3S16K

Rna polymerase ii initiation complex with an 8-nt rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s16K00
3M4OK 3HOWC 4A3LK 3M4OC 4A3LC 2WB1D 3CQZK 3S1NK 3S14K 3CQZC 4BBRK 3S1NC 3S14C 4LLGA 4BBRC 3HOUK 4KN4A 4QIWL 5TMFA 1I6VA 4JK1A 3HOUC 3PO2K 2JA7K 1R9TK 3H3VL 3I4MK 2PA8D 1R9TC 2JA7C 3I4MC 2VUMK 5M5XK 2NVQK 1XPPA 2VUMC 2NVQC 3HOYK 4C3HK 4A3EK 4KN7A 3HOYC 2B63K 4A3EC 4NOIA 4BY1K 3K7AK 2B63C 2A68A 4BY1C 3K7AC 2JA5K 4XLNA 4G7ZA 2JA5C 4LK1A 5FJ8K 4MEXA 5IYBK 4YFKA 2E2IK 3HOZK 3S2DK 4OIPA 5IYBC 2E2IC 3HOZC 3S2DC 5IYDK 4A3IK 5IYDC 2PMZD 4MEYA 4A3IC 2R93K 1K83K 1K83C 5IP7K 2NVXK 5IP7C 2NVXC 4YG2A 1TWFK 2PMZL 3GTMK 5C44K 1TWFC 4G7OA 2WB1L 4Q5SA 3GTMC 5C44C 2R92K 2R92C 4XSZA 4A3GK 4AYBD 4A93K 4A3BK 3HOXK 1WCMK 1TWAK 4Q4ZA 4A93C 4A3GC 4A3BC 3HOXC 1WCMC 1TWAC 2CW0A 4A3FK 4BBSK 4A3FC 3RZDK 4ZH4A 2PA8L 4BBSC 3HKZD 3RZDC 1SFOK 2A6HA 2JA6K 2NVYK 1SFOC 2NVTK 2JA6C 2NVYC 2JA8K 2NVTC 2WAQD 2JA8C 4A3MK 3DXJA 4A3MC 4X6AC 3I4NC 1YNJA 4A3JK 2YU9K 3GTKK 2R93C 1I3QK 4A3JC 2YU9C 3GTKC 3S1MK 1I3QC 3S1MC 4C3JK 5M3FK 2BE5A 4G7HA 1Y1WK 5TMCA 3RZOK 4OIRA 1Y1WC 1I50K 3RZOC 1I50C 4Y7NK 3GTJK 3S1RK 1TWGK 3HOVK 3GTJC 4Y7NC 3S1RC 3HOVC 1TWGC 3S17K 5M3MK 3S17C 5D4DA 4LK0A 4QJVB 3PO3K 2E2HK 3PO3C 2Y0SD 4XLPA 2E2HC 3S2HK 3S1QK 3S2HC 3S1QC 4A3CK 4BY7K 5IP9K 5IYCC 4A3CC 4BY7C 5IP9C 4AYBL 2O5IA 4MQ9A 2Y0SL 1Y1VK 1I6HK 3H3VD 3I4NK 4X6AK 1Y1VC 2R7ZK 1I6HC 3HKZL 4YFXA 2R7ZC 2A69A 4GZYA 5C3EK 4C3IK 4C2MK 1HQMA 2A6EA 5FLMK 5C3EC 2WAQL 3FKIK 4OIQA 3GTPK 3PO2C 5FLMC 3GTPC 3S16K 3FKIC 1IW7A 1SMYA 4YFNA 3S15K 3S16C 2E2JK 3S15C 1TWHK 3GTLK 1YNNA 2E2JC 3EQLA 1TWHC 3GTLC 5M5YK 4OINA 3H0GK 1TWCK 3GTGK 2O5JA 4A3KK 4KMUA 3H0GC 1TWCC 3GTGC 4BXXK 4A3DK 4A3KC 4BXXC 5C4JK 4A3DC 4Y52K 2PPBA 3GTQK 4Y52C 5C4JC 3GTQC 3WODA 4QJVA 4XSXA 1ZYRA 4OIOA 3GTOK 4LJZA 5IYCK 5M5WK 3GTOC 1BDFA 5C4XK 3M3YK 3M3YC 5C4XC 4QIWD 3HOWK
chains in the Genus database with same CATH superfamily
2GSUA 3M4OK 1WQGA 3IPJA 4M1XA 4KASA 3CQZK 2GSNA 4KMAA 1JQWA 4BBRC 4GTLA 4KN4A 2YU9A 3OPFA 3TFHA 2JA7K 1XZQA 1R9TC 1Y1WA 2CFAA 3H0GA 1TWCA 4C3HC 2GSOA 3HOYC 4NOIA 4BY1K 1ISEA 1IBAA 4G7ZA 3LAJA 4YFKA 3S0XA 1IL2A 4OIPA 1EFWA 4RMFA 4FM9A 1ZXOA 3A8KA 3GEHA 5IYDC 3TTGA 3SZYA 1L0WA 3T01A 3GTPA 3BUEA 3FKIA 4Q5SA 1TWFC 3GTMC 5C44C 4KM8A 2R92C 4XSZA 4A3GK 2ZUEA 4A93C 4A3BC 1B4AA 4A3FC 3RZDK 4ZH4A 2NVYK 2JA8K 3DXJA 4A3MC 1PJ5A 3GTKK 1I3QK 4A3JC 3S1MK 4G7HA 5TMCA 1I50C 3GTJK 2RGRA 1TWGK 1R9TA 3S1RC 3S17K 1USMA 4LK0A 5CHPA 4QJVB 2R93A 3FOEA 2E2HK 1WCMA 3PO3C 2Y0SD 4XLPA 3T00A 4BLAA 2Y3PA 4A3CK 5IP9K 1EK8A 1Y1VK 1I6HK 4X6AK 2R7ZC 3AQPA 1O25A 1XXBA 4C3IK 1HQMA 5C3EC 4YFNA 1SMYA 3S16C 3S15C 1TWHK 1XXAA 3EQLA 3GTLC 1TWFA 4KARA 2O5JA 3GTMA 3H0GC 1TWCC 3GTGC 2PPBA 1YCLA 5C4JC 2V6TA 5IORA 4QJVA 1VGXA 4OIOA 1DCPA 1EQRA 4LJZA 5IYCK 3M3YK 3LPXA 1WOSA 3HOWC 4A3LK 3NUHA 1USOA 3S1NK 3S14C 3HOUK 4QIWL 1I6VA 3AD8C 4GTEA 3I4MC 3JSTA 2XCQA 5M5XK 4LOWA 2NVQK 1I50A 2VUMC 5L46A 4A3EK 4LQYA 2B63C 3K7AC 3GTQA 4XLNA 2JA5C 2GAGC 3A8IA 1J6XA 4C45A 5IYBK 4MEXA 2E2IK 3HOZK 3S2DC 4KM9A 4GTDA 4GT9A 4A3IK 1DD5A 1K83K 1JVIA 3CQZA 5IP7K 2R7ZA 2NVXC 4YG2A 3AD9C 1F93A 2RH6A 2PMZL 4O2DA 4G7OA 3QX3A 3GTLA 4AYBD 2R93C 3HOXC 1WCMC 1TWAC 1ZBSA 3GTGA 1WSRA 4BBSK 4GTFA 1J98A 3BP3A 3VA7A 3FHZA 1B4BA 5E68A 2JA6K 1O26A 3GEIA 1SFOC 1O2AA 1X31C 2KWAA 2NVTC 2WAQD 3GDZA 4X6AC 1YNJA 3ERED 2YU9K 4C3JK 1Y1WK 3RZOK 1J6VA 3FOFA 1WQHA 4Y7NK 1PJ6A 4KC6A 3HOVC 1HI9A 1IE0A 5D4DA 2VUMA 5IOQA 3S2HK 3S1QK 2B63A 3A8JA 4BY7K 5IYCC 2JA5A 4AYBL 2NVYA 1GE9A 2ZUFA 4MQ9A 1IQ0A 3H3VD 2P5MA 3N0BA 4GZYA 3GTPK 2WAQL 3FKIK 4C2MC 5FLMC 1IW7A 2NVXA 2E2JC 5M5YK 3L4KA 4OINA 4A3KC 4BXXC 3GEEA 4A3DC 3ADAC 4Y52C 3G4AA 3GTQC 1TWAA 3WODA 3AH5A 4G0WA 1C0AA 5M5WK 3GTOC 1SFOA 5C4XC 4QIWD 5IOSA 1Y1VA 3M4OC 1VLOA 3CQZC 4BBRK 5TMFA 4JK1A 3AQOA 5JVOA 1R9TK 3H3VL 2JA7C 4ILDA 1XPPA 1TWHA 3Q3QA 3HOYK 2FQTA 4C3HK 1YX2A 1O27A 4KN7A 3TFIA 4BY1C 4WJ3M 4LK1A 5FJ8K 3LAPA 5IYDK 2PMZD 4MEYA 1XXCA 4G0VA 2EBBA 4GFQA 3AD7C 1O28A 1KQ4A 1PJ7A 3V4GA 1TWFK 1UV7A 3GTMK 5C44K 2R92K 4A93K 4XCHA 4A3BK 4Q4ZA 4A3GC 4A3FK 2CW0A 4BKWA 1WOOA 3HKZD 3RZDC 4G0UA 2ZFZA 2NVYC 4KMHA 2JA8C 4A3MK 3GTOA 1F9NA 1WOPA 4A3JK 3GTKC 1IS1A 1I3QC 1K83A 3S1MC 5M3FK 1WQFA 2CFAB 4BLBA 4OIRA 4GTBA 1I50K 4J3NA 3S1RK 2JA7A 3GTJC 1TWGC 5M3MK 5EGEA 3S17C 3PO3K 4KB2A 1ZQ1C 3GIRA 5IOTA 2E2HC 4FZBA 4WILA 1JOEA 4A3CC 5IP9C 4KDDA 4KATA 2XCRB 3I4NK 1Y1VC 2R7ZK 1I6HC 2D6FC 3HKZL 4YFXA 3N0CA 5C3EK 2A6EA 4C3IC 3S16K 3S15K 5CJ9A 3GTLK 1YNNA 1TWHC 4KB4A 3TFJA 3H0GK 1TWCK 3GTGK 2PHCB 3BP8C 5C4JK 4PAAA 1VH2A 4AH6A 2GAHC 2V6SA 3M3YC 1F7VA 3HOWK 1WORA 1VJEA 1XZPB 2WB1D 4A3LC 3S14K 1WSVA 3S1NC 4LLGA 3GTKA 1I3QA 3PO2K 3HOUC 3I4MK 2PA8D 2W7VA 4GTAA 2VUMK 5JFEA 1DCHA 5HL8A 2NVQC 3OREA 1BGWA 3GTJA 1TWGA 3L4JA 2B63K 4A3EC 1O2BA 3K7AK 4P5AA 1O29A 2XCOA 2A68A 1O24A 3SZZA 2JA5K 1RU0A 2E2HA 3OEPA 1EH1A 2P8TA 5EGHA 2JH3A 3S2DK 5IYBC 2E2IC 3HOZC 4GTCA 4PABA 3GSIA 4A3IC 1K83C 2NVXK 1XZPA 3CAGA 5IP7C 1INNA 1AB4A 4LR2A 2WB1L 2R93K 4WJ4A 3HOXK 1WCMK 1TWAK 1G51A 4BBSC 2PA8L 1SFOK 3HXAA 2A6HA 2NVTK 2JA6C 3I4NC 1WIHA 2YU9C 4P5BA 2BE5A 4C3JC 4KAWX 1Y1WC 1O2FB 3RZOC 3HOVK 4Y7NC 2R92A 1ZVUA 2V6UA 1DCOA 1BS2A 4DDQA 3S2HC 1V5VA 3S1QC 4KMDA 4BY7C 2O5IA 1F7UA 1J6WA 2Y0SL 2FQOA 2E2IA 3MMLB 2A69A 4C2MK 1XZQB 5FLMK 4OIQA 3PO2C 3N3YA 3T02A 3GTPC 3FKIC 2E2JK 1VRQC 4A3KK 4KMUA 4BXXK 4A3DK 4P9SA 1BJTA 4Y52K 3GTQK 1EI6A 5TJ3A 4XSXA 1ZYRA 3GTOK 1BDFA 5C4XK 2JA6A 3G4CA
chains in the Genus database with same CATH topology
3M4OK 3HOWC 4A3LK 3M4OC 4A3LC 2WB1D 3CQZK 3S1NK 3S14K 3CQZC 4BBRK 3S1NC 3S14C 4LLGA 4BBRC 3HOUK 4KN4A 4QIWL 5TMFA 1I6VA 4JK1A 3HOUC 3PO2K 2JA7K 1R9TK 3H3VL 3I4MK 2PA8D 1R9TC 2JA7C 3I4MC 2VUMK 5M5XK 2NVQK 1XPPA 2VUMC 2NVQC 3HOYK 4C3HK 4A3EK 4KN7A 3HOYC 2B63K 4A3EC 4NOIA 4BY1K 3K7AK 2B63C 2A68A 4BY1C 3K7AC 2JA5K 4XLNA 4G7ZA 2JA5C 4LK1A 5FJ8K 4MEXA 5IYBK 4YFKA 2E2IK 3HOZK 3S2DK 4OIPA 5IYBC 2E2IC 3HOZC 3S2DC 5IYDK 4A3IK 5IYDC 2PMZD 4MEYA 4A3IC 2R93K 1K83K 1K83C 5IP7K 2NVXK 5IP7C 2NVXC 4YG2A 1TWFK 2PMZL 3GTMK 5C44K 1TWFC 4G7OA 2WB1L 4Q5SA 3GTMC 5C44C 2R92K 2R92C 4XSZA 4A3GK 4AYBD 4A93K 4A3BK 3HOXK 1WCMK 1TWAK 4Q4ZA 4A93C 4A3GC 4A3BC 3HOXC 1WCMC 1TWAC 2CW0A 4A3FK 4BBSK 4A3FC 3RZDK 4ZH4A 2PA8L 4BBSC 3HKZD 3RZDC 1SFOK 2A6HA 2JA6K 2NVYK 1SFOC 2NVTK 2JA6C 2NVYC 2JA8K 2NVTC 2WAQD 2JA8C 4A3MK 3DXJA 4A3MC 4X6AC 3I4NC 1YNJA 4A3JK 2YU9K 3GTKK 2R93C 1I3QK 4A3JC 2YU9C 3GTKC 3S1MK 1I3QC 3S1MC 4C3JK 5M3FK 2BE5A 4G7HA 1Y1WK 5TMCA 3RZOK 4OIRA 1Y1WC 1I50K 3RZOC 1I50C 4Y7NK 3GTJK 3S1RK 1TWGK 3HOVK 3GTJC 4Y7NC 3S1RC 3HOVC 1TWGC 3S17K 5M3MK 3S17C 5D4DA 4LK0A 4QJVB 3PO3K 2E2HK 3PO3C 2Y0SD 4XLPA 2E2HC 3S2HK 3S1QK 3S2HC 3S1QC 4A3CK 4BY7K 5IP9K 5IYCC 4A3CC 4BY7C 5IP9C 4AYBL 2O5IA 4MQ9A 2Y0SL 1Y1VK 1I6HK 3H3VD 3I4NK 4X6AK 1Y1VC 2R7ZK 1I6HC 3HKZL 4YFXA 2R7ZC 2A69A 4GZYA 5C3EK 4C3IK 4C2MK 1HQMA 2A6EA 5FLMK 5C3EC 2WAQL 3FKIK 4OIQA 3GTPK 3PO2C 5FLMC 3GTPC 3S16K 3FKIC 1IW7A 1SMYA 4YFNA 3S15K 3S16C 2E2JK 3S15C 1TWHK 3GTLK 1YNNA 2E2JC 3EQLA 1TWHC 3GTLC 5M5YK 4OINA 3H0GK 1TWCK 3GTGK 2O5JA 4A3KK 4KMUA 3H0GC 1TWCC 3GTGC 4BXXK 4A3DK 4A3KC 4BXXC 5C4JK 4A3DC 4Y52K 2PPBA 3GTQK 4Y52C 5C4JC 3GTQC 3WODA 4QJVA 4XSXA 1ZYRA 4OIOA 3GTOK 4LJZA 5IYCK 5M5WK 3GTOC 1BDFA 5C4XK 3M3YK 3M3YC 5C4XC 4QIWD 3HOWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O K;  3HOW C;  4A3L K;  3M4O C;  4A3L C;  2WB1 D;  3CQZ K;  3S1N K;  3S14 K;  3CQZ C;  4BBR K;  3S1N C;  3S14 C;  4LLG A;  4BBR C;  3HOU K;  4KN4 A;  4QIW L;  5TMF A;  1I6V A;  4JK1 A;  3HOU C;  3PO2 K;  2JA7 K;  1R9T K;  3H3V L;  3I4M K;  2PA8 D;  1R9T C;  2JA7 C;  3I4M C;  2VUM K;  5M5X K;  2NVQ K;  1XPP A;  2VUM C;  2NVQ C;  3HOY K;  4C3H K;  4A3E K;  4KN7 A;  3HOY C;  2B63 K;  4A3E C;  4NOI A;  4BY1 K;  3K7A K;  2B63 C;  2A68 A;  4BY1 C;  3K7A C;  2JA5 K;  4XLN A;  4G7Z A;  2JA5 C;  4LK1 A;  5FJ8 K;  4MEX A;  5IYB K;  4YFK A;  2E2I K;  3HOZ K;  3S2D K;  4OIP A;  5IYB C;  2E2I C;  3HOZ C;  3S2D C;  5IYD K;  4A3I K;  5IYD C;  2PMZ D;  4MEY A;  4A3I C;  2R93 K;  1K83 K;  1K83 C;  5IP7 K;  2NVX K;  5IP7 C;  2NVX C;  4YG2 A;  1TWF K;  2PMZ L;  3GTM K;  5C44 K;  1TWF C;  4G7O A;  2WB1 L;  4Q5S A;  3GTM C;  5C44 C;  2R92 K;  2R92 C;  4XSZ A;  4A3G K;  4AYB D;  4A93 K;  4A3B K;  3HOX K;  1WCM K;  1TWA K;  4Q4Z A;  4A93 C;  4A3G C;  4A3B C;  3HOX C;  1WCM C;  1TWA C;  2CW0 A;  4A3F K;  4BBS K;  4A3F C;  3RZD K;  4ZH4 A;  2PA8 L;  4BBS C;  3HKZ D;  3RZD C;  1SFO K;  2A6H A;  2JA6 K;  2NVY K;  1SFO C;  2NVT K;  2JA6 C;  2NVY C;  2JA8 K;  2NVT C;  2WAQ D;  2JA8 C;  4A3M K;  3DXJ A;  4A3M C;  4X6A C;  3I4N C;  1YNJ A;  4A3J K;  2YU9 K;  3GTK K;  2R93 C;  1I3Q K;  4A3J C;  2YU9 C;  3GTK C;  3S1M K;  1I3Q C;  3S1M C;  4C3J K;  5M3F K;  2BE5 A;  4G7H A;  1Y1W K;  5TMC A;  3RZO K;  4OIR A;  1Y1W C;  1I50 K;  3RZO C;  1I50 C;  4Y7N K;  3GTJ K;  3S1R K;  1TWG K;  3HOV K;  3GTJ C;  4Y7N C;  3S1R C;  3HOV C;  1TWG C;  3S17 K;  5M3M K;  3S17 C;  5D4D A;  4LK0 A;  4QJV B;  3PO3 K;  2E2H K;  3PO3 C;  2Y0S D;  4XLP A;  2E2H C;  3S2H K;  3S1Q K;  3S2H C;  3S1Q C;  4A3C K;  4BY7 K;  5IP9 K;  5IYC C;  4A3C C;  4BY7 C;  5IP9 C;  4AYB L;  2O5I A;  4MQ9 A;  2Y0S L;  1Y1V K;  1I6H K;  3H3V D;  3I4N K;  4X6A K;  1Y1V C;  2R7Z K;  1I6H C;  3HKZ L;  4YFX A;  2R7Z C;  2A69 A;  4GZY A;  5C3E K;  4C3I K;  4C2M K;  1HQM A;  2A6E A;  5FLM K;  5C3E C;  2WAQ L;  3FKI K;  4OIQ A;  3GTP K;  3PO2 C;  5FLM C;  3GTP C;  3S16 K;  3FKI C;  1IW7 A;  1SMY A;  4YFN A;  3S15 K;  3S16 C;  2E2J K;  3S15 C;  1TWH K;  3GTL K;  1YNN A;  2E2J C;  3EQL A;  1TWH C;  3GTL C;  5M5Y K;  4OIN A;  3H0G K;  1TWC K;  3GTG K;  2O5J A;  4A3K K;  4KMU A;  3H0G C;  1TWC C;  3GTG C;  4BXX K;  4A3D K;  4A3K C;  4BXX C;  5C4J K;  4A3D C;  4Y52 K;  2PPB A;  3GTQ K;  4Y52 C;  5C4J C;  3GTQ C;  3WOD A;  4QJV A;  4XSX A;  1ZYR A;  4OIO A;  3GTO K;  4LJZ A;  5IYC K;  5M5W K;  3GTO C;  1BDF A;  5C4X K;  3M3Y K;  3M3Y C;  5C4X C;  4QIW D;  3HOW K; 
#chains in the Genus database with same CATH topology
 2GSU A;  3M4O K;  1WQG A;  3IPJ A;  4M1X A;  4KAS A;  3CQZ K;  2GSN A;  4KMA A;  1JQW A;  4BBR C;  4GTL A;  4KN4 A;  2YU9 A;  3OPF A;  3TFH A;  2JA7 K;  1XZQ A;  1R9T C;  1Y1W A;  2CFA A;  3H0G A;  1TWC A;  4C3H C;  2GSO A;  3HOY C;  4NOI A;  4BY1 K;  1ISE A;  1IBA A;  4G7Z A;  3LAJ A;  4YFK A;  3S0X A;  1IL2 A;  4OIP A;  1EFW A;  4RMF A;  4FM9 A;  1ZXO A;  3A8K A;  3GEH A;  5IYD C;  3TTG A;  3SZY A;  1L0W A;  3T01 A;  3GTP A;  3BUE A;  3FKI A;  4Q5S A;  1TWF C;  3GTM C;  5C44 C;  4KM8 A;  2R92 C;  4XSZ A;  4A3G K;  2ZUE A;  4A93 C;  4A3B C;  1B4A A;  4A3F C;  3RZD K;  4ZH4 A;  2NVY K;  2JA8 K;  3DXJ A;  4A3M C;  1PJ5 A;  3GTK K;  1I3Q K;  4A3J C;  3S1M K;  4G7H A;  5TMC A;  1I50 C;  3GTJ K;  2RGR A;  1TWG K;  1R9T A;  3S1R C;  3S17 K;  1USM A;  4LK0 A;  5CHP A;  4QJV B;  2R93 A;  3FOE A;  2E2H K;  1WCM A;  3PO3 C;  2Y0S D;  4XLP A;  3T00 A;  4BLA A;  2Y3P A;  4A3C K;  5IP9 K;  1EK8 A;  1Y1V K;  1I6H K;  4X6A K;  2R7Z C;  3AQP A;  1O25 A;  1XXB A;  4C3I K;  1HQM A;  5C3E C;  4YFN A;  1SMY A;  3S16 C;  3S15 C;  1TWH K;  1XXA A;  3EQL A;  3GTL C;  1TWF A;  4KAR A;  2O5J A;  3GTM A;  3H0G C;  1TWC C;  3GTG C;  2PPB A;  1YCL A;  5C4J C;  2V6T A;  5IOR A;  4QJV A;  1VGX A;  4OIO A;  1DCP A;  1EQR A;  4LJZ A;  5IYC K;  3M3Y K;  3LPX A;  1WOS A;  3HOW C;  4A3L K;  3NUH A;  1USO A;  3S1N K;  3S14 C;  3HOU K;  4QIW L;  1I6V A;  3AD8 C;  4GTE A;  3I4M C;  3JST A;  2XCQ A;  5M5X K;  4LOW A;  2NVQ K;  1I50 A;  2VUM C;  5L46 A;  4A3E K;  4LQY A;  2B63 C;  3K7A C;  3GTQ A;  4XLN A;  2JA5 C;  2GAG C;  3A8I A;  1J6X A;  4C45 A;  5IYB K;  4MEX A;  2E2I K;  3HOZ K;  3S2D C;  4KM9 A;  4GTD A;  4GT9 A;  4A3I K;  1DD5 A;  1K83 K;  1JVI A;  3CQZ A;  5IP7 K;  2R7Z A;  2NVX C;  4YG2 A;  3AD9 C;  1F93 A;  2RH6 A;  2PMZ L;  4O2D A;  4G7O A;  3QX3 A;  3GTL A;  4AYB D;  2R93 C;  3HOX C;  1WCM C;  1TWA C;  1ZBS A;  3GTG A;  1WSR A;  4BBS K;  4GTF A;  1J98 A;  3BP3 A;  3VA7 A;  3FHZ A;  1B4B A;  5E68 A;  2JA6 K;  1O26 A;  3GEI A;  1SFO C;  1O2A A;  1X31 C;  2KWA A;  2NVT C;  2WAQ D;  3GDZ A;  4X6A C;  1YNJ A;  3ERE D;  2YU9 K;  4C3J K;  1Y1W K;  3RZO K;  1J6V A;  3FOF A;  1WQH A;  4Y7N K;  1PJ6 A;  4KC6 A;  3HOV C;  1HI9 A;  1IE0 A;  5D4D A;  2VUM A;  5IOQ A;  3S2H K;  3S1Q K;  2B63 A;  3A8J A;  4BY7 K;  5IYC C;  2JA5 A;  4AYB L;  2NVY A;  1GE9 A;  2ZUF A;  4MQ9 A;  1IQ0 A;  3H3V D;  2P5M A;  3N0B A;  4GZY A;  3GTP K;  2WAQ L;  3FKI K;  4C2M C;  5FLM C;  1IW7 A;  2NVX A;  2E2J C;  5M5Y K;  3L4K A;  4OIN A;  4A3K C;  4BXX C;  3GEE A;  4A3D C;  3ADA C;  4Y52 C;  3G4A A;  3GTQ C;  1TWA A;  3WOD A;  3AH5 A;  4G0W A;  1C0A A;  5M5W K;  3GTO C;  1SFO A;  5C4X C;  4QIW D;  5IOS A;  1Y1V A;  3M4O C;  1VLO A;  3CQZ C;  4BBR K;  5TMF A;  4JK1 A;  3AQO A;  5JVO A;  1R9T K;  3H3V L;  2JA7 C;  4ILD A;  1XPP A;  1TWH A;  3Q3Q A;  3HOY K;  2FQT A;  4C3H K;  1YX2 A;  1O27 A;  4KN7 A;  3TFI A;  4BY1 C;  4WJ3 M;  4LK1 A;  5FJ8 K;  3LAP A;  5IYD K;  2PMZ D;  4MEY A;  1XXC A;  4G0V A;  2EBB A;  4GFQ A;  3AD7 C;  1O28 A;  1KQ4 A;  1PJ7 A;  3V4G A;  1TWF K;  1UV7 A;  3GTM K;  5C44 K;  2R92 K;  4A93 K;  4XCH A;  4A3B K;  4Q4Z A;  4A3G C;  4A3F K;  2CW0 A;  4BKW A;  1WOO A;  3HKZ D;  3RZD C;  4G0U A;  2ZFZ A;  2NVY C;  4KMH A;  2JA8 C;  4A3M K;  3GTO A;  1F9N A;  1WOP A;  4A3J K;  3GTK C;  1IS1 A;  1I3Q C;  1K83 A;  3S1M C;  5M3F K;  1WQF A;  2CFA B;  4BLB A;  4OIR A;  4GTB A;  1I50 K;  4J3N A;  3S1R K;  2JA7 A;  3GTJ C;  1TWG C;  5M3M K;  5EGE A;  3S17 C;  3PO3 K;  4KB2 A;  1ZQ1 C;  3GIR A;  5IOT A;  2E2H C;  4FZB A;  4WIL A;  1JOE A;  4A3C C;  5IP9 C;  4KDD A;  4KAT A;  2XCR B;  3I4N K;  1Y1V C;  2R7Z K;  1I6H C;  2D6F C;  3HKZ L;  4YFX A;  3N0C A;  5C3E K;  2A6E A;  4C3I C;  3S16 K;  3S15 K;  5CJ9 A;  3GTL K;  1YNN A;  1TWH C;  4KB4 A;  3TFJ A;  3H0G K;  1TWC K;  3GTG K;  2PHC B;  3BP8 C;  5C4J K;  4PAA A;  1VH2 A;  4AH6 A;  2GAH C;  2V6S A;  3M3Y C;  1F7V A;  3HOW K;  1WOR A;  1VJE A;  1XZP B;  2WB1 D;  4A3L C;  3S14 K;  1WSV A;  3S1N C;  4LLG A;  3GTK A;  1I3Q A;  3PO2 K;  3HOU C;  3I4M K;  2PA8 D;  2W7V A;  4GTA A;  2VUM K;  5JFE A;  1DCH A;  5HL8 A;  2NVQ C;  3ORE A;  1BGW A;  3GTJ A;  1TWG A;  3L4J A;  2B63 K;  4A3E C;  1O2B A;  3K7A K;  4P5A A;  1O29 A;  2XCO A;  2A68 A;  1O24 A;  3SZZ A;  2JA5 K;  1RU0 A;  2E2H A;  3OEP A;  1EH1 A;  2P8T A;  5EGH A;  2JH3 A;  3S2D K;  5IYB C;  2E2I C;  3HOZ C;  4GTC A;  4PAB A;  3GSI A;  4A3I C;  1K83 C;  2NVX K;  1XZP A;  3CAG A;  5IP7 C;  1INN A;  1AB4 A;  4LR2 A;  2WB1 L;  2R93 K;  4WJ4 A;  3HOX K;  1WCM K;  1TWA K;  1G51 A;  4BBS C;  2PA8 L;  1SFO K;  3HXA A;  2A6H A;  2NVT K;  2JA6 C;  3I4N C;  1WIH A;  2YU9 C;  4P5B A;  2BE5 A;  4C3J C;  4KAW X;  1Y1W C;  1O2F B;  3RZO C;  3HOV K;  4Y7N C;  2R92 A;  1ZVU A;  2V6U A;  1DCO A;  1BS2 A;  4DDQ A;  3S2H C;  1V5V A;  3S1Q C;  4KMD A;  4BY7 C;  2O5I A;  1F7U A;  1J6W A;  2Y0S L;  2FQO A;  2E2I A;  3MML B;  2A69 A;  4C2M K;  1XZQ B;  5FLM K;  4OIQ A;  3PO2 C;  3N3Y A;  3T02 A;  3GTP C;  3FKI C;  2E2J K;  1VRQ C;  4A3K K;  4KMU A;  4BXX K;  4A3D K;  4P9S A;  1BJT A;  4Y52 K;  3GTQ K;  1EI6 A;  5TJ3 A;  4XSX A;  1ZYR A;  3GTO K;  1BDF A;  5C4X K;  2JA6 A;  3G4C A; 
#chains in the Genus database with same CATH homology
 3M4O K;  3HOW C;  4A3L K;  3M4O C;  4A3L C;  2WB1 D;  3CQZ K;  3S1N K;  3S14 K;  3CQZ C;  4BBR K;  3S1N C;  3S14 C;  4LLG A;  4BBR C;  3HOU K;  4KN4 A;  4QIW L;  5TMF A;  1I6V A;  4JK1 A;  3HOU C;  3PO2 K;  2JA7 K;  1R9T K;  3H3V L;  3I4M K;  2PA8 D;  1R9T C;  2JA7 C;  3I4M C;  2VUM K;  5M5X K;  2NVQ K;  1XPP A;  2VUM C;  2NVQ C;  3HOY K;  4C3H K;  4A3E K;  4KN7 A;  3HOY C;  2B63 K;  4A3E C;  4NOI A;  4BY1 K;  3K7A K;  2B63 C;  2A68 A;  4BY1 C;  3K7A C;  2JA5 K;  4XLN A;  4G7Z A;  2JA5 C;  4LK1 A;  5FJ8 K;  4MEX A;  5IYB K;  4YFK A;  2E2I K;  3HOZ K;  3S2D K;  4OIP A;  5IYB C;  2E2I C;  3HOZ C;  3S2D C;  5IYD K;  4A3I K;  5IYD C;  2PMZ D;  4MEY A;  4A3I C;  2R93 K;  1K83 K;  1K83 C;  5IP7 K;  2NVX K;  5IP7 C;  2NVX C;  4YG2 A;  1TWF K;  2PMZ L;  3GTM K;  5C44 K;  1TWF C;  4G7O A;  2WB1 L;  4Q5S A;  3GTM C;  5C44 C;  2R92 K;  2R92 C;  4XSZ A;  4A3G K;  4AYB D;  4A93 K;  4A3B K;  3HOX K;  1WCM K;  1TWA K;  4Q4Z A;  4A93 C;  4A3G C;  4A3B C;  3HOX C;  1WCM C;  1TWA C;  2CW0 A;  4A3F K;  4BBS K;  4A3F C;  3RZD K;  4ZH4 A;  2PA8 L;  4BBS C;  3HKZ D;  3RZD C;  1SFO K;  2A6H A;  2JA6 K;  2NVY K;  1SFO C;  2NVT K;  2JA6 C;  2NVY C;  2JA8 K;  2NVT C;  2WAQ D;  2JA8 C;  4A3M K;  3DXJ A;  4A3M C;  4X6A C;  3I4N C;  1YNJ A;  4A3J K;  2YU9 K;  3GTK K;  2R93 C;  1I3Q K;  4A3J C;  2YU9 C;  3GTK C;  3S1M K;  1I3Q C;  3S1M C;  4C3J K;  5M3F K;  2BE5 A;  4G7H A;  1Y1W K;  5TMC A;  3RZO K;  4OIR A;  1Y1W C;  1I50 K;  3RZO C;  1I50 C;  4Y7N K;  3GTJ K;  3S1R K;  1TWG K;  3HOV K;  3GTJ C;  4Y7N C;  3S1R C;  3HOV C;  1TWG C;  3S17 K;  5M3M K;  3S17 C;  5D4D A;  4LK0 A;  4QJV B;  3PO3 K;  2E2H K;  3PO3 C;  2Y0S D;  4XLP A;  2E2H C;  3S2H K;  3S1Q K;  3S2H C;  3S1Q C;  4A3C K;  4BY7 K;  5IP9 K;  5IYC C;  4A3C C;  4BY7 C;  5IP9 C;  4AYB L;  2O5I A;  4MQ9 A;  2Y0S L;  1Y1V K;  1I6H K;  3H3V D;  3I4N K;  4X6A K;  1Y1V C;  2R7Z K;  1I6H C;  3HKZ L;  4YFX A;  2R7Z C;  2A69 A;  4GZY A;  5C3E K;  4C3I K;  4C2M K;  1HQM A;  2A6E A;  5FLM K;  5C3E C;  2WAQ L;  3FKI K;  4OIQ A;  3GTP K;  3PO2 C;  5FLM C;  3GTP C;  3S16 K;  3FKI C;  1IW7 A;  1SMY A;  4YFN A;  3S15 K;  3S16 C;  2E2J K;  3S15 C;  1TWH K;  3GTL K;  1YNN A;  2E2J C;  3EQL A;  1TWH C;  3GTL C;  5M5Y K;  4OIN A;  3H0G K;  1TWC K;  3GTG K;  2O5J A;  4A3K K;  4KMU A;  3H0G C;  1TWC C;  3GTG C;  4BXX K;  4A3D K;  4A3K C;  4BXX C;  5C4J K;  4A3D C;  4Y52 K;  2PPB A;  3GTQ K;  4Y52 C;  5C4J C;  3GTQ C;  3WOD A;  4QJV A;  4XSX A;  1ZYR A;  4OIO A;  3GTO K;  4LJZ A;  5IYC K;  5M5W K;  3GTO C;  1BDF A;  5C4X K;  3M3Y K;  3M3Y C;  5C4X C;  4QIW D;  3HOW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...