3S16K

Rna polymerase ii initiation complex with an 8-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s16K00
2WAQD 1R9TK 4BY1C 4BBRK 3S2DK 4Q5SA 4AYBL 4A93C 2JA7K 1YNJA 3S15C 4BY7C 1TWAC 4QJVA 2NVTK 1Y1WC 2PPBA 4KN7A 1I3QC 4Y7NK 5IP9C 1TWFK 3GTJK 2E2HK 2VUMC 4A3MK 2YU9C 2NVYC 1SFOK 4KMUA 2JA8C 3RZOC 4A93K 5IYBC 3GTOK 2NVXK 2E2JC 4X6AC 5D4DA 4BY7K 1TWAK 1TWHK 4QIWL 5IP7C 1Y1WK 1R9TC 4BBRC 2JA5K 1I3QK 2PA8L 2VUMK 2R92K 4G7OA 4OIRA 3PO3C 1I6HK 2R93K 3HKZL 2JA8K 3RZOK 4C2MK 2A6EA 5C44K 2E2JK 4X6AK 4Y7NC 4XLNA 1TWFC 1ZYRA 4LK1A 2E2HC 4A3MC 2JA6C 5IP7K 4A3CK 1SFOC 2BE5A 2O5JA 4LJZA 4A3DC 5M5WK 3GTOC 4GZYA 2NVXC 1SMYA 2Y0SL 3PO3K 5IYDK 1TWHC 4YFKA 5C3EC 2JA5C 1Y1VK 2NVQC 5M5YK 4Q4ZA 4A3KC 3GTLK 4QIWD 5FLMK 2JA6K 2R92C 1I6HC 2R93C 2PA8D 4G7ZA 4A3DK 3HOVK 4MQ9A 3GTMC 5C44C 3H3VD 3HKZD 2WB1L 3FKIC 1XPPA 4A3CC 5C3EK 1K83C 2NVQK 3GTQC 4OIOA 4A3KK 1I50K 2B63K 5IYCK 4C3IK 2PMZL 5IYDC 4AYBD 4MEXA 3S1MK 4Y52K 5M5XK 4A3IC 5M3MK 3GTMK 2Y0SD 1BDFA 1Y1VC 4A3EC 4OIQA 2CW0A 3GTLC 3S2HC 4NOIA 3FKIK 5FLMC 1K83K 4C3HK 3GTQK 1TWCK 5TMCA 3HOVC 1HQMA 3PO2K 4XSZA 3WODA 2A6HA 4BBSC 4A3IK 4ZH4A 4A3BC 4A3EK 4A3FK 2WB1D 3S2HK 4A3GC 3GTPK 4OINA 1I50C 3M4OK 2B63C 3I4MC 5IYCC 4BXXK 1IW7A 1YNNA 4LK0A 4OIPA 4Y52C 3S1MC 3RZDK 3GTGK 1I6VA 3GTKC 3HOUC 4BXXC 5FJ8K 2A68A 3CQZK 4LLGA 3S1RC 3S1QK 4BBSK 4A3BK 3HOWK 4A3GK 3H0GK 1TWCC 4KN4A 3HOZC 3S14K 3S17K 3I4MK 5C4XK 3PO2C 3K7AK 3HOUK 4YFNA 3GTKK 4A3LC 4YFXA 1WCMC 4A3FC 2O5IA 4C3JK 4XLPA 3GTPC 1TWGC 3DXJA 3S1RK 5C4JK 3M3YC 3S1NK 3M4OC 3I4NC 2WAQL 3HOXK 3RZDC 3HOZK 3GTGC 2E2IC 3S16C 4G7HA 4BY1K 2R7ZC 3HOYC 3CQZC 3S1QC 4A3LK 1WCMK 3HOWC 3H0GC 3S15K 3S14C 1TWGK 3S17C 3I4NK 3M3YK 5C4XC 4A3JC 3S2DC 3K7AC 4JK1A 2E2IK 5IP9K 4MEYA 3S16K 4XSXA 2PMZD 2YU9K 2JA7C 2NVYK 3HOYK 2R7ZK 3H3VL 3EQLA 3S1NC 4QJVB 5C4JC 2NVTC 5IYBK 5TMFA 2A69A 4YG2A 3HOXC 5M3FK 3GTJC 4A3JK
chains in the Genus database with same CATH superfamily
4BY1C 4BBRK 1O26A 1K83A 4Q5SA 2JA7K 4BLAA 1KQ4A 3AQPA 1TWAC 1USOA 4GFQA 2PPBA 4KN7A 1I3QC 5IP9C 1TWFK 2VUMC 2GSUA 2NVYC 4GT9A 4KMUA 1EK8A 1XZQB 3S0XA 5IYBC 1J6WA 3GTOK 3AD7C 1ZBSA 4BKWA 5D4DA 1TWHK 2V6TA 3AH5A 1O25A 3QX3A 4GTEA 3HKZL 2JA8K 3RZOK 1XXCA 1JOEA 4Y7NC 1ZYRA 4LK1A 4A3CK 1WIHA 3OEPA 5IYDK 4ILDA 2NVQC 4Q4ZA 4A3KC 1XZPB 5FLMK 1C0AA 1TWGA 2JA6K 3BP3A 4A3DK 1F7UA 3HOVK 4C2MC 2E2IA 2NVYA 3FKIC 3GTQC 4RMFA 2B63K 4MEXA 5M3MK 3GTMK 2Y0SD 1Y1VC 4BLBA 3S2HC 4NOIA 1WOSA 2ZUFA 4C3HK 5TMCA 3VA7A 3IPJA 3JSTA 2V6UA 2GSOA 3GSIA 4WILA 4A3FK 2WB1D 4P5AA 3GTPK 1O2FB 1I50C 3M4OK 3L4JA 1IW7A 1YNNA 3GTGK 3HOUC 3GTKC 2A68A 4M1XA 4A3BK 1TWCC 3I4MK 1J98A 5IOSA 3PO2C 2D6FC 4PAAA 1WSRA 4YFXA 3AD9C 4LR2A 5L46A 4C3JK 3ADAC 1YCLA 3S1NK 4KM8A 3S1RK 4BXXC 3HOZK 1Y1VA 3L4KA 2R7ZC 1ZXOA 3CQZC 3S1QC 1B4BA 5EGHA 1O27A 3M3YK 5C4XC 1EFWA 1IE0A 2JA5A 2PMZD 1O2BA 1I50A 2JA7C 3H3VL 3G4CA 4YG2A 1V5VA 2WAQD 1R9TK 1TWCA 1YNJA 3S15C 3FHZA 4GTDA 4A3MK 1EQRA 1SFOK 5IOTA 2JA8C 3RZOC 2NVXK 3CQZA 5JFEA 1Y1WK 2JA5K 4KC6A 2PA8L 1USMA 1G51A 2R92K 4OIRA 1I6HK 4X6AK 2E2HC 4G0UA 2JA6C 4A3DC 2CFAB 3TFHA 1SMYA 3PO3K 4FZBA 1WCMA 3A8IA 3GTLK 4WJ4A 1O28A 2Y3PA 4KMHA 2R93C 2CFAA 4MQ9A 3GTMC 5C44C 3HKZD 2RGRA 4GTLA 1XPPA 5C3EK 4KB4A 4OIOA 4P9SA 5IYCK 4C3IK 4Y52K 3S1MK 4AYBD 1XZQA 4G0WA 5M5XK 1BDFA 4OIQA 2CW0A 3HXAA 1K83K 1JQWA 1HQMA 3GTJA 2E2HA 3WODA 3TFIA 2A6HA 1INNA 4A3BC 4A3EK 1XXAA 3I4MC 1TWAA 4LK0A 1PJ5A 3RZDK 1I3QA 3LAJA 5FJ8K 2VUMA 4BBSK 2R93A 3S1RC 1VGXA 3HOWK 4AH6A 3HOZC 1XZPA 2PHCB 5IOQA 1F7VA 3T01A 1WOOA 4P5BA 1L0WA 3T00A 2O5IA 1VH2A 5C4JK 3M3YC 3LPXA 1PJ6A 4BY1K 4A3LK 1EI6A 2XCRB 3H0GC 2FQTA 1TWGK 3S14C 1IL2A 3S17C 3K7AC 4JK1A 2E2IK 5IP9K 2NVYK 2EBBA 5IYBK 5IORA 2XCOA 3HOXC 3N3YA 3FKIA 4A3JK 4O2DA 3GTQA 4KAWX 3G4AA 2NVTK 1Y1WC 1ZQ1C 5EGEA 4Y7NK 1IQ0A 2YU9C 4A93K 4GTCA 3GIRA 4X6AC 4BY7K 3Q3QA 4QIWL 4C45A 4BBRC 3N0CA 3H0GA 3OPFA 2W7VA 4G7OA 3PO3C 4C2MK 3GTKA 2E2JK 1VLOA 3FOFA 1TWFC 5CJ9A 5IP7K 1X31C 2BE5A 2O5JA 4LJZA 1J6VA 3GTOC 1TWHC 3GEIA 4KMDA 5C3EC 1Y1VK 3AQOA 3GDZA 3A8KA 4C3IC 2PA8D 3N0BA 1AB4A 3ERED 2R7ZA 3AD8C 4WJ3M 4A3CC 4KATA 4XCHA 1K83C 5HL8A 3BUEA 1I50K 2PMZL 5IYDC 2RH6A 4A3EC 2JA7A 2ZFZA 4KASA 5FLMC 1TWCK 3HOVC 1WQFA 1TWFA 4KDDA 4LOWA 4XSZA 3PO2K 4BBSC 4A3IK 3GTOA 3FOEA 4BXXK 2GAGC 2B63C 4GTAA 1TWHA 2XCQA 2P5MA 3TTGA 3CQZK 3S1QK 4J3NA 4C3HC 4A3GK 4KN4A 4GTFA 5C4XK 1VJEA 1DCPA 4YFNA 4A3LC 4A3FC 4XLPA 3GTPC 3M4OC 1TWGC 2KWAA 1HI9A 4G0VA 3GTGC 1DCHA 2E2IC 1JVIA 4G7HA 2FQOA 2JA6A 5TJ3A 1WCMK 3V4GA 3S15K 3I4NK 4A3JC 1WOPA 4MEYA 3S16K 2B63A 3HOYK 4C3JC 3S1NC 4QJVB 2NVTC 2ZUEA 2A69A 2GAHC 3GTMA 5M3FK 2V6SA 2P8TA 2JH3A 3S2DK 4AYBL 4A93C 4BY7C 1J6XA 4QJVA 1DCOA 2E2HK 3GTJK 3GTPA 1WQHA 4KARA 3GTGA 2E2JC 1O24A 1WSVA 3SZYA 1TWAK 4DDQA 1F93A 3CAGA 5IP7C 1R9TC 1I3QK 2VUMK 1VRQC 4LQYA 2R93K 2A6EA 3MMLB 5C44K 4XLNA 3NUHA 4A3MC 1BS2A 3TFJA 1SFOC 3GEEA 5M5WK 4GZYA 2NVXC 2Y0SL 4YFKA 2JA5C 1BJTA 5M5YK 4QIWD 2R92C 1I6HC 4G7ZA 1O2AA 1WORA 3H3VD 2WB1L 2NVQK 3SZZA 4A3KK 1F9NA 4FM9A 1R9TA 4A3IC 1DD5A 1RU0A 3GTLC 5CHPA 3FKIK 5E68A 3GTQK 1UV7A 1SFOA 1YX2A 4KB2A 4ZH4A 4A3GC 3S2HK 2NVXA 2GSNA 4KMAA 4OINA 5IYCC 4OIPA 4Y52C 3S1MC 1Y1WA 1XXBA 1IS1A 1ISEA 1I6VA 2YU9A 2R92A 4GTBA 4LLGA 1IBAA 1EH1A 3H0GK 3S14K 3S17K 5JVOA 3K7AK 3HOUK 1BGWA 3GTKK 1PJ7A 4PABA 1WCMC 3LAPA 3DXJA 3I4NC 1ZVUA 3GEHA 2WAQL 3HOXK 3OREA 3RZDC 3GTLA 3S16C 1B4AA 3HOYC 4KM9A 3BP8C 1O29A 3T02A 3A8JA 3HOWC 1GE9A 3S2DC 4XSXA 2YU9K 2R7ZK 1WQGA 3EQLA 5C4JC 5TMFA 3GTJC
chains in the Genus database with same CATH topology
2WAQD 1R9TK 4BY1C 4BBRK 3S2DK 4Q5SA 4AYBL 4A93C 2JA7K 1YNJA 3S15C 4BY7C 1TWAC 4QJVA 2NVTK 1Y1WC 2PPBA 4KN7A 1I3QC 4Y7NK 5IP9C 1TWFK 3GTJK 2E2HK 2VUMC 4A3MK 2YU9C 2NVYC 1SFOK 4KMUA 2JA8C 3RZOC 4A93K 5IYBC 3GTOK 2NVXK 2E2JC 4X6AC 5D4DA 4BY7K 1TWAK 1TWHK 4QIWL 5IP7C 1Y1WK 1R9TC 4BBRC 2JA5K 1I3QK 2PA8L 2VUMK 2R92K 4G7OA 4OIRA 3PO3C 1I6HK 2R93K 3HKZL 2JA8K 3RZOK 4C2MK 2A6EA 5C44K 2E2JK 4X6AK 4Y7NC 4XLNA 1TWFC 1ZYRA 4LK1A 2E2HC 4A3MC 2JA6C 5IP7K 4A3CK 1SFOC 2BE5A 2O5JA 4LJZA 4A3DC 5M5WK 3GTOC 4GZYA 2NVXC 1SMYA 2Y0SL 3PO3K 5IYDK 1TWHC 4YFKA 5C3EC 2JA5C 1Y1VK 2NVQC 5M5YK 4Q4ZA 4A3KC 3GTLK 4QIWD 5FLMK 2JA6K 2R92C 1I6HC 2R93C 2PA8D 4G7ZA 4A3DK 3HOVK 4MQ9A 3GTMC 5C44C 3H3VD 3HKZD 2WB1L 3FKIC 1XPPA 4A3CC 5C3EK 1K83C 2NVQK 3GTQC 4OIOA 4A3KK 1I50K 2B63K 5IYCK 4C3IK 2PMZL 5IYDC 4AYBD 4MEXA 3S1MK 4Y52K 5M5XK 4A3IC 5M3MK 3GTMK 2Y0SD 1BDFA 1Y1VC 4A3EC 4OIQA 2CW0A 3GTLC 3S2HC 4NOIA 3FKIK 5FLMC 1K83K 4C3HK 3GTQK 1TWCK 5TMCA 3HOVC 1HQMA 3PO2K 4XSZA 3WODA 2A6HA 4BBSC 4A3IK 4ZH4A 4A3BC 4A3EK 4A3FK 2WB1D 3S2HK 4A3GC 3GTPK 4OINA 1I50C 3M4OK 2B63C 3I4MC 5IYCC 4BXXK 1IW7A 1YNNA 4LK0A 4OIPA 4Y52C 3S1MC 3RZDK 3GTGK 1I6VA 3GTKC 3HOUC 4BXXC 5FJ8K 2A68A 3CQZK 4LLGA 3S1RC 3S1QK 4BBSK 4A3BK 3HOWK 4A3GK 3H0GK 1TWCC 4KN4A 3HOZC 3S14K 3S17K 3I4MK 5C4XK 3PO2C 3K7AK 3HOUK 4YFNA 3GTKK 4A3LC 4YFXA 1WCMC 4A3FC 2O5IA 4C3JK 4XLPA 3GTPC 1TWGC 3DXJA 3S1RK 5C4JK 3M3YC 3S1NK 3M4OC 3I4NC 2WAQL 3HOXK 3RZDC 3HOZK 3GTGC 2E2IC 3S16C 4G7HA 4BY1K 2R7ZC 3HOYC 3CQZC 3S1QC 4A3LK 1WCMK 3HOWC 3H0GC 3S15K 3S14C 1TWGK 3S17C 3I4NK 3M3YK 5C4XC 4A3JC 3S2DC 3K7AC 4JK1A 2E2IK 5IP9K 4MEYA 3S16K 4XSXA 2PMZD 2YU9K 2JA7C 2NVYK 3HOYK 2R7ZK 3H3VL 3EQLA 3S1NC 4QJVB 5C4JC 2NVTC 5IYBK 5TMFA 2A69A 4YG2A 3HOXC 5M3FK 3GTJC 4A3JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ D;  1R9T K;  4BY1 C;  4BBR K;  3S2D K;  4Q5S A;  4AYB L;  4A93 C;  2JA7 K;  1YNJ A;  3S15 C;  4BY7 C;  1TWA C;  4QJV A;  2NVT K;  1Y1W C;  2PPB A;  4KN7 A;  1I3Q C;  4Y7N K;  5IP9 C;  1TWF K;  3GTJ K;  2E2H K;  2VUM C;  4A3M K;  2YU9 C;  2NVY C;  1SFO K;  4KMU A;  2JA8 C;  3RZO C;  4A93 K;  5IYB C;  3GTO K;  2NVX K;  2E2J C;  4X6A C;  5D4D A;  4BY7 K;  1TWA K;  1TWH K;  4QIW L;  5IP7 C;  1Y1W K;  1R9T C;  4BBR C;  2JA5 K;  1I3Q K;  2PA8 L;  2VUM K;  2R92 K;  4G7O A;  4OIR A;  3PO3 C;  1I6H K;  2R93 K;  3HKZ L;  2JA8 K;  3RZO K;  4C2M K;  2A6E A;  5C44 K;  2E2J K;  4X6A K;  4Y7N C;  4XLN A;  1TWF C;  1ZYR A;  4LK1 A;  2E2H C;  4A3M C;  2JA6 C;  5IP7 K;  4A3C K;  1SFO C;  2BE5 A;  2O5J A;  4LJZ A;  4A3D C;  5M5W K;  3GTO C;  4GZY A;  2NVX C;  1SMY A;  2Y0S L;  3PO3 K;  5IYD K;  1TWH C;  4YFK A;  5C3E C;  2JA5 C;  1Y1V K;  2NVQ C;  5M5Y K;  4Q4Z A;  4A3K C;  3GTL K;  4QIW D;  5FLM K;  2JA6 K;  2R92 C;  1I6H C;  2R93 C;  2PA8 D;  4G7Z A;  4A3D K;  3HOV K;  4MQ9 A;  3GTM C;  5C44 C;  3H3V D;  3HKZ D;  2WB1 L;  3FKI C;  1XPP A;  4A3C C;  5C3E K;  1K83 C;  2NVQ K;  3GTQ C;  4OIO A;  4A3K K;  1I50 K;  2B63 K;  5IYC K;  4C3I K;  2PMZ L;  5IYD C;  4AYB D;  4MEX A;  3S1M K;  4Y52 K;  5M5X K;  4A3I C;  5M3M K;  3GTM K;  2Y0S D;  1BDF A;  1Y1V C;  4A3E C;  4OIQ A;  2CW0 A;  3GTL C;  3S2H C;  4NOI A;  3FKI K;  5FLM C;  1K83 K;  4C3H K;  3GTQ K;  1TWC K;  5TMC A;  3HOV C;  1HQM A;  3PO2 K;  4XSZ A;  3WOD A;  2A6H A;  4BBS C;  4A3I K;  4ZH4 A;  4A3B C;  4A3E K;  4A3F K;  2WB1 D;  3S2H K;  4A3G C;  3GTP K;  4OIN A;  1I50 C;  3M4O K;  2B63 C;  3I4M C;  5IYC C;  4BXX K;  1IW7 A;  1YNN A;  4LK0 A;  4OIP A;  4Y52 C;  3S1M C;  3RZD K;  3GTG K;  1I6V A;  3GTK C;  3HOU C;  4BXX C;  5FJ8 K;  2A68 A;  3CQZ K;  4LLG A;  3S1R C;  3S1Q K;  4BBS K;  4A3B K;  3HOW K;  4A3G K;  3H0G K;  1TWC C;  4KN4 A;  3HOZ C;  3S14 K;  3S17 K;  3I4M K;  5C4X K;  3PO2 C;  3K7A K;  3HOU K;  4YFN A;  3GTK K;  4A3L C;  4YFX A;  1WCM C;  4A3F C;  2O5I A;  4C3J K;  4XLP A;  3GTP C;  1TWG C;  3DXJ A;  3S1R K;  5C4J K;  3M3Y C;  3S1N K;  3M4O C;  3I4N C;  2WAQ L;  3HOX K;  3RZD C;  3HOZ K;  3GTG C;  2E2I C;  3S16 C;  4G7H A;  4BY1 K;  2R7Z C;  3HOY C;  3CQZ C;  3S1Q C;  4A3L K;  1WCM K;  3HOW C;  3H0G C;  3S15 K;  3S14 C;  1TWG K;  3S17 C;  3I4N K;  3M3Y K;  5C4X C;  4A3J C;  3S2D C;  3K7A C;  4JK1 A;  2E2I K;  5IP9 K;  4MEY A;  3S16 K;  4XSX A;  2PMZ D;  2YU9 K;  2JA7 C;  2NVY K;  3HOY K;  2R7Z K;  3H3V L;  3EQL A;  3S1N C;  4QJV B;  5C4J C;  2NVT C;  5IYB K;  5TMF A;  2A69 A;  4YG2 A;  3HOX C;  5M3F K;  3GTJ C;  4A3J K; 
#chains in the Genus database with same CATH topology
 4BY1 C;  4BBR K;  1O26 A;  1K83 A;  4Q5S A;  2JA7 K;  4BLA A;  1KQ4 A;  3AQP A;  1TWA C;  1USO A;  4GFQ A;  2PPB A;  4KN7 A;  1I3Q C;  5IP9 C;  1TWF K;  2VUM C;  2GSU A;  2NVY C;  4GT9 A;  4KMU A;  1EK8 A;  1XZQ B;  3S0X A;  5IYB C;  1J6W A;  3GTO K;  3AD7 C;  1ZBS A;  4BKW A;  5D4D A;  1TWH K;  2V6T A;  3AH5 A;  1O25 A;  3QX3 A;  4GTE A;  3HKZ L;  2JA8 K;  3RZO K;  1XXC A;  1JOE A;  4Y7N C;  1ZYR A;  4LK1 A;  4A3C K;  1WIH A;  3OEP A;  5IYD K;  4ILD A;  2NVQ C;  4Q4Z A;  4A3K C;  1XZP B;  5FLM K;  1C0A A;  1TWG A;  2JA6 K;  3BP3 A;  4A3D K;  1F7U A;  3HOV K;  4C2M C;  2E2I A;  2NVY A;  3FKI C;  3GTQ C;  4RMF A;  2B63 K;  4MEX A;  5M3M K;  3GTM K;  2Y0S D;  1Y1V C;  4BLB A;  3S2H C;  4NOI A;  1WOS A;  2ZUF A;  4C3H K;  5TMC A;  3VA7 A;  3IPJ A;  3JST A;  2V6U A;  2GSO A;  3GSI A;  4WIL A;  4A3F K;  2WB1 D;  4P5A A;  3GTP K;  1O2F B;  1I50 C;  3M4O K;  3L4J A;  1IW7 A;  1YNN A;  3GTG K;  3HOU C;  3GTK C;  2A68 A;  4M1X A;  4A3B K;  1TWC C;  3I4M K;  1J98 A;  5IOS A;  3PO2 C;  2D6F C;  4PAA A;  1WSR A;  4YFX A;  3AD9 C;  4LR2 A;  5L46 A;  4C3J K;  3ADA C;  1YCL A;  3S1N K;  4KM8 A;  3S1R K;  4BXX C;  3HOZ K;  1Y1V A;  3L4K A;  2R7Z C;  1ZXO A;  3CQZ C;  3S1Q C;  1B4B A;  5EGH A;  1O27 A;  3M3Y K;  5C4X C;  1EFW A;  1IE0 A;  2JA5 A;  2PMZ D;  1O2B A;  1I50 A;  2JA7 C;  3H3V L;  3G4C A;  4YG2 A;  1V5V A;  2WAQ D;  1R9T K;  1TWC A;  1YNJ A;  3S15 C;  3FHZ A;  4GTD A;  4A3M K;  1EQR A;  1SFO K;  5IOT A;  2JA8 C;  3RZO C;  2NVX K;  3CQZ A;  5JFE A;  1Y1W K;  2JA5 K;  4KC6 A;  2PA8 L;  1USM A;  1G51 A;  2R92 K;  4OIR A;  1I6H K;  4X6A K;  2E2H C;  4G0U A;  2JA6 C;  4A3D C;  2CFA B;  3TFH A;  1SMY A;  3PO3 K;  4FZB A;  1WCM A;  3A8I A;  3GTL K;  4WJ4 A;  1O28 A;  2Y3P A;  4KMH A;  2R93 C;  2CFA A;  4MQ9 A;  3GTM C;  5C44 C;  3HKZ D;  2RGR A;  4GTL A;  1XPP A;  5C3E K;  4KB4 A;  4OIO A;  4P9S A;  5IYC K;  4C3I K;  4Y52 K;  3S1M K;  4AYB D;  1XZQ A;  4G0W A;  5M5X K;  1BDF A;  4OIQ A;  2CW0 A;  3HXA A;  1K83 K;  1JQW A;  1HQM A;  3GTJ A;  2E2H A;  3WOD A;  3TFI A;  2A6H A;  1INN A;  4A3B C;  4A3E K;  1XXA A;  3I4M C;  1TWA A;  4LK0 A;  1PJ5 A;  3RZD K;  1I3Q A;  3LAJ A;  5FJ8 K;  2VUM A;  4BBS K;  2R93 A;  3S1R C;  1VGX A;  3HOW K;  4AH6 A;  3HOZ C;  1XZP A;  2PHC B;  5IOQ A;  1F7V A;  3T01 A;  1WOO A;  4P5B A;  1L0W A;  3T00 A;  2O5I A;  1VH2 A;  5C4J K;  3M3Y C;  3LPX A;  1PJ6 A;  4BY1 K;  4A3L K;  1EI6 A;  2XCR B;  3H0G C;  2FQT A;  1TWG K;  3S14 C;  1IL2 A;  3S17 C;  3K7A C;  4JK1 A;  2E2I K;  5IP9 K;  2NVY K;  2EBB A;  5IYB K;  5IOR A;  2XCO A;  3HOX C;  3N3Y A;  3FKI A;  4A3J K;  4O2D A;  3GTQ A;  4KAW X;  3G4A A;  2NVT K;  1Y1W C;  1ZQ1 C;  5EGE A;  4Y7N K;  1IQ0 A;  2YU9 C;  4A93 K;  4GTC A;  3GIR A;  4X6A C;  4BY7 K;  3Q3Q A;  4QIW L;  4C45 A;  4BBR C;  3N0C A;  3H0G A;  3OPF A;  2W7V A;  4G7O A;  3PO3 C;  4C2M K;  3GTK A;  2E2J K;  1VLO A;  3FOF A;  1TWF C;  5CJ9 A;  5IP7 K;  1X31 C;  2BE5 A;  2O5J A;  4LJZ A;  1J6V A;  3GTO C;  1TWH C;  3GEI A;  4KMD A;  5C3E C;  1Y1V K;  3AQO A;  3GDZ A;  3A8K A;  4C3I C;  2PA8 D;  3N0B A;  1AB4 A;  3ERE D;  2R7Z A;  3AD8 C;  4WJ3 M;  4A3C C;  4KAT A;  4XCH A;  1K83 C;  5HL8 A;  3BUE A;  1I50 K;  2PMZ L;  5IYD C;  2RH6 A;  4A3E C;  2JA7 A;  2ZFZ A;  4KAS A;  5FLM C;  1TWC K;  3HOV C;  1WQF A;  1TWF A;  4KDD A;  4LOW A;  4XSZ A;  3PO2 K;  4BBS C;  4A3I K;  3GTO A;  3FOE A;  4BXX K;  2GAG C;  2B63 C;  4GTA A;  1TWH A;  2XCQ A;  2P5M A;  3TTG A;  3CQZ K;  3S1Q K;  4J3N A;  4C3H C;  4A3G K;  4KN4 A;  4GTF A;  5C4X K;  1VJE A;  1DCP A;  4YFN A;  4A3L C;  4A3F C;  4XLP A;  3GTP C;  3M4O C;  1TWG C;  2KWA A;  1HI9 A;  4G0V A;  3GTG C;  1DCH A;  2E2I C;  1JVI A;  4G7H A;  2FQO A;  2JA6 A;  5TJ3 A;  1WCM K;  3V4G A;  3S15 K;  3I4N K;  4A3J C;  1WOP A;  4MEY A;  3S16 K;  2B63 A;  3HOY K;  4C3J C;  3S1N C;  4QJV B;  2NVT C;  2ZUE A;  2A69 A;  2GAH C;  3GTM A;  5M3F K;  2V6S A;  2P8T A;  2JH3 A;  3S2D K;  4AYB L;  4A93 C;  4BY7 C;  1J6X A;  4QJV A;  1DCO A;  2E2H K;  3GTJ K;  3GTP A;  1WQH A;  4KAR A;  3GTG A;  2E2J C;  1O24 A;  1WSV A;  3SZY A;  1TWA K;  4DDQ A;  1F93 A;  3CAG A;  5IP7 C;  1R9T C;  1I3Q K;  2VUM K;  1VRQ C;  4LQY A;  2R93 K;  2A6E A;  3MML B;  5C44 K;  4XLN A;  3NUH A;  4A3M C;  1BS2 A;  3TFJ A;  1SFO C;  3GEE A;  5M5W K;  4GZY A;  2NVX C;  2Y0S L;  4YFK A;  2JA5 C;  1BJT A;  5M5Y K;  4QIW D;  2R92 C;  1I6H C;  4G7Z A;  1O2A A;  1WOR A;  3H3V D;  2WB1 L;  2NVQ K;  3SZZ A;  4A3K K;  1F9N A;  4FM9 A;  1R9T A;  4A3I C;  1DD5 A;  1RU0 A;  3GTL C;  5CHP A;  3FKI K;  5E68 A;  3GTQ K;  1UV7 A;  1SFO A;  1YX2 A;  4KB2 A;  4ZH4 A;  4A3G C;  3S2H K;  2NVX A;  2GSN A;  4KMA A;  4OIN A;  5IYC C;  4OIP A;  4Y52 C;  3S1M C;  1Y1W A;  1XXB A;  1IS1 A;  1ISE A;  1I6V A;  2YU9 A;  2R92 A;  4GTB A;  4LLG A;  1IBA A;  1EH1 A;  3H0G K;  3S14 K;  3S17 K;  5JVO A;  3K7A K;  3HOU K;  1BGW A;  3GTK K;  1PJ7 A;  4PAB A;  1WCM C;  3LAP A;  3DXJ A;  3I4N C;  1ZVU A;  3GEH A;  2WAQ L;  3HOX K;  3ORE A;  3RZD C;  3GTL A;  3S16 C;  1B4A A;  3HOY C;  4KM9 A;  3BP8 C;  1O29 A;  3T02 A;  3A8J A;  3HOW C;  1GE9 A;  3S2D C;  4XSX A;  2YU9 K;  2R7Z K;  1WQG A;  3EQL A;  5C4J C;  5TMF A;  3GTJ C; 
#chains in the Genus database with same CATH homology
 2WAQ D;  1R9T K;  4BY1 C;  4BBR K;  3S2D K;  4Q5S A;  4AYB L;  4A93 C;  2JA7 K;  1YNJ A;  3S15 C;  4BY7 C;  1TWA C;  4QJV A;  2NVT K;  1Y1W C;  2PPB A;  4KN7 A;  1I3Q C;  4Y7N K;  5IP9 C;  1TWF K;  3GTJ K;  2E2H K;  2VUM C;  4A3M K;  2YU9 C;  2NVY C;  1SFO K;  4KMU A;  2JA8 C;  3RZO C;  4A93 K;  5IYB C;  3GTO K;  2NVX K;  2E2J C;  4X6A C;  5D4D A;  4BY7 K;  1TWA K;  1TWH K;  4QIW L;  5IP7 C;  1Y1W K;  1R9T C;  4BBR C;  2JA5 K;  1I3Q K;  2PA8 L;  2VUM K;  2R92 K;  4G7O A;  4OIR A;  3PO3 C;  1I6H K;  2R93 K;  3HKZ L;  2JA8 K;  3RZO K;  4C2M K;  2A6E A;  5C44 K;  2E2J K;  4X6A K;  4Y7N C;  4XLN A;  1TWF C;  1ZYR A;  4LK1 A;  2E2H C;  4A3M C;  2JA6 C;  5IP7 K;  4A3C K;  1SFO C;  2BE5 A;  2O5J A;  4LJZ A;  4A3D C;  5M5W K;  3GTO C;  4GZY A;  2NVX C;  1SMY A;  2Y0S L;  3PO3 K;  5IYD K;  1TWH C;  4YFK A;  5C3E C;  2JA5 C;  1Y1V K;  2NVQ C;  5M5Y K;  4Q4Z A;  4A3K C;  3GTL K;  4QIW D;  5FLM K;  2JA6 K;  2R92 C;  1I6H C;  2R93 C;  2PA8 D;  4G7Z A;  4A3D K;  3HOV K;  4MQ9 A;  3GTM C;  5C44 C;  3H3V D;  3HKZ D;  2WB1 L;  3FKI C;  1XPP A;  4A3C C;  5C3E K;  1K83 C;  2NVQ K;  3GTQ C;  4OIO A;  4A3K K;  1I50 K;  2B63 K;  5IYC K;  4C3I K;  2PMZ L;  5IYD C;  4AYB D;  4MEX A;  3S1M K;  4Y52 K;  5M5X K;  4A3I C;  5M3M K;  3GTM K;  2Y0S D;  1BDF A;  1Y1V C;  4A3E C;  4OIQ A;  2CW0 A;  3GTL C;  3S2H C;  4NOI A;  3FKI K;  5FLM C;  1K83 K;  4C3H K;  3GTQ K;  1TWC K;  5TMC A;  3HOV C;  1HQM A;  3PO2 K;  4XSZ A;  3WOD A;  2A6H A;  4BBS C;  4A3I K;  4ZH4 A;  4A3B C;  4A3E K;  4A3F K;  2WB1 D;  3S2H K;  4A3G C;  3GTP K;  4OIN A;  1I50 C;  3M4O K;  2B63 C;  3I4M C;  5IYC C;  4BXX K;  1IW7 A;  1YNN A;  4LK0 A;  4OIP A;  4Y52 C;  3S1M C;  3RZD K;  3GTG K;  1I6V A;  3GTK C;  3HOU C;  4BXX C;  5FJ8 K;  2A68 A;  3CQZ K;  4LLG A;  3S1R C;  3S1Q K;  4BBS K;  4A3B K;  3HOW K;  4A3G K;  3H0G K;  1TWC C;  4KN4 A;  3HOZ C;  3S14 K;  3S17 K;  3I4M K;  5C4X K;  3PO2 C;  3K7A K;  3HOU K;  4YFN A;  3GTK K;  4A3L C;  4YFX A;  1WCM C;  4A3F C;  2O5I A;  4C3J K;  4XLP A;  3GTP C;  1TWG C;  3DXJ A;  3S1R K;  5C4J K;  3M3Y C;  3S1N K;  3M4O C;  3I4N C;  2WAQ L;  3HOX K;  3RZD C;  3HOZ K;  3GTG C;  2E2I C;  3S16 C;  4G7H A;  4BY1 K;  2R7Z C;  3HOY C;  3CQZ C;  3S1Q C;  4A3L K;  1WCM K;  3HOW C;  3H0G C;  3S15 K;  3S14 C;  1TWG K;  3S17 C;  3I4N K;  3M3Y K;  5C4X C;  4A3J C;  3S2D C;  3K7A C;  4JK1 A;  2E2I K;  5IP9 K;  4MEY A;  3S16 K;  4XSX A;  2PMZ D;  2YU9 K;  2JA7 C;  2NVY K;  3HOY K;  2R7Z K;  3H3V L;  3EQL A;  3S1N C;  4QJV B;  5C4J C;  2NVT C;  5IYB K;  5TMF A;  2A69 A;  4YG2 A;  3HOX C;  5M3F K;  3GTJ C;  4A3J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...