3S16K

Rna polymerase ii initiation complex with an 8-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s16K00
5C44C 4ZH4A 3HOVK 2R93C 1Y1VC 5M5WK 1TWAK 3M3YK 4A93K 4BY7C 3GTQK 4X6AC 4XSZA 4G7ZA 1Y1WK 3RZOC 3S16K 1I6VA 4A3EK 5C44K 3RZOK 1K83C 4A3IC 2O5IA 3M3YC 4A93C 3I4MC 3RZDC 4BY7K 4X6AK 5M3FK 3S17K 3S1RK 1I3QC 1TWCC 3PO3K 3S1NC 4C2MK 3S15K 5IYBK 3HOYC 1TWCK 5FLMK 2Y0SL 4QJVA 4YFKA 4Y52C 3PO3C 4A3GK 2NVTK 2JA5K 3PO2C 5IYBC 3S15C 3HOYK 5FLMC 4A3GC 4QIWD 1YNNA 5C3EK 2B63C 3I4NK 3S1QC 2A68A 2A69A 5FJ8K 2JA5C 3PO2K 2JA6C 4A3MK 4BY1C 4LLGA 5IP7K 5IYCK 1I50C 3GTKK 3CQZK 1R9TC 3DXJA 4MEYA 1I6HC 4KN7A 3HOXC 4A3MC 1YNJA 3GTKC 5IYCC 3CQZC 1R9TK 2E2IK 3HOWK 5C4XC 2PMZL 3HOXK 1XPPA 4QIWL 3H0GK 5IP9K 2WB1D 2A6EA 2R7ZC 3S2HC 3GTLK 2E2HK 1WCMC 2PPBA 4Y7NC 4Q4ZA 2JA7K 4XSXA 3S14K 4MQ9A 2R7ZK 1IW7A 5M3MK 3HKZL 1TWGK 4KN4A 4NOIA 3GTMC 3GTGK 3GTLC 3HOZC 4OIOA 3S14C 2A6HA 2WB1L 5D4DA 1TWFC 3HKZD 2WAQL 3HOUC 4MEXA 4LJZA 3S1NK 4C3JK 3GTGC 3K7AK 4KMUA 4YG2A 3H3VD 2WAQD 4A3EC 2PA8D 1K83K 4A3IK 4LK1A 5C4JC 2CW0A 2VUMK 3RZDK 5M5XK 2R92C 3K7AC 3M4OC 1I3QK 4XLPA 3GTJK 5C4JK 2VUMC 4OINA 3GTPC 3M4OK 2NVTC 3HOVC 1TWAC 4A3FK 4BXXK 5IYDC 1SMYA 4A3KK 3S1QK 4BBSC 4A3DC 1TWHC 4BBRC 4C3IK 2PA8L 4JK1A 1ZYRA 2JA6K 3S1MC 3I4MK 4A3DK 2NVYK 3S1RC 4A3KC 4BBRK 4A3BK 1TWHK 5TMFA 3S2HK 2O5JA 4Q5SA 4YFXA 3S1MK 2NVYC 4LK0A 4A3BC 3S16C 4Y52K 3FKIK 2NVQC 4A3CK 1SFOC 2NVXC 3GTOC 4OIPA 4G7HA 3S17C 4GZYA 2YU9K 3H0GC 3FKIC 2NVQK 2BE5A 2E2JK 2JA8C 3WODA 4A3CC 2Y0SD 3GTOK 4A3LK 1SFOK 2NVXK 4YFNA 4XLNA 4BY1K 5IP7C 2YU9C 1I50K 4AYBD 2E2JC 2JA8K 4A3LC 3GTMK 1I6HK 3HOZK 2R92K 4A3JC 5C3EC 2B63K 4AYBL 4C3HK 3EQLA 1TWFK 3HOUK 3I4NC 3S2DC 4G7OA 3H3VL 5IP9C 4A3JK 3GTPK 3S2DK 2E2HC 1HQMA 4A3FC 1WCMK 4OIRA 4Y7NK 4QJVB 4BXXC 5IYDK 2JA7C 4BBSK 1BDFA 1Y1VK 2PMZD 1TWGC 3GTJC 5C4XK 2E2IC 3GTQC 4OIQA 3HOWC 2R93K 5M5YK 1Y1WC 5TMCA
chains in the Genus database with same CATH superfamily
1TWAK 3GTQK 3GEEA 4XSZA 1Y1WK 2D6FC 1K83C 4A93C 3S17K 4KMAA 1I3QC 2XCRB 1YX2A 1TWCK 3AQOA 2Y0SL 1F9NA 4QJVA 5E68A 2JA7A 4GFQA 2JA5K 4KMHA 1YNNA 2A68A 5FJ8K 4ILDA 3PO2K 3BUEA 4G0UA 5IYCK 2V6TA 3CQZK 1JVIA 3DXJA 1R9TC 3AQPA 1I6HC 4KN7A 2JH3A 4A3MC 3GDZA 3GTKC 5EGHA 3GTPA 3Q3QA 3HOWK 3A8KA 2PMZL 5IORA 3AD7C 2R7ZC 2E2HA 2E2HK 1WCMC 2PPBA 4Q4ZA 4P9SA 4MQ9A 2P5MA 3A8IA 1PJ5A 2E2IA 4NOIA 3GTMC 3GTGK 3GTLC 1VJEA 3MMLB 3HOZC 1DCPA 3HOUC 4P5AA 4XCHA 1WSVA 2FQTA 3AD9C 2GSNA 2PA8D 2VUMK 2R92C 3K7AC 1I50A 3AD8C 3GTJK 2NVXA 3LAPA 1V5VA 3GTPC 1O24A 4G0WA 3S1QK 1TWGA 3OEPA 1O2AA 2PA8L 4JK1A 2GSUA 2JA6K 3S1MC 3FHZA 4KMDA 2NVYK 4A3KC 1WOPA 5TMFA 4C2MC 3IPJA 1BGWA 3JSTA 4GTFA 4A3BC 3S16C 4KASA 4GTDA 4A3CK 1XZPB 1SFOC 1J6XA 3GEIA 2B63A 4YFNA 4BY1K 3H0GA 1I50K 2YU9C 1VRQC 4AYBD 3N0BA 1R9TA 5C3EC 4LQYA 1WOOA 2V6SA 4Y7NK 4BBSK 3SZZA 1ISEA 5M5YK 4WILA 5TMCA 5C44C 4ZH4A 3VA7A 3HOVK 3N0CA 1K83A 1O26A 4BY7C 4M1XA 3RZOC 1ZXOA 4KDDA 4A3EK 4A3IC 3I4MC 1RU0A 3S1RK 3PO3K 4LR2A 1XXBA 4J3NA 3BP3A 3S15K 1XXAA 3TFHA 4KARA 4GTLA 2NVTK 5IYBC 2R92A 5FLMC 3OPFA 4A3GC 3I4NK 3BP8C 2A69A 4P5BA 2JA5C 3V4GA 1XXCA 1VH2A 1X31C 3S0XA 5IYCC 3CQZC 1R9TK 2E2IK 5IP9K 3T02A 1WQHA 2WB1D 2A6EA 3FOFA 3S2HC 1GE9A 3GTLA 2R93A 5L46A 3GTMA 3S14K 1EQRA 3HKZL 3LAJA 1BJTA 5D4DA 1TWFC 1F7UA 2WAQL 3S1NK 4LJZA 3GEHA 4C3JK 4KB4A 3GTGC 2P8TA 4YG2A 4GTBA 5CJ9A 1DCOA 1K83K 4LK1A 5C4JC 1IL2A 3M4OC 1I3QK 1C0AA 1XZQB 1KQ4A 1XZPA 1WOSA 4OINA 3TFIA 4A3FK 4AH6A 1SMYA 1TWHC 2KWAA 4C3IK 3NUHA 4A3DK 4BBRK 5JFEA 5HL8A 1USMA 4LK0A 1WCMA 4Y52K 1IQ0A 3GSIA 3GTOC 4G7HA 3S17C 1J6WA 4LOWA 4GZYA 3FKIC 2NVQK 1ZQ1C 2E2JK 4PABA 5IOSA 4A3CC 1SFOK 2EBBA 5IP7C 4A3LC 3GTMK 3HOZK 3CAGA 4AYBL 3HOUK 2JA6A 3S2DC 4G7OA 3GTOA 2GSOA 4BXXC 4OIRA 3OREA 4QJVB 5IYDK 2JA7C 1J6VA 1Y1VK 3GTJC 1TWGC 1L0WA 3HOWC 4KM8A 1Y1WC 3HXAA 2PHCB 2R93C 3M3YK 4X6AC 2ZFZA 3G4CA 4G7ZA 5C44K 2O5IA 4BY7K 3RZDC 3GTKA 1O27A 1TWCC 1IE0A 4C2MK 3GTGA 3HOYC 3G4AA 3S15C 1Y1WA 4GTCA 2B63C 4C3HC 4BY1C 1I50C 3GTKK 1WSRA 4MEYA 3HOXC 3CQZA 1YNJA 5C4XC 4G0VA 1DCHA 1XPPA 3H0GK 1O25A 4RMFA 4Y7NC 4BLBA 2R7ZK 1IW7A 5M3MK 4KN4A 2V6UA 5CHPA 4OIOA 2A6HA 2WB1L 4MEXA 5IOTA 5EGEA 1WQFA 4KMUA 3H3VD 2WAQD 4A3EC 1IS1A 4A3IK 4GT9A 2CW0A 5M5XK 3FOEA 1SFOA 3T00A 2VUMC 1XZQA 1B4BA 3ADAC 3M4OK 2NVTC 1TWAC 4BBSC 1ZYRA 2W7VA 1TWHA 4A3BK 4WJ4A 2RH6A 1TWHK 1JQWA 2ZUFA 4C3IC 4Q5SA 3S1MK 2NVYC 3ERED 4FZBA 1USOA 1JOEA 2NVXC 1Y1VA 4OIPA 2BE5A 2JA8C 3WODA 4FM9A 4XLNA 3GTQA 2Y3PA 2E2JC 1I6HK 1TWFA 2R92K 4A3JC 3SZYA 3I4NC 1TWFK 1UV7A 4C3JC 3GTPK 2ZUEA 4KB2A 1O29A 2E2HC 1HQMA 1WCMK 1PJ6A 4BLAA 4KATA 1BDFA 1YCLA 2PMZD 2E2IC 3GTQC 2NVYA 4C45A 3RZOK 1Y1VC 5M5WK 4A93K 3AH5A 1J98A 4KM9A 3S16K 1IBAA 1I6VA 3TFJA 4GTEA 1TWCA 3M3YC 4X6AK 1HI9A 5M3FK 1VGXA 3S1NC 3FKIA 4O2DA 1B4AA 1G51A 5IYBK 1PJ7A 3PO3C 5FLMK 4YFKA 4A3GK 2CFAA 4Y52C 2VUMA 3PO2C 3HOYK 4QIWD 3S1QC 5C3EK 2RGRA 2JA6C 1VLOA 4A3MK 4LLGA 1EH1A 5IP7K 1WORA 2GAGC 1ZVUA 3TTGA 2R7ZA 3HOXK 2GAHC 3A8JA 4QIWL 4KC6A 3GTLK 5JVOA 2JA7K 4XSXA 1ZBSA 1TWGK 3S14C 3HKZD 2FQOA 3K7AK 1EK8A 1I3QA 3RZDK 4XLPA 1F93A 4BKWA 5C4JK 4KAWX 3L4KA 1F7VA 1O2FB 1EI6A 3HOVC 4DDQA 4BXXK 3QX3A 5IYDC 4A3KK 4WJ3M 4A3DC 1EFWA 4BBRC 1WQGA 3I4MK 3S1RC 3S2HK 2O5JA 4YFXA 4PAAA 2XCOA 1O2BA 3FKIK 2NVQC 3GIRA 1O28A 5TJ3A 2YU9K 3H0GC 2YU9A 1DD5A 2Y0SD 1AB4A 3GTOK 2NVXK 3GTJA 4A3LK 3L4JA 1BS2A 5IOQA 2JA8K 2XCQA 3LPXA 4GTAA 2B63K 4C3HK 2JA5A 3EQLA 3N3YA 3H3VL 5IP9C 4A3JK 3S2DK 4A3FC 2CFAB 1INNA 1WIHA 2R93K 5C4XK 4OIQA 3T01A 1TWAA
chains in the Genus database with same CATH topology
5C44C 4ZH4A 3HOVK 2R93C 1Y1VC 5M5WK 1TWAK 3M3YK 4A93K 4BY7C 3GTQK 4X6AC 4XSZA 4G7ZA 1Y1WK 3RZOC 3S16K 1I6VA 4A3EK 5C44K 3RZOK 1K83C 4A3IC 2O5IA 3M3YC 4A93C 3I4MC 3RZDC 4BY7K 4X6AK 5M3FK 3S17K 3S1RK 1I3QC 1TWCC 3PO3K 3S1NC 4C2MK 3S15K 5IYBK 3HOYC 1TWCK 5FLMK 2Y0SL 4QJVA 4YFKA 4Y52C 3PO3C 4A3GK 2NVTK 2JA5K 3PO2C 5IYBC 3S15C 3HOYK 5FLMC 4A3GC 4QIWD 1YNNA 5C3EK 2B63C 3I4NK 3S1QC 2A68A 2A69A 5FJ8K 2JA5C 3PO2K 2JA6C 4A3MK 4BY1C 4LLGA 5IP7K 5IYCK 1I50C 3GTKK 3CQZK 1R9TC 3DXJA 4MEYA 1I6HC 4KN7A 3HOXC 4A3MC 1YNJA 3GTKC 5IYCC 3CQZC 1R9TK 2E2IK 3HOWK 5C4XC 2PMZL 3HOXK 1XPPA 4QIWL 3H0GK 5IP9K 2WB1D 2A6EA 2R7ZC 3S2HC 3GTLK 2E2HK 1WCMC 2PPBA 4Y7NC 4Q4ZA 2JA7K 4XSXA 3S14K 4MQ9A 2R7ZK 1IW7A 5M3MK 3HKZL 1TWGK 4KN4A 4NOIA 3GTMC 3GTGK 3GTLC 3HOZC 4OIOA 3S14C 2A6HA 2WB1L 5D4DA 1TWFC 3HKZD 2WAQL 3HOUC 4MEXA 4LJZA 3S1NK 4C3JK 3GTGC 3K7AK 4KMUA 4YG2A 3H3VD 2WAQD 4A3EC 2PA8D 1K83K 4A3IK 4LK1A 5C4JC 2CW0A 2VUMK 3RZDK 5M5XK 2R92C 3K7AC 3M4OC 1I3QK 4XLPA 3GTJK 5C4JK 2VUMC 4OINA 3GTPC 3M4OK 2NVTC 3HOVC 1TWAC 4A3FK 4BXXK 5IYDC 1SMYA 4A3KK 3S1QK 4BBSC 4A3DC 1TWHC 4BBRC 4C3IK 2PA8L 4JK1A 1ZYRA 2JA6K 3S1MC 3I4MK 4A3DK 2NVYK 3S1RC 4A3KC 4BBRK 4A3BK 1TWHK 5TMFA 3S2HK 2O5JA 4Q5SA 4YFXA 3S1MK 2NVYC 4LK0A 4A3BC 3S16C 4Y52K 3FKIK 2NVQC 4A3CK 1SFOC 2NVXC 3GTOC 4OIPA 4G7HA 3S17C 4GZYA 2YU9K 3H0GC 3FKIC 2NVQK 2BE5A 2E2JK 2JA8C 3WODA 4A3CC 2Y0SD 3GTOK 4A3LK 1SFOK 2NVXK 4YFNA 4XLNA 4BY1K 5IP7C 2YU9C 1I50K 4AYBD 2E2JC 2JA8K 4A3LC 3GTMK 1I6HK 3HOZK 2R92K 4A3JC 5C3EC 2B63K 4AYBL 4C3HK 3EQLA 1TWFK 3HOUK 3I4NC 3S2DC 4G7OA 3H3VL 5IP9C 4A3JK 3GTPK 3S2DK 2E2HC 1HQMA 4A3FC 1WCMK 4OIRA 4Y7NK 4QJVB 4BXXC 5IYDK 2JA7C 4BBSK 1BDFA 1Y1VK 2PMZD 1TWGC 3GTJC 5C4XK 2E2IC 3GTQC 4OIQA 3HOWC 2R93K 5M5YK 1Y1WC 5TMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 C;  4ZH4 A;  3HOV K;  2R93 C;  1Y1V C;  5M5W K;  1TWA K;  3M3Y K;  4A93 K;  4BY7 C;  3GTQ K;  4X6A C;  4XSZ A;  4G7Z A;  1Y1W K;  3RZO C;  3S16 K;  1I6V A;  4A3E K;  5C44 K;  3RZO K;  1K83 C;  4A3I C;  2O5I A;  3M3Y C;  4A93 C;  3I4M C;  3RZD C;  4BY7 K;  4X6A K;  5M3F K;  3S17 K;  3S1R K;  1I3Q C;  1TWC C;  3PO3 K;  3S1N C;  4C2M K;  3S15 K;  5IYB K;  3HOY C;  1TWC K;  5FLM K;  2Y0S L;  4QJV A;  4YFK A;  4Y52 C;  3PO3 C;  4A3G K;  2NVT K;  2JA5 K;  3PO2 C;  5IYB C;  3S15 C;  3HOY K;  5FLM C;  4A3G C;  4QIW D;  1YNN A;  5C3E K;  2B63 C;  3I4N K;  3S1Q C;  2A68 A;  2A69 A;  5FJ8 K;  2JA5 C;  3PO2 K;  2JA6 C;  4A3M K;  4BY1 C;  4LLG A;  5IP7 K;  5IYC K;  1I50 C;  3GTK K;  3CQZ K;  1R9T C;  3DXJ A;  4MEY A;  1I6H C;  4KN7 A;  3HOX C;  4A3M C;  1YNJ A;  3GTK C;  5IYC C;  3CQZ C;  1R9T K;  2E2I K;  3HOW K;  5C4X C;  2PMZ L;  3HOX K;  1XPP A;  4QIW L;  3H0G K;  5IP9 K;  2WB1 D;  2A6E A;  2R7Z C;  3S2H C;  3GTL K;  2E2H K;  1WCM C;  2PPB A;  4Y7N C;  4Q4Z A;  2JA7 K;  4XSX A;  3S14 K;  4MQ9 A;  2R7Z K;  1IW7 A;  5M3M K;  3HKZ L;  1TWG K;  4KN4 A;  4NOI A;  3GTM C;  3GTG K;  3GTL C;  3HOZ C;  4OIO A;  3S14 C;  2A6H A;  2WB1 L;  5D4D A;  1TWF C;  3HKZ D;  2WAQ L;  3HOU C;  4MEX A;  4LJZ A;  3S1N K;  4C3J K;  3GTG C;  3K7A K;  4KMU A;  4YG2 A;  3H3V D;  2WAQ D;  4A3E C;  2PA8 D;  1K83 K;  4A3I K;  4LK1 A;  5C4J C;  2CW0 A;  2VUM K;  3RZD K;  5M5X K;  2R92 C;  3K7A C;  3M4O C;  1I3Q K;  4XLP A;  3GTJ K;  5C4J K;  2VUM C;  4OIN A;  3GTP C;  3M4O K;  2NVT C;  3HOV C;  1TWA C;  4A3F K;  4BXX K;  5IYD C;  1SMY A;  4A3K K;  3S1Q K;  4BBS C;  4A3D C;  1TWH C;  4BBR C;  4C3I K;  2PA8 L;  4JK1 A;  1ZYR A;  2JA6 K;  3S1M C;  3I4M K;  4A3D K;  2NVY K;  3S1R C;  4A3K C;  4BBR K;  4A3B K;  1TWH K;  5TMF A;  3S2H K;  2O5J A;  4Q5S A;  4YFX A;  3S1M K;  2NVY C;  4LK0 A;  4A3B C;  3S16 C;  4Y52 K;  3FKI K;  2NVQ C;  4A3C K;  1SFO C;  2NVX C;  3GTO C;  4OIP A;  4G7H A;  3S17 C;  4GZY A;  2YU9 K;  3H0G C;  3FKI C;  2NVQ K;  2BE5 A;  2E2J K;  2JA8 C;  3WOD A;  4A3C C;  2Y0S D;  3GTO K;  4A3L K;  1SFO K;  2NVX K;  4YFN A;  4XLN A;  4BY1 K;  5IP7 C;  2YU9 C;  1I50 K;  4AYB D;  2E2J C;  2JA8 K;  4A3L C;  3GTM K;  1I6H K;  3HOZ K;  2R92 K;  4A3J C;  5C3E C;  2B63 K;  4AYB L;  4C3H K;  3EQL A;  1TWF K;  3HOU K;  3I4N C;  3S2D C;  4G7O A;  3H3V L;  5IP9 C;  4A3J K;  3GTP K;  3S2D K;  2E2H C;  1HQM A;  4A3F C;  1WCM K;  4OIR A;  4Y7N K;  4QJV B;  4BXX C;  5IYD K;  2JA7 C;  4BBS K;  1BDF A;  1Y1V K;  2PMZ D;  1TWG C;  3GTJ C;  5C4X K;  2E2I C;  3GTQ C;  4OIQ A;  3HOW C;  2R93 K;  5M5Y K;  1Y1W C;  5TMC A; 
#chains in the Genus database with same CATH topology
 1TWA K;  3GTQ K;  3GEE A;  4XSZ A;  1Y1W K;  2D6F C;  1K83 C;  4A93 C;  3S17 K;  4KMA A;  1I3Q C;  2XCR B;  1YX2 A;  1TWC K;  3AQO A;  2Y0S L;  1F9N A;  4QJV A;  5E68 A;  2JA7 A;  4GFQ A;  2JA5 K;  4KMH A;  1YNN A;  2A68 A;  5FJ8 K;  4ILD A;  3PO2 K;  3BUE A;  4G0U A;  5IYC K;  2V6T A;  3CQZ K;  1JVI A;  3DXJ A;  1R9T C;  3AQP A;  1I6H C;  4KN7 A;  2JH3 A;  4A3M C;  3GDZ A;  3GTK C;  5EGH A;  3GTP A;  3Q3Q A;  3HOW K;  3A8K A;  2PMZ L;  5IOR A;  3AD7 C;  2R7Z C;  2E2H A;  2E2H K;  1WCM C;  2PPB A;  4Q4Z A;  4P9S A;  4MQ9 A;  2P5M A;  3A8I A;  1PJ5 A;  2E2I A;  4NOI A;  3GTM C;  3GTG K;  3GTL C;  1VJE A;  3MML B;  3HOZ C;  1DCP A;  3HOU C;  4P5A A;  4XCH A;  1WSV A;  2FQT A;  3AD9 C;  2GSN A;  2PA8 D;  2VUM K;  2R92 C;  3K7A C;  1I50 A;  3AD8 C;  3GTJ K;  2NVX A;  3LAP A;  1V5V A;  3GTP C;  1O24 A;  4G0W A;  3S1Q K;  1TWG A;  3OEP A;  1O2A A;  2PA8 L;  4JK1 A;  2GSU A;  2JA6 K;  3S1M C;  3FHZ A;  4KMD A;  2NVY K;  4A3K C;  1WOP A;  5TMF A;  4C2M C;  3IPJ A;  1BGW A;  3JST A;  4GTF A;  4A3B C;  3S16 C;  4KAS A;  4GTD A;  4A3C K;  1XZP B;  1SFO C;  1J6X A;  3GEI A;  2B63 A;  4YFN A;  4BY1 K;  3H0G A;  1I50 K;  2YU9 C;  1VRQ C;  4AYB D;  3N0B A;  1R9T A;  5C3E C;  4LQY A;  1WOO A;  2V6S A;  4Y7N K;  4BBS K;  3SZZ A;  1ISE A;  5M5Y K;  4WIL A;  5TMC A;  5C44 C;  4ZH4 A;  3VA7 A;  3HOV K;  3N0C A;  1K83 A;  1O26 A;  4BY7 C;  4M1X A;  3RZO C;  1ZXO A;  4KDD A;  4A3E K;  4A3I C;  3I4M C;  1RU0 A;  3S1R K;  3PO3 K;  4LR2 A;  1XXB A;  4J3N A;  3BP3 A;  3S15 K;  1XXA A;  3TFH A;  4KAR A;  4GTL A;  2NVT K;  5IYB C;  2R92 A;  5FLM C;  3OPF A;  4A3G C;  3I4N K;  3BP8 C;  2A69 A;  4P5B A;  2JA5 C;  3V4G A;  1XXC A;  1VH2 A;  1X31 C;  3S0X A;  5IYC C;  3CQZ C;  1R9T K;  2E2I K;  5IP9 K;  3T02 A;  1WQH A;  2WB1 D;  2A6E A;  3FOF A;  3S2H C;  1GE9 A;  3GTL A;  2R93 A;  5L46 A;  3GTM A;  3S14 K;  1EQR A;  3HKZ L;  3LAJ A;  1BJT A;  5D4D A;  1TWF C;  1F7U A;  2WAQ L;  3S1N K;  4LJZ A;  3GEH A;  4C3J K;  4KB4 A;  3GTG C;  2P8T A;  4YG2 A;  4GTB A;  5CJ9 A;  1DCO A;  1K83 K;  4LK1 A;  5C4J C;  1IL2 A;  3M4O C;  1I3Q K;  1C0A A;  1XZQ B;  1KQ4 A;  1XZP A;  1WOS A;  4OIN A;  3TFI A;  4A3F K;  4AH6 A;  1SMY A;  1TWH C;  2KWA A;  4C3I K;  3NUH A;  4A3D K;  4BBR K;  5JFE A;  5HL8 A;  1USM A;  4LK0 A;  1WCM A;  4Y52 K;  1IQ0 A;  3GSI A;  3GTO C;  4G7H A;  3S17 C;  1J6W A;  4LOW A;  4GZY A;  3FKI C;  2NVQ K;  1ZQ1 C;  2E2J K;  4PAB A;  5IOS A;  4A3C C;  1SFO K;  2EBB A;  5IP7 C;  4A3L C;  3GTM K;  3HOZ K;  3CAG A;  4AYB L;  3HOU K;  2JA6 A;  3S2D C;  4G7O A;  3GTO A;  2GSO A;  4BXX C;  4OIR A;  3ORE A;  4QJV B;  5IYD K;  2JA7 C;  1J6V A;  1Y1V K;  3GTJ C;  1TWG C;  1L0W A;  3HOW C;  4KM8 A;  1Y1W C;  3HXA A;  2PHC B;  2R93 C;  3M3Y K;  4X6A C;  2ZFZ A;  3G4C A;  4G7Z A;  5C44 K;  2O5I A;  4BY7 K;  3RZD C;  3GTK A;  1O27 A;  1TWC C;  1IE0 A;  4C2M K;  3GTG A;  3HOY C;  3G4A A;  3S15 C;  1Y1W A;  4GTC A;  2B63 C;  4C3H C;  4BY1 C;  1I50 C;  3GTK K;  1WSR A;  4MEY A;  3HOX C;  3CQZ A;  1YNJ A;  5C4X C;  4G0V A;  1DCH A;  1XPP A;  3H0G K;  1O25 A;  4RMF A;  4Y7N C;  4BLB A;  2R7Z K;  1IW7 A;  5M3M K;  4KN4 A;  2V6U A;  5CHP A;  4OIO A;  2A6H A;  2WB1 L;  4MEX A;  5IOT A;  5EGE A;  1WQF A;  4KMU A;  3H3V D;  2WAQ D;  4A3E C;  1IS1 A;  4A3I K;  4GT9 A;  2CW0 A;  5M5X K;  3FOE A;  1SFO A;  3T00 A;  2VUM C;  1XZQ A;  1B4B A;  3ADA C;  3M4O K;  2NVT C;  1TWA C;  4BBS C;  1ZYR A;  2W7V A;  1TWH A;  4A3B K;  4WJ4 A;  2RH6 A;  1TWH K;  1JQW A;  2ZUF A;  4C3I C;  4Q5S A;  3S1M K;  2NVY C;  3ERE D;  4FZB A;  1USO A;  1JOE A;  2NVX C;  1Y1V A;  4OIP A;  2BE5 A;  2JA8 C;  3WOD A;  4FM9 A;  4XLN A;  3GTQ A;  2Y3P A;  2E2J C;  1I6H K;  1TWF A;  2R92 K;  4A3J C;  3SZY A;  3I4N C;  1TWF K;  1UV7 A;  4C3J C;  3GTP K;  2ZUE A;  4KB2 A;  1O29 A;  2E2H C;  1HQM A;  1WCM K;  1PJ6 A;  4BLA A;  4KAT A;  1BDF A;  1YCL A;  2PMZ D;  2E2I C;  3GTQ C;  2NVY A;  4C45 A;  3RZO K;  1Y1V C;  5M5W K;  4A93 K;  3AH5 A;  1J98 A;  4KM9 A;  3S16 K;  1IBA A;  1I6V A;  3TFJ A;  4GTE A;  1TWC A;  3M3Y C;  4X6A K;  1HI9 A;  5M3F K;  1VGX A;  3S1N C;  3FKI A;  4O2D A;  1B4A A;  1G51 A;  5IYB K;  1PJ7 A;  3PO3 C;  5FLM K;  4YFK A;  4A3G K;  2CFA A;  4Y52 C;  2VUM A;  3PO2 C;  3HOY K;  4QIW D;  3S1Q C;  5C3E K;  2RGR A;  2JA6 C;  1VLO A;  4A3M K;  4LLG A;  1EH1 A;  5IP7 K;  1WOR A;  2GAG C;  1ZVU A;  3TTG A;  2R7Z A;  3HOX K;  2GAH C;  3A8J A;  4QIW L;  4KC6 A;  3GTL K;  5JVO A;  2JA7 K;  4XSX A;  1ZBS A;  1TWG K;  3S14 C;  3HKZ D;  2FQO A;  3K7A K;  1EK8 A;  1I3Q A;  3RZD K;  4XLP A;  1F93 A;  4BKW A;  5C4J K;  4KAW X;  3L4K A;  1F7V A;  1O2F B;  1EI6 A;  3HOV C;  4DDQ A;  4BXX K;  3QX3 A;  5IYD C;  4A3K K;  4WJ3 M;  4A3D C;  1EFW A;  4BBR C;  1WQG A;  3I4M K;  3S1R C;  3S2H K;  2O5J A;  4YFX A;  4PAA A;  2XCO A;  1O2B A;  3FKI K;  2NVQ C;  3GIR A;  1O28 A;  5TJ3 A;  2YU9 K;  3H0G C;  2YU9 A;  1DD5 A;  2Y0S D;  1AB4 A;  3GTO K;  2NVX K;  3GTJ A;  4A3L K;  3L4J A;  1BS2 A;  5IOQ A;  2JA8 K;  2XCQ A;  3LPX A;  4GTA A;  2B63 K;  4C3H K;  2JA5 A;  3EQL A;  3N3Y A;  3H3V L;  5IP9 C;  4A3J K;  3S2D K;  4A3F C;  2CFA B;  1INN A;  1WIH A;  2R93 K;  5C4X K;  4OIQ A;  3T01 A;  1TWA A; 
#chains in the Genus database with same CATH homology
 5C44 C;  4ZH4 A;  3HOV K;  2R93 C;  1Y1V C;  5M5W K;  1TWA K;  3M3Y K;  4A93 K;  4BY7 C;  3GTQ K;  4X6A C;  4XSZ A;  4G7Z A;  1Y1W K;  3RZO C;  3S16 K;  1I6V A;  4A3E K;  5C44 K;  3RZO K;  1K83 C;  4A3I C;  2O5I A;  3M3Y C;  4A93 C;  3I4M C;  3RZD C;  4BY7 K;  4X6A K;  5M3F K;  3S17 K;  3S1R K;  1I3Q C;  1TWC C;  3PO3 K;  3S1N C;  4C2M K;  3S15 K;  5IYB K;  3HOY C;  1TWC K;  5FLM K;  2Y0S L;  4QJV A;  4YFK A;  4Y52 C;  3PO3 C;  4A3G K;  2NVT K;  2JA5 K;  3PO2 C;  5IYB C;  3S15 C;  3HOY K;  5FLM C;  4A3G C;  4QIW D;  1YNN A;  5C3E K;  2B63 C;  3I4N K;  3S1Q C;  2A68 A;  2A69 A;  5FJ8 K;  2JA5 C;  3PO2 K;  2JA6 C;  4A3M K;  4BY1 C;  4LLG A;  5IP7 K;  5IYC K;  1I50 C;  3GTK K;  3CQZ K;  1R9T C;  3DXJ A;  4MEY A;  1I6H C;  4KN7 A;  3HOX C;  4A3M C;  1YNJ A;  3GTK C;  5IYC C;  3CQZ C;  1R9T K;  2E2I K;  3HOW K;  5C4X C;  2PMZ L;  3HOX K;  1XPP A;  4QIW L;  3H0G K;  5IP9 K;  2WB1 D;  2A6E A;  2R7Z C;  3S2H C;  3GTL K;  2E2H K;  1WCM C;  2PPB A;  4Y7N C;  4Q4Z A;  2JA7 K;  4XSX A;  3S14 K;  4MQ9 A;  2R7Z K;  1IW7 A;  5M3M K;  3HKZ L;  1TWG K;  4KN4 A;  4NOI A;  3GTM C;  3GTG K;  3GTL C;  3HOZ C;  4OIO A;  3S14 C;  2A6H A;  2WB1 L;  5D4D A;  1TWF C;  3HKZ D;  2WAQ L;  3HOU C;  4MEX A;  4LJZ A;  3S1N K;  4C3J K;  3GTG C;  3K7A K;  4KMU A;  4YG2 A;  3H3V D;  2WAQ D;  4A3E C;  2PA8 D;  1K83 K;  4A3I K;  4LK1 A;  5C4J C;  2CW0 A;  2VUM K;  3RZD K;  5M5X K;  2R92 C;  3K7A C;  3M4O C;  1I3Q K;  4XLP A;  3GTJ K;  5C4J K;  2VUM C;  4OIN A;  3GTP C;  3M4O K;  2NVT C;  3HOV C;  1TWA C;  4A3F K;  4BXX K;  5IYD C;  1SMY A;  4A3K K;  3S1Q K;  4BBS C;  4A3D C;  1TWH C;  4BBR C;  4C3I K;  2PA8 L;  4JK1 A;  1ZYR A;  2JA6 K;  3S1M C;  3I4M K;  4A3D K;  2NVY K;  3S1R C;  4A3K C;  4BBR K;  4A3B K;  1TWH K;  5TMF A;  3S2H K;  2O5J A;  4Q5S A;  4YFX A;  3S1M K;  2NVY C;  4LK0 A;  4A3B C;  3S16 C;  4Y52 K;  3FKI K;  2NVQ C;  4A3C K;  1SFO C;  2NVX C;  3GTO C;  4OIP A;  4G7H A;  3S17 C;  4GZY A;  2YU9 K;  3H0G C;  3FKI C;  2NVQ K;  2BE5 A;  2E2J K;  2JA8 C;  3WOD A;  4A3C C;  2Y0S D;  3GTO K;  4A3L K;  1SFO K;  2NVX K;  4YFN A;  4XLN A;  4BY1 K;  5IP7 C;  2YU9 C;  1I50 K;  4AYB D;  2E2J C;  2JA8 K;  4A3L C;  3GTM K;  1I6H K;  3HOZ K;  2R92 K;  4A3J C;  5C3E C;  2B63 K;  4AYB L;  4C3H K;  3EQL A;  1TWF K;  3HOU K;  3I4N C;  3S2D C;  4G7O A;  3H3V L;  5IP9 C;  4A3J K;  3GTP K;  3S2D K;  2E2H C;  1HQM A;  4A3F C;  1WCM K;  4OIR A;  4Y7N K;  4QJV B;  4BXX C;  5IYD K;  2JA7 C;  4BBS K;  1BDF A;  1Y1V K;  2PMZ D;  1TWG C;  3GTJ C;  5C4X K;  2E2I C;  3GTQ C;  4OIQ A;  3HOW C;  2R93 K;  5M5Y K;  1Y1W C;  5TMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...