVXC 4A3JK 1TWAC 4A3GK 4C2MK 2R93K 3HOXC 2NVTC 4A3LK 1K83K 1Y1WK 3S14C 1TWFC 4Y7NC 2E2JC 4MEYA 4C3IK 4OIPA 4XLPA 1TWAK 4Q4ZA 2JA7C 3K7AC 2NVTK 3S14K 1XPPA 4LJZA 1ZYRA 4LK1A 2R7ZC 3HOZC 3S1NC 3PO3C 3S2DC 1YNNA 2VUMK 2Y0SL 4BY1C 3HOYC 4QIWD 4QIWL 4OIRA 2WAQD 2WAQL 2PMZL 2PMZD 4XSXA 5IP9C 2JA8C 3HOZK 3S1NK 3S2HK 3RZOC 4G7HA 4LLGA 4A3CK 3S1MC 3EQLA 3H3VL 3H3VD 1SMYA 2NVYK 1TWGK 4BY1K 1WCMC 3GTMC 3HOYK 5FJ8K 4ZH4A 1Y1VC 3PO2C 4OIQA 3S1MK 4Y52C 2E2HK 4G7OA 3FKIC 2A6EA 3HKZD 3GTMK 4BY7K 4YFNA 2JA6C 3CQZC 4YFXA 3M3YK 3S17C 5FLMC 1HQMA 5C3EC 1R9TC 2WB1D 2WB1L 4YFKA 2JA6K 2R92C 4X6AC 4BBSC 1I6VA 4A3IK
chains in the Genus database with same CATH superfamily
3GTJC 1ZBSA 4Y7NK 4C3JC 4BLBA 3S1QC 2JA7K 5M3MK 1IBAA 3BP3A 1AB4A 5IYBC 4M1XA 3AQPA 3PO3K 2A6HA 2YU9C 3I4MC 3HOWC 4KMAA 1O27A 1ZVUA 4A93C 1TWAA 1I50K 4A3BC 1TWHC 1WORA 3S17K 2JA7A 4LOWA 1DCPA 4BBSK 5IYCC 1INNA 4KMDA 2V6SA 4C3JK 3GDZA 1I50A 4C2MC 2R93C 3S1QK 3I4NK 5IYBK 4C3IC 5CHPA 2YU9K 1IE0A 4WJ4A 4A3KK 3HOWK 3RZDC 4KN4A 3TFHA 5TMFA 4AYBD 3GTJA 4A93K 1WOOA 1ZXOA 4A3BK 4GTFA 3TFIA 2GSUA 3FOEA 3LAPA 3GTQC 1JVIA 2O5JA 2E2HC 2YU9A 2JH3A 2PPBA 5IYCK 1F9NA 1YNJA 4G0UA 5IYDK 4C2MK 2R93K 2NVTC 3S14C 4BKWA 2E2JC 1TWHA 1O25A 4C3IK 4XLPA 1G51A 1XPPA 3GEIA 3S1NC 1YCLA 1XXCA 5TJ3A 2D6FC 3HOYC 4OIRA 4QIWL 2WAQL 4XSXA 3HOZK 3VA7A 3CAGA 1HI9A 3RZOC 3EQLA 3H3VL 1WCMC 1XZQB 1WOSA 1XZQA 5IOTA 2R93A 1VRQC 2E2HK 2PHCB 3GTMK 1WQGA 2KWAA 4LQYA 2GAHC 2R92C 4BXXC 1I3QC 3G4AA 4KDDA 1XXAA 1IW7A 4GT9A 2CFAB 4KMHA 2CFAA 2E2JK 1C0AA 5C4XC 5E68A 3AH5A 2E2HA 4PABA 1UV7A 3WODA 1I50C 2GAGC 4QJVB 3H0GC 4QJVA 3RZOK 1I6HC 4JK1A 3AD9C 3ERED 1WCMK 1WQHA 5M5XK 3LAJA 4KM9A 4BBRK 2PA8L 1WQFA 4MEXA 2ZUFA 2E2IK 4OIOA 1O26A 2A69A 5M5YK 2ZFZA 4P9SA 3HOVC 1EQRA 3S16K 4NOIA 3N0BA 2R92K 5C44C 5C4JK 4BXXK 4GTLA 4KASA 5IP7C 1I3QK 4BLAA 2JA5C 3I4NC 1WCMA 5C4XK 2O5IA 1RU0A 4A3GC 4A3KC 1J6XA 5EGEA 1ISEA 1XXBA 3Q3QA 3N0CA 2PA8D 3NUHA 3H0GK 4KARA 2R92A 1I6HK 2VUMC 4AYBL 5D4DA 1GE9A 1I3QA 4A3MK 3L4JA 4PAAA 1PJ7A 3TTGA 3BP8C 3HOVK 1O28A 4LR2A 3AD8C 3GEEA 3SZZA 4O2DA 1O24A 1BGWA 5C44K 5L46A 5IYDC 3DXJA 4XSZA 5IP7K 3H0GA 2JA5K 4Q5SA 1L0WA 3A8IA 3T02A 4A3GK 4FZBA 4GTCA 1TWFC 5IOQA 1VJEA 3K7AC 1ZYRA 3HOZC 2VUMK 2Y0SL 3AD7C 2PMZD 1F7UA 5IP9C 2JA5A 2JA8C 5EGHA 2ZUEA 3GTMC 1JQWA 3AQOA 1WOPA 1KQ4A 3PO2C 3S1MK 2Y3PA 3FKIC 3N3YA 5HL8A 1DCHA 1HQMA 5C3EC 4AH6A 1J6WA 2FQOA 2W7VA 4G0WA 1IQ0A 2JA6K 2VUMA 3GTOC 3M4OC 4C3HC 5IOSA 4XLNA 4RMFA 1TWFK 5M3FK 3HOUK 2Y0SD 1BDFA 3LPXA 3QX3A 3K7AK 1TWCC 3GTLC 2A68A 1F93A 2P5MA 2BE5A 3GTGC 1WSVA 2NVQK 4BBRC 5IP9K 2JA8K 2E2IC 3GEHA 3GTKK 3PO2K 1TWFA 1BS2A 3FKIK 2RH6A 4GFQA 3S16C 5C4JC 2EBBA 5C3EK 4G0VA 3S15C 1JOEA 1O29A 2XCRB 3T00A 4G7ZA 3GTOK 3M4OK 4KB4A 1WSRA 4C3HK 4KN7A 3GTMA 1EK8A 3BUEA 4A3LC 1TWCK 1K83C 1Y1WC 4A3EK 3GTLK 1SFOK 3FKIA 3GSIA 3GTGK 4A3MC 3TFJA 3V4GA 3GTOA 4KB2A 1BJTA 4A3CC 5TMCA 2NVYC 1TWGC 1TWCA 2V6TA 3GTLA 3S15K 4BY7C 3GTGA 4A3FK 4KM8A 4MQ9A 2E2IA 4A3IC 2NVXC 4A3JK 3ADAC 3HOXC 4A3LK 1K83K 1Y1WK 1B4BA 1TWAK 3L4KA 1J98A 2XCQA 4LJZA 3S2DC 4LK1A 2R7ZC 4WJ3M 2RGRA 4GTAA 1XZPB 1XZPA 4KATA 2PMZL 1IS1A 5JFEA 3A8KA 3S1MC 4A3CK 4G7HA 4LLGA 3HXAA 2NVYK 1TWGK 4WILA 4BY1K 5FJ8K 1Y1VC 1K83A 4OIQA 1Y1WA 4Y52C 4P5AA 4BY7K 2GSOA 4YFNA 3CQZC 4YFXA 2JA6C 5FLMC 1R9TC 2WB1D 1EI6A 1I6VA 3FHZA 4A3IK 2NVXK 1DCOA 3HOUC 3HOXK 4P5BA 3FOFA 4J3NA 4A3DC 4ILDA 2NVYA 1TWGA 4LK0A 3GTPC 3GTJK 1V5VA 4X6AK 1O2AA 2FQTA 1O2FB 2NVQC 1USMA 2B63C 4FM9A 3S2DK 2R7ZK 1ZQ1C 1B4AA 1EFWA 3SZYA 3GTKC 3OREA 1J6VA 3IPJA 3I4MK 2NVXA 1Y1VK 4Y52K 2XCOA 1VGXA 3CQZK 1VH2A 5FLMK 3A8JA 5CJ9A 1R9TK 2R7ZA 1O2BA 1TWHK 2CW0A 3S1RC 3T01A 4KMUA 4A3DK 4A3EC 4YG2A 1SFOC 4OINA 3GTPK 1Y1VA 4DDQA 2B63K 3OPFA 2JA6A 2V6UA 3CQZA 2GSNA 1R9TA 1IL2A 1X31C 4C45A 4GZYA 1PJ5A 3GIRA 3JSTA 3RZDK 3S2HC 5M5WK 3GTPA 1YX2A 4A3FC 5IORA 4GTEA 2B63A 3S1RK 3GTQK 3M3YC 5JVOA 3GTKA 4A3JC 1USOA 3HKZL 1F7VA 4XCHA 1TWAC 4GTBA 4KAWX 1WIHA 4Y7NC 4MEYA 4OIPA 1VLOA 1DD5A 4Q4ZA 2JA7C 2NVTK 3S14K 3PO3C 3GTQA 1YNNA 4GTDA 4BY1C 4QIWD 2WAQD 3S1NK 3S2HK 2P8TA 3G4CA 1SFOA 3H3VD 1SMYA 3HOYK 1PJ6A 4ZH4A 4G7OA 2A6EA 3HKZD 3M3YK 1EH1A 3S17C 4YFKA 2WB1L 3S0XA 4KC6A 3MMLB 3OEPA 4X6AC 4BBSC
chains in the Genus database with same CATH topology
3GTJC 2NVXK 1I3QC 3GTOC 3HOUC 3M4OC 3HOXK 4XLNA 4A3DC 5M3FK 1TWFK 4Y7NK 1IW7A 4LK0A 2E2JK 3GTPC 3GTJK 4X6AK 5C4XC 3HOUK 2Y0SD 1BDFA 2NVQC 2JA7K 3K7AK 1TWCC 5M3MK 3S1QC 2B63C 3GTLC 5IYBC 3S2DK 2A68A 2R7ZK 3WODA 3PO3K 2BE5A 3GTGC 2NVQK 2A6HA 2YU9C 3I4MC 3GTKC 1I50C 3HOWC 4BBRC 5IP9K 2JA8K 4QJVB 3H0GC 4QJVA 3RZOK 1I6HC 2E2IC 4JK1A 3I4MK 4A93C 1WCMK 5M5XK 3GTKK 1I50K 4BBRK 2PA8L 4A3BC 1Y1VK 3PO2K 4MEXA 4Y52K 2E2IK 3FKIK 1TWHC 4OIOA 3S16C 3CQZK 5C4JC 3S17K 5FLMK 2A69A 4BXXC 5C3EK 5M5YK 1R9TK 3HOVC 3S15C 1TWHK 3S16K 4NOIA 2CW0A 3S1RC 5C44C 5C4JK 2R92K 4BBSK 4BXXK 5IYCC 5IP7C 1I3QK 4G7ZA 3GTOK 3M4OK 4KMUA 4C3HK 2JA5C 4A3DK 4A3EC 4YG2A 1SFOC 4KN7A 4OINA 3I4NC 4C3JK 3GTPK 5C4XK 2O5IA 4A3GC 2R93C 3S1QK 4A3LC 1TWCK 1K83C 1Y1WC 4A3EK 4A3KC 1SFOK 2B63K 5IYBK 3GTLK 3I4NK 3GTGK 2YU9K 4A3KK 4A3MC 3HOWK 2PA8D 3RZDC 4KN4A 3H0GK 5TMFA 1I6HK 4AYBD 4AYBL 2VUMC 4GZYA 5D4DA 4A93K 4A3MK 3S2HC 4A3BK 3RZDK 4A3CC 5TMCA 5M5WK 2NVYC 1TWGC 4A3FC 3GTQC 2O5JA 2E2HC 3HOVK 3S15K 4BY7C 4A3FK 3S1RK 5C44K 5IYDC 3GTQK 3M3YC 3DXJA 2PPBA 5IYCK 4MQ9A 4XSZA 5IP7K 4A3JC 2JA5K 4Q5SA 3HKZL 1YNJA 5IYDK 4A3IC 2NVXC 4A3JK 1TWAC 4A3GK 4C2MK 2R93K 3HOXC 2NVTC 4A3LK 1K83K 1Y1WK 3S14C 1TWFC 4Y7NC 2E2JC 4MEYA 4C3IK 4OIPA 4XLPA 1TWAK 4Q4ZA 2JA7C 3K7AC 2NVTK 3S14K 1XPPA 4LJZA 1ZYRA 4LK1A 2R7ZC 3HOZC 3S1NC 3PO3C 3S2DC 1YNNA 2VUMK 2Y0SL 4BY1C 3HOYC 4QIWD 4QIWL 4OIRA 2WAQD 2WAQL 2PMZL 2PMZD 4XSXA 5IP9C 2JA8C 3HOZK 3S1NK 3S2HK 3RZOC 4G7HA 4LLGA 4A3CK 3S1MC 3EQLA 3H3VL 3H3VD 1SMYA 2NVYK 1TWGK 4BY1K 1WCMC 3GTMC 3HOYK 5FJ8K 4ZH4A 1Y1VC 3PO2C 4OIQA 3S1MK 4Y52C 2E2HK 4G7OA 3FKIC 2A6EA 3HKZD 3GTMK 4BY7K 4YFNA 2JA6C 3CQZC 4YFXA 3M3YK 3S17C 5FLMC 1HQMA 5C3EC 1R9TC 2WB1D 2WB1L 4YFKA 2JA6K 2R92C 4X6AC 4BBSC 1I6VA 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ C;  2NVX K;  1I3Q C;  3GTO C;  3HOU C;  3M4O C;  3HOX K;  4XLN A;  4A3D C;  5M3F K;  1TWF K;  4Y7N K;  1IW7 A;  4LK0 A;  2E2J K;  3GTP C;  3GTJ K;  4X6A K;  5C4X C;  3HOU K;  2Y0S D;  1BDF A;  2NVQ C;  2JA7 K;  3K7A K;  1TWC C;  5M3M K;  3S1Q C;  2B63 C;  3GTL C;  5IYB C;  3S2D K;  2A68 A;  2R7Z K;  3WOD A;  3PO3 K;  2BE5 A;  3GTG C;  2NVQ K;  2A6H A;  2YU9 C;  3I4M C;  3GTK C;  1I50 C;  3HOW C;  4BBR C;  5IP9 K;  2JA8 K;  4QJV B;  3H0G C;  4QJV A;  3RZO K;  1I6H C;  2E2I C;  4JK1 A;  3I4M K;  4A93 C;  1WCM K;  5M5X K;  3GTK K;  1I50 K;  4BBR K;  2PA8 L;  4A3B C;  1Y1V K;  3PO2 K;  4MEX A;  4Y52 K;  2E2I K;  3FKI K;  1TWH C;  4OIO A;  3S16 C;  3CQZ K;  5C4J C;  3S17 K;  5FLM K;  2A69 A;  4BXX C;  5C3E K;  5M5Y K;  1R9T K;  3HOV C;  3S15 C;  1TWH K;  3S16 K;  4NOI A;  2CW0 A;  3S1R C;  5C44 C;  5C4J K;  2R92 K;  4BBS K;  4BXX K;  5IYC C;  5IP7 C;  1I3Q K;  4G7Z A;  3GTO K;  3M4O K;  4KMU A;  4C3H K;  2JA5 C;  4A3D K;  4A3E C;  4YG2 A;  1SFO C;  4KN7 A;  4OIN A;  3I4N C;  4C3J K;  3GTP K;  5C4X K;  2O5I A;  4A3G C;  2R93 C;  3S1Q K;  4A3L C;  1TWC K;  1K83 C;  1Y1W C;  4A3E K;  4A3K C;  1SFO K;  2B63 K;  5IYB K;  3GTL K;  3I4N K;  3GTG K;  2YU9 K;  4A3K K;  4A3M C;  3HOW K;  2PA8 D;  3RZD C;  4KN4 A;  3H0G K;  5TMF A;  1I6H K;  4AYB D;  4AYB L;  2VUM C;  4GZY A;  5D4D A;  4A93 K;  4A3M K;  3S2H C;  4A3B K;  3RZD K;  4A3C C;  5TMC A;  5M5W K;  2NVY C;  1TWG C;  4A3F C;  3GTQ C;  2O5J A;  2E2H C;  3HOV K;  3S15 K;  4BY7 C;  4A3F K;  3S1R K;  5C44 K;  5IYD C;  3GTQ K;  3M3Y C;  3DXJ A;  2PPB A;  5IYC K;  4MQ9 A;  4XSZ A;  5IP7 K;  4A3J C;  2JA5 K;  4Q5S A;  3HKZ L;  1YNJ A;  5IYD K;  4A3I C;  2NVX C;  4A3J K;  1TWA C;  4A3G K;  4C2M K;  2R93 K;  3HOX C;  2NVT C;  4A3L K;  1K83 K;  1Y1W K;  3S14 C;  1TWF C;  4Y7N C;  2E2J C;  4MEY A;  4C3I K;  4OIP A;  4XLP A;  1TWA K;  4Q4Z A;  2JA7 C;  3K7A C;  2NVT K;  3S14 K;  1XPP A;  4LJZ A;  1ZYR A;  4LK1 A;  2R7Z C;  3HOZ C;  3S1N C;  3PO3 C;  3S2D C;  1YNN A;  2VUM K;  2Y0S L;  4BY1 C;  3HOY C;  4QIW D;  4QIW L;  4OIR A;  2WAQ D;  2WAQ L;  2PMZ L;  2PMZ D;  4XSX A;  5IP9 C;  2JA8 C;  3HOZ K;  3S1N K;  3S2H K;  3RZO C;  4G7H A;  4LLG A;  4A3C K;  3S1M C;  3EQL A;  3H3V L;  3H3V D;  1SMY A;  2NVY K;  1TWG K;  4BY1 K;  1WCM C;  3GTM C;  3HOY K;  5FJ8 K;  4ZH4 A;  1Y1V C;  3PO2 C;  4OIQ A;  3S1M K;  4Y52 C;  2E2H K;  4G7O A;  3FKI C;  2A6E A;  3HKZ D;  3GTM K;  4BY7 K;  4YFN A;  2JA6 C;  3CQZ C;  4YFX A;  3M3Y K;  3S17 C;  5FLM C;  1HQM A;  5C3E C;  1R9T C;  2WB1 D;  2WB1 L;  4YFK A;  2JA6 K;  2R92 C;  4X6A C;  4BBS C;  1I6V A;  4A3I K; 
#chains in the Genus database with same CATH topology
 3GTJ C;  1ZBS A;  4Y7N K;  4C3J C;  4BLB A;  3S1Q C;  2JA7 K;  5M3M K;  1IBA A;  3BP3 A;  1AB4 A;  5IYB C;  4M1X A;  3AQP A;  3PO3 K;  2A6H A;  2YU9 C;  3I4M C;  3HOW C;  4KMA A;  1O27 A;  1ZVU A;  4A93 C;  1TWA A;  1I50 K;  4A3B C;  1TWH C;  1WOR A;  3S17 K;  2JA7 A;  4LOW A;  1DCP A;  4BBS K;  5IYC C;  1INN A;  4KMD A;  2V6S A;  4C3J K;  3GDZ A;  1I50 A;  4C2M C;  2R93 C;  3S1Q K;  3I4N K;  5IYB K;  4C3I C;  5CHP A;  2YU9 K;  1IE0 A;  4WJ4 A;  4A3K K;  3HOW K;  3RZD C;  4KN4 A;  3TFH A;  5TMF A;  4AYB D;  3GTJ A;  4A93 K;  1WOO A;  1ZXO A;  4A3B K;  4GTF A;  3TFI A;  2GSU A;  3FOE A;  3LAP A;  3GTQ C;  1JVI A;  2O5J A;  2E2H C;  2YU9 A;  2JH3 A;  2PPB A;  5IYC K;  1F9N A;  1YNJ A;  4G0U A;  5IYD K;  4C2M K;  2R93 K;  2NVT C;  3S14 C;  4BKW A;  2E2J C;  1TWH A;  1O25 A;  4C3I K;  4XLP A;  1G51 A;  1XPP A;  3GEI A;  3S1N C;  1YCL A;  1XXC A;  5TJ3 A;  2D6F C;  3HOY C;  4OIR A;  4QIW L;  2WAQ L;  4XSX A;  3HOZ K;  3VA7 A;  3CAG A;  1HI9 A;  3RZO C;  3EQL A;  3H3V L;  1WCM C;  1XZQ B;  1WOS A;  1XZQ A;  5IOT A;  2R93 A;  1VRQ C;  2E2H K;  2PHC B;  3GTM K;  1WQG A;  2KWA A;  4LQY A;  2GAH C;  2R92 C;  4BXX C;  1I3Q C;  3G4A A;  4KDD A;  1XXA A;  1IW7 A;  4GT9 A;  2CFA B;  4KMH A;  2CFA A;  2E2J K;  1C0A A;  5C4X C;  5E68 A;  3AH5 A;  2E2H A;  4PAB A;  1UV7 A;  3WOD A;  1I50 C;  2GAG C;  4QJV B;  3H0G C;  4QJV A;  3RZO K;  1I6H C;  4JK1 A;  3AD9 C;  3ERE D;  1WCM K;  1WQH A;  5M5X K;  3LAJ A;  4KM9 A;  4BBR K;  2PA8 L;  1WQF A;  4MEX A;  2ZUF A;  2E2I K;  4OIO A;  1O26 A;  2A69 A;  5M5Y K;  2ZFZ A;  4P9S A;  3HOV C;  1EQR A;  3S16 K;  4NOI A;  3N0B A;  2R92 K;  5C44 C;  5C4J K;  4BXX K;  4GTL A;  4KAS A;  5IP7 C;  1I3Q K;  4BLA A;  2JA5 C;  3I4N C;  1WCM A;  5C4X K;  2O5I A;  1RU0 A;  4A3G C;  4A3K C;  1J6X A;  5EGE A;  1ISE A;  1XXB A;  3Q3Q A;  3N0C A;  2PA8 D;  3NUH A;  3H0G K;  4KAR A;  2R92 A;  1I6H K;  2VUM C;  4AYB L;  5D4D A;  1GE9 A;  1I3Q A;  4A3M K;  3L4J A;  4PAA A;  1PJ7 A;  3TTG A;  3BP8 C;  3HOV K;  1O28 A;  4LR2 A;  3AD8 C;  3GEE A;  3SZZ A;  4O2D A;  1O24 A;  1BGW A;  5C44 K;  5L46 A;  5IYD C;  3DXJ A;  4XSZ A;  5IP7 K;  3H0G A;  2JA5 K;  4Q5S A;  1L0W A;  3A8I A;  3T02 A;  4A3G K;  4FZB A;  4GTC A;  1TWF C;  5IOQ A;  1VJE A;  3K7A C;  1ZYR A;  3HOZ C;  2VUM K;  2Y0S L;  3AD7 C;  2PMZ D;  1F7U A;  5IP9 C;  2JA5 A;  2JA8 C;  5EGH A;  2ZUE A;  3GTM C;  1JQW A;  3AQO A;  1WOP A;  1KQ4 A;  3PO2 C;  3S1M K;  2Y3P A;  3FKI C;  3N3Y A;  5HL8 A;  1DCH A;  1HQM A;  5C3E C;  4AH6 A;  1J6W A;  2FQO A;  2W7V A;  4G0W A;  1IQ0 A;  2JA6 K;  2VUM A;  3GTO C;  3M4O C;  4C3H C;  5IOS A;  4XLN A;  4RMF A;  1TWF K;  5M3F K;  3HOU K;  2Y0S D;  1BDF A;  3LPX A;  3QX3 A;  3K7A K;  1TWC C;  3GTL C;  2A68 A;  1F93 A;  2P5M A;  2BE5 A;  3GTG C;  1WSV A;  2NVQ K;  4BBR C;  5IP9 K;  2JA8 K;  2E2I C;  3GEH A;  3GTK K;  3PO2 K;  1TWF A;  1BS2 A;  3FKI K;  2RH6 A;  4GFQ A;  3S16 C;  5C4J C;  2EBB A;  5C3E K;  4G0V A;  3S15 C;  1JOE A;  1O29 A;  2XCR B;  3T00 A;  4G7Z A;  3GTO K;  3M4O K;  4KB4 A;  1WSR A;  4C3H K;  4KN7 A;  3GTM A;  1EK8 A;  3BUE A;  4A3L C;  1TWC K;  1K83 C;  1Y1W C;  4A3E K;  3GTL K;  1SFO K;  3FKI A;  3GSI A;  3GTG K;  4A3M C;  3TFJ A;  3V4G A;  3GTO A;  4KB2 A;  1BJT A;  4A3C C;  5TMC A;  2NVY C;  1TWG C;  1TWC A;  2V6T A;  3GTL A;  3S15 K;  4BY7 C;  3GTG A;  4A3F K;  4KM8 A;  4MQ9 A;  2E2I A;  4A3I C;  2NVX C;  4A3J K;  3ADA C;  3HOX C;  4A3L K;  1K83 K;  1Y1W K;  1B4B A;  1TWA K;  3L4K A;  1J98 A;  2XCQ A;  4LJZ A;  3S2D C;  4LK1 A;  2R7Z C;  4WJ3 M;  2RGR A;  4GTA A;  1XZP B;  1XZP A;  4KAT A;  2PMZ L;  1IS1 A;  5JFE A;  3A8K A;  3S1M C;  4A3C K;  4G7H A;  4LLG A;  3HXA A;  2NVY K;  1TWG K;  4WIL A;  4BY1 K;  5FJ8 K;  1Y1V C;  1K83 A;  4OIQ A;  1Y1W A;  4Y52 C;  4P5A A;  4BY7 K;  2GSO A;  4YFN A;  3CQZ C;  4YFX A;  2JA6 C;  5FLM C;  1R9T C;  2WB1 D;  1EI6 A;  1I6V A;  3FHZ A;  4A3I K;  2NVX K;  1DCO A;  3HOU C;  3HOX K;  4P5B A;  3FOF A;  4J3N A;  4A3D C;  4ILD A;  2NVY A;  1TWG A;  4LK0 A;  3GTP C;  3GTJ K;  1V5V A;  4X6A K;  1O2A A;  2FQT A;  1O2F B;  2NVQ C;  1USM A;  2B63 C;  4FM9 A;  3S2D K;  2R7Z K;  1ZQ1 C;  1B4A A;  1EFW A;  3SZY A;  3GTK C;  3ORE A;  1J6V A;  3IPJ A;  3I4M K;  2NVX A;  1Y1V K;  4Y52 K;  2XCO A;  1VGX A;  3CQZ K;  1VH2 A;  5FLM K;  3A8J A;  5CJ9 A;  1R9T K;  2R7Z A;  1O2B A;  1TWH K;  2CW0 A;  3S1R C;  3T01 A;  4KMU A;  4A3D K;  4A3E C;  4YG2 A;  1SFO C;  4OIN A;  3GTP K;  1Y1V A;  4DDQ A;  2B63 K;  3OPF A;  2JA6 A;  2V6U A;  3CQZ A;  2GSN A;  1R9T A;  1IL2 A;  1X31 C;  4C45 A;  4GZY A;  1PJ5 A;  3GIR A;  3JST A;  3RZD K;  3S2H C;  5M5W K;  3GTP A;  1YX2 A;  4A3F C;  5IOR A;  4GTE A;  2B63 A;  3S1R K;  3GTQ K;  3M3Y C;  5JVO A;  3GTK A;  4A3J C;  1USO A;  3HKZ L;  1F7V A;  4XCH A;  1TWA C;  4GTB A;  4KAW X;  1WIH A;  4Y7N C;  4MEY A;  4OIP A;  1VLO A;  1DD5 A;  4Q4Z A;  2JA7 C;  2NVT K;  3S14 K;  3PO3 C;  3GTQ A;  1YNN A;  4GTD A;  4BY1 C;  4QIW D;  2WAQ D;  3S1N K;  3S2H K;  2P8T A;  3G4C A;  1SFO A;  3H3V D;  1SMY A;  3HOY K;  1PJ6 A;  4ZH4 A;  4G7O A;  2A6E A;  3HKZ D;  3M3Y K;  1EH1 A;  3S17 C;  4YFK A;  2WB1 L;  3S0X A;  4KC6 A;  3MML B;  3OEP A;  4X6A C;  4BBS C; 
#chains in the Genus database with same CATH homology
 3GTJ C;  2NVX K;  1I3Q C;  3GTO C;  3HOU C;  3M4O C;  3HOX K;  4XLN A;  4A3D C;  5M3F K;  1TWF K;  4Y7N K;  1IW7 A;  4LK0 A;  2E2J K;  3GTP C;  3GTJ K;  4X6A K;  5C4X C;  3HOU K;  2Y0S D;  1BDF A;  2NVQ C;  2JA7 K;  3K7A K;  1TWC C;  5M3M K;  3S1Q C;  2B63 C;  3GTL C;  5IYB C;  3S2D K;  2A68 A;  2R7Z K;  3WOD A;  3PO3 K;  2BE5 A;  3GTG C;  2NVQ K;  2A6H A;  2YU9 C;  3I4M C;  3GTK C;  1I50 C;  3HOW C;  4BBR C;  5IP9 K;  2JA8 K;  4QJV B;  3H0G C;  4QJV A;  3RZO K;  1I6H C;  2E2I C;  4JK1 A;  3I4M K;  4A93 C;  1WCM K;  5M5X K;  3GTK K;  1I50 K;  4BBR K;  2PA8 L;  4A3B C;  1Y1V K;  3PO2 K;  4MEX A;  4Y52 K;  2E2I K;  3FKI K;  1TWH C;  4OIO A;  3S16 C;  3CQZ K;  5C4J C;  3S17 K;  5FLM K;  2A69 A;  4BXX C;  5C3E K;  5M5Y K;  1R9T K;  3HOV C;  3S15 C;  1TWH K;  3S16 K;  4NOI A;  2CW0 A;  3S1R C;  5C44 C;  5C4J K;  2R92 K;  4BBS K;  4BXX K;  5IYC C;  5IP7 C;  1I3Q K;  4G7Z A;  3GTO K;  3M4O K;  4KMU A;  4C3H K;  2JA5 C;  4A3D K;  4A3E C;  4YG2 A;  1SFO C;  4KN7 A;  4OIN A;  3I4N C;  4C3J K;  3GTP K;  5C4X K;  2O5I A;  4A3G C;  2R93 C;  3S1Q K;  4A3L C;  1TWC K;  1K83 C;  1Y1W C;  4A3E K;  4A3K C;  1SFO K;  2B63 K;  5IYB K;  3GTL K;  3I4N K;  3GTG K;  2YU9 K;  4A3K K;  4A3M C;  3HOW K;  2PA8 D;  3RZD C;  4KN4 A;  3H0G K;  5TMF A;  1I6H K;  4AYB D;  4AYB L;  2VUM C;  4GZY A;  5D4D A;  4A93 K;  4A3M K;  3S2H C;  4A3B K;  3RZD K;  4A3C C;  5TMC A;  5M5W K;  2NVY C;  1TWG C;  4A3F C;  3GTQ C;  2O5J A;  2E2H C;  3HOV K;  3S15 K;  4BY7 C;  4A3F K;  3S1R K;  5C44 K;  5IYD C;  3GTQ K;  3M3Y C;  3DXJ A;  2PPB A;  5IYC K;  4MQ9 A;  4XSZ A;  5IP7 K;  4A3J C;  2JA5 K;  4Q5S A;  3HKZ L;  1YNJ A;  5IYD K;  4A3I C;  2NVX C;  4A3J K;  1TWA C;  4A3G K;  4C2M K;  2R93 K;  3HOX C;  2NVT C;  4A3L K;  1K83 K;  1Y1W K;  3S14 C;  1TWF C;  4Y7N C;  2E2J C;  4MEY A;  4C3I K;  4OIP A;  4XLP A;  1TWA K;  4Q4Z A;  2JA7 C;  3K7A C;  2NVT K;  3S14 K;  1XPP A;  4LJZ A;  1ZYR A;  4LK1 A;  2R7Z C;  3HOZ C;  3S1N C;  3PO3 C;  3S2D C;  1YNN A;  2VUM K;  2Y0S L;  4BY1 C;  3HOY C;  4QIW D;  4QIW L;  4OIR A;  2WAQ D;  2WAQ L;  2PMZ L;  2PMZ D;  4XSX A;  5IP9 C;  2JA8 C;  3HOZ K;  3S1N K;  3S2H K;  3RZO C;  4G7H A;  4LLG A;  4A3C K;  3S1M C;  3EQL A;  3H3V L;  3H3V D;  1SMY A;  2NVY K;  1TWG K;  4BY1 K;  1WCM C;  3GTM C;  3HOY K;  5FJ8 K;  4ZH4 A;  1Y1V C;  3PO2 C;  4OIQ A;  3S1M K;  4Y52 C;  2E2H K;  4G7O A;  3FKI C;  2A6E A;  3HKZ D;  3GTM K;  4BY7 K;  4YFN A;  2JA6 C;  3CQZ C;  4YFX A;  3M3Y K;  3S17 C;  5FLM C;  1HQM A;  5C3E C;  1R9T C;  2WB1 D;  2WB1 L;  4YFK A;  2JA6 K;  2R92 C;  4X6A C;  4BBS C;  1I6V A;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...