3HXAA

Crystal structure of dcoh1thr51ser
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
AHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMSRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pterin-4-alpha-carbinolamine dehydratase
publication title Crystal Structure of DCoH1Thr51Ser
rcsb
source organism Rattus norvegicus
total genus 33
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 3hxaA00
3HXAA 4WILA 1F93A 2EBBA 4C45A 3JSTA 2V6UA 1DCHA 1DCPA 1RU0A 1USMA 2V6SA 4LOWA 1USOA 1DCOA 2V6TA
chains in the Genus database with same CATH superfamily
4OIRA 1TWCA 2R7ZK 1B4AA 3S15K 2PHCB 4WJ4A 3A8KA 4GTFA 1J98A 5TJ3A 4G7HA 3RZDC 1XXBA 1ZYRA 1INNA 2YU9A 2JA5C 1IL2A 1EK8A 4FM9A 3FKIC 3HOYC 3QX3A 3HOVC 3HOZC 1SFOC 4OIOA 2V6UA 3RZDK 3GTPC 2E2IA 2JA5K 5E68A 4A3EC 4OIPA 3FKIK 3HOYK 1ZBSA 3HOVK 1SFOK 4C3HC 4KMDA 3PO2C 3GTPK 4P5AA 2NVXA 1XZQA 2V6TA 1WSRA 3HKZL 4KM9A 1VJEA 4A3EK 4A3MK 1USOA 3WODA 4X6AC 3ERED 1I50A 4C3HK 2R92C 3PO2K 1VH2A 1IQ0A 3AQOA 1YCLA 4BBSC 1TWAA 3HKZD 1DD5A 4X6AK 3GTOK 5C4JC 4BXXK 4DDQA 1J6VA 3AH5A 4GFQA 4BY7C 3BP8C 1TWHC 1G51A 1TWGC 1JVIA 3N3YA 3HOUK 3GTKA 5C4JK 5L46A 3HOWC 2ZUFA 2BE5A 3T02A 1X31C 5TMFA 1R9TC 1Y1WK 2NVQC 4BY7K 3I4NK 1VLOA 1TWHK 4C3JC 1TWGK 3CQZA 4G0VA 3ADAC 3OPFA 4A3DK 3T00A 5C4XK 2NVYA 2NVTC 1R9TK 2PA8L 1TWFA 2NVQK 2XCRB 2O5IA 4G0WA 4C3JK 3GEEA 3GSIA 4MEYA 3VA7A 1F7VA 4A93K 3GTJC 2NVTK 4M1XA 3GTQC 1EI6A 3BP3A 3T01A 1WQGA 5C3EC 4GTDA 1DCOA 1XZPB 4G7ZA 4A3FC 4XCHA 2CFAA 4NOIA 1WORA 2GAHC 3GTJK 1K83A 1WCMA 4O2DA 1I6VA 5C3EK 1ZVUA 3N0BA 1IS1A 3S1QC 2A6EA 5M3FK 5EGEA 1SMYA 1YNNA 1DCPA 3GTGA 3S2DC 4MQ9A 3NUHA 2Y0SD 1ZXOA 3GTLC 4BLBA 2B63C 2A68A 2JA5A 1O28A 3MMLB 5IYDC 3S2DK 5IOSA 2FQOA 1SFOA 3I4MK 3G4CA 3GTPA 3S15C 5FJ8K 3M4OK 4XSXA 2Y3PA 1XZQB 4A3BK 4KASA 4A3JC 2P8TA 4FZBA 4GTAA 5HL8A 3H0GA 1IBAA 4PABA 3GDZA 2CW0A 4GTCA 1WQHA 4A3JK 3TFHA 3DXJA 5IYCC 5M3MK 2FQTA 3PO3K 1WOOA 2R92A 1I6HC 4YG2A 2GAGC 1J6XA 2E2JC 3L4JA 2WB1L 1RU0A 5IYCK 4G0UA 3TFJA 4JK1A 4XLNA 1I6HK 4A3MC 1O26A 1O24A 2E2HC 2E2JK 1TWHA 1WSVA 1TWGA 1F93A 1ISEA 4LJZA 4GTBA 4A3GC 3L4KA 4KM8A 4GTLA 1HI9A 2E2HK 3GTOC 1PJ5A 4BXXC 4QIWL 3K7AK 4A3CC 1BGWA 3OEPA 3EQLA 4YFNA 1YNJA 4P9SA 4A3GK 5M5WK 3HOUC 5CJ9A 3RZOC 1C0AA 4AYBL 2JA6K 1Y1VA 4A3CK 1Y1WC 4QJVA 1ZQ1C 3I4NC 1J6WA 1YX2A 4BKWA 2CFAB 2YU9C 3RZOK 1DCHA 4A3DC 3GTQA 1TWCK 5C4XC 3AQPA 1O2FB 2YU9K 3BUEA 3G4AA 4C3IC 4OINA 1AB4A 4LR2A 4A93C 4ZH4A 2JA7C 4KB4A 4C45A 2NVXC 2R93A 2RGRA 1PJ7A 4P5BA 5EGHA 4C3IK 3GTMC 3GTLA 2JA7K 1O27A 1O2AA 2B63A 1VGXA 1EQRA 4LK1A 2PA8D 4BBRC 1B4BA 1I3QC 4MEXA 1V5VA 2NVXK 3GTMK 1UV7A 2R7ZA 1F7UA 1O25A 4J3NA 4YFXA 4BBRK 1I3QK 3FHZA 2ZUEA 3S14C 4KC6A 4WILA 3I4MC 5IORA 4KMHA 3M4OC 4C2MC 4A3BC 3S14K 3H3VL 4OIQA 3FKIA 1XPPA 2PMZL 4Q4ZA 3GTKK 3GEHA 2XCQA 4KATA 4LK0A 2D6FC 4C2MK 1O29A 1L0WA 3CQZK 2E2HA 2PMZD 3PO3C 4GT9A 1EFWA 5IP9C 1TWFK 2W7VA 4A3LC 5IOQA 1XXCA 3V4GA 1IE0A 3IPJA 1XXAA 3GTOA 3S2HC 1EH1A 5IP9K 4Y7NK 4A3LK 3S1NC 4QJVB 3S2HK 3FOFA 1K83K 1WCMK 3GTGC 1Y1WA 5IYBC 3HXAA 4BLAA 3K7AC 3S1NK 4G7OA 1HQMA 3S16C 4KB2A 2WB1D 4AH6A 2P5MA 1JQWA 1R9TA 3GTGK 2XCOA 5IYBK 2JA8C 2JA6C 1WOSA 2VUMC 3S16K 1PJ6A 4KMUA 3HOXC 2JA7A 3H0GC 2JA8K 3HOZK 1TWCC 3OREA 3AD7C 1WOPA 3LAJA 1JOEA 2VUMK 2A6HA 4QIWD 1F9NA 3GTMA 1BDFA 3HOXK 3GTJA 3H0GK 3LPXA 2RH6A 1I3QA 1VRQC 2PPBA 3TFIA 4AYBD 2A69A 3S1RC 2E2IC 3A8IA 5IOTA 5IP7C 3AD9C 3N0CA 4XSZA 2R92K 3A8JA 4KMAA 5FLMC 4BBSK 1WQFA 3CAGA 1BS2A 3S1RK 2E2IK 5IP7K 4KN4A 4A3KC 1WIHA 3S17C 3SZYA 5FLMK 3S1MC 1I50C 4Q5SA 1TWAC 2EBBA 5D4DA 4A3IC 3HOWK 4Y52C 4A3KK 3S17K 4XLPA 3S1MK 1I50K 1Y1VC 4LLGA 1O2BA 4YFKA 3AD8C 3GEIA 1TWAK 4A3IK 4GTEA 4Y52K 1IW7A 3FOEA 3Q3QA 2WAQL 3GTKC 3GIRA 4KDDA 4BY1C 3M3YC 2O5JA 5C44C 2KWAA 1Y1VK 3SZZA 5CHPA 1KQ4A 2GSUA 2GSOA 2Y0SL 4LOWA 3CQZC 4BY1K 3GTQK 3M3YK 5C44K 2NVYC 2WAQD 1TWFC 4A3FK 2R93C 5JVOA 4RMFA 1USMA 3H3VD 3LAPA 4ILDA 1GE9A 2NVYK 4Y7NC 4KAWX 4KARA 4WJ3M 3JSTA 3S1QK 5M5YK 5JFEA 2JH3A 5M5XK 3S0XA 2R93K 2ZFZA 5TMCA 4LQYA 2R7ZC 2V6SA 2JA6A 4GZYA 3GTLK 1K83C 1WCMC 2VUMA 1XZPA 2B63K 2GSNA 4KN7A 3TTGA 1BJTA 5IYDK 4PAAA
chains in the Genus database with same CATH topology
3HXAA 4WILA 1F93A 2EBBA 4C45A 3JSTA 2V6UA 1DCHA 1DCPA 1RU0A 1USMA 2V6SA 4LOWA 1USOA 1DCOA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXA A;  4WIL A;  1F93 A;  2EBB A;  4C45 A;  3JST A;  2V6U A;  1DCH A;  1DCP A;  1RU0 A;  1USM A;  2V6S A;  4LOW A;  1USO A;  1DCO A;  2V6T A; 
#chains in the Genus database with same CATH topology
 4OIR A;  1TWC A;  2R7Z K;  1B4A A;  3S15 K;  2PHC B;  4WJ4 A;  3A8K A;  4GTF A;  1J98 A;  5TJ3 A;  4G7H A;  3RZD C;  1XXB A;  1ZYR A;  1INN A;  2YU9 A;  2JA5 C;  1IL2 A;  1EK8 A;  4FM9 A;  3FKI C;  3HOY C;  3QX3 A;  3HOV C;  3HOZ C;  1SFO C;  4OIO A;  2V6U A;  3RZD K;  3GTP C;  2E2I A;  2JA5 K;  5E68 A;  4A3E C;  4OIP A;  3FKI K;  3HOY K;  1ZBS A;  3HOV K;  1SFO K;  4C3H C;  4KMD A;  3PO2 C;  3GTP K;  4P5A A;  2NVX A;  1XZQ A;  2V6T A;  1WSR A;  3HKZ L;  4KM9 A;  1VJE A;  4A3E K;  4A3M K;  1USO A;  3WOD A;  4X6A C;  3ERE D;  1I50 A;  4C3H K;  2R92 C;  3PO2 K;  1VH2 A;  1IQ0 A;  3AQO A;  1YCL A;  4BBS C;  1TWA A;  3HKZ D;  1DD5 A;  4X6A K;  3GTO K;  5C4J C;  4BXX K;  4DDQ A;  1J6V A;  3AH5 A;  4GFQ A;  4BY7 C;  3BP8 C;  1TWH C;  1G51 A;  1TWG C;  1JVI A;  3N3Y A;  3HOU K;  3GTK A;  5C4J K;  5L46 A;  3HOW C;  2ZUF A;  2BE5 A;  3T02 A;  1X31 C;  5TMF A;  1R9T C;  1Y1W K;  2NVQ C;  4BY7 K;  3I4N K;  1VLO A;  1TWH K;  4C3J C;  1TWG K;  3CQZ A;  4G0V A;  3ADA C;  3OPF A;  4A3D K;  3T00 A;  5C4X K;  2NVY A;  2NVT C;  1R9T K;  2PA8 L;  1TWF A;  2NVQ K;  2XCR B;  2O5I A;  4G0W A;  4C3J K;  3GEE A;  3GSI A;  4MEY A;  3VA7 A;  1F7V A;  4A93 K;  3GTJ C;  2NVT K;  4M1X A;  3GTQ C;  1EI6 A;  3BP3 A;  3T01 A;  1WQG A;  5C3E C;  4GTD A;  1DCO A;  1XZP B;  4G7Z A;  4A3F C;  4XCH A;  2CFA A;  4NOI A;  1WOR A;  2GAH C;  3GTJ K;  1K83 A;  1WCM A;  4O2D A;  1I6V A;  5C3E K;  1ZVU A;  3N0B A;  1IS1 A;  3S1Q C;  2A6E A;  5M3F K;  5EGE A;  1SMY A;  1YNN A;  1DCP A;  3GTG A;  3S2D C;  4MQ9 A;  3NUH A;  2Y0S D;  1ZXO A;  3GTL C;  4BLB A;  2B63 C;  2A68 A;  2JA5 A;  1O28 A;  3MML B;  5IYD C;  3S2D K;  5IOS A;  2FQO A;  1SFO A;  3I4M K;  3G4C A;  3GTP A;  3S15 C;  5FJ8 K;  3M4O K;  4XSX A;  2Y3P A;  1XZQ B;  4A3B K;  4KAS A;  4A3J C;  2P8T A;  4FZB A;  4GTA A;  5HL8 A;  3H0G A;  1IBA A;  4PAB A;  3GDZ A;  2CW0 A;  4GTC A;  1WQH A;  4A3J K;  3TFH A;  3DXJ A;  5IYC C;  5M3M K;  2FQT A;  3PO3 K;  1WOO A;  2R92 A;  1I6H C;  4YG2 A;  2GAG C;  1J6X A;  2E2J C;  3L4J A;  2WB1 L;  1RU0 A;  5IYC K;  4G0U A;  3TFJ A;  4JK1 A;  4XLN A;  1I6H K;  4A3M C;  1O26 A;  1O24 A;  2E2H C;  2E2J K;  1TWH A;  1WSV A;  1TWG A;  1F93 A;  1ISE A;  4LJZ A;  4GTB A;  4A3G C;  3L4K A;  4KM8 A;  4GTL A;  1HI9 A;  2E2H K;  3GTO C;  1PJ5 A;  4BXX C;  4QIW L;  3K7A K;  4A3C C;  1BGW A;  3OEP A;  3EQL A;  4YFN A;  1YNJ A;  4P9S A;  4A3G K;  5M5W K;  3HOU C;  5CJ9 A;  3RZO C;  1C0A A;  4AYB L;  2JA6 K;  1Y1V A;  4A3C K;  1Y1W C;  4QJV A;  1ZQ1 C;  3I4N C;  1J6W A;  1YX2 A;  4BKW A;  2CFA B;  2YU9 C;  3RZO K;  1DCH A;  4A3D C;  3GTQ A;  1TWC K;  5C4X C;  3AQP A;  1O2F B;  2YU9 K;  3BUE A;  3G4A A;  4C3I C;  4OIN A;  1AB4 A;  4LR2 A;  4A93 C;  4ZH4 A;  2JA7 C;  4KB4 A;  4C45 A;  2NVX C;  2R93 A;  2RGR A;  1PJ7 A;  4P5B A;  5EGH A;  4C3I K;  3GTM C;  3GTL A;  2JA7 K;  1O27 A;  1O2A A;  2B63 A;  1VGX A;  1EQR A;  4LK1 A;  2PA8 D;  4BBR C;  1B4B A;  1I3Q C;  4MEX A;  1V5V A;  2NVX K;  3GTM K;  1UV7 A;  2R7Z A;  1F7U A;  1O25 A;  4J3N A;  4YFX A;  4BBR K;  1I3Q K;  3FHZ A;  2ZUE A;  3S14 C;  4KC6 A;  4WIL A;  3I4M C;  5IOR A;  4KMH A;  3M4O C;  4C2M C;  4A3B C;  3S14 K;  3H3V L;  4OIQ A;  3FKI A;  1XPP A;  2PMZ L;  4Q4Z A;  3GTK K;  3GEH A;  2XCQ A;  4KAT A;  4LK0 A;  2D6F C;  4C2M K;  1O29 A;  1L0W A;  3CQZ K;  2E2H A;  2PMZ D;  3PO3 C;  4GT9 A;  1EFW A;  5IP9 C;  1TWF K;  2W7V A;  4A3L C;  5IOQ A;  1XXC A;  3V4G A;  1IE0 A;  3IPJ A;  1XXA A;  3GTO A;  3S2H C;  1EH1 A;  5IP9 K;  4Y7N K;  4A3L K;  3S1N C;  4QJV B;  3S2H K;  3FOF A;  1K83 K;  1WCM K;  3GTG C;  1Y1W A;  5IYB C;  3HXA A;  4BLA A;  3K7A C;  3S1N K;  4G7O A;  1HQM A;  3S16 C;  4KB2 A;  2WB1 D;  4AH6 A;  2P5M A;  1JQW A;  1R9T A;  3GTG K;  2XCO A;  5IYB K;  2JA8 C;  2JA6 C;  1WOS A;  2VUM C;  3S16 K;  1PJ6 A;  4KMU A;  3HOX C;  2JA7 A;  3H0G C;  2JA8 K;  3HOZ K;  1TWC C;  3ORE A;  3AD7 C;  1WOP A;  3LAJ A;  1JOE A;  2VUM K;  2A6H A;  4QIW D;  1F9N A;  3GTM A;  1BDF A;  3HOX K;  3GTJ A;  3H0G K;  3LPX A;  2RH6 A;  1I3Q A;  1VRQ C;  2PPB A;  3TFI A;  4AYB D;  2A69 A;  3S1R C;  2E2I C;  3A8I A;  5IOT A;  5IP7 C;  3AD9 C;  3N0C A;  4XSZ A;  2R92 K;  3A8J A;  4KMA A;  5FLM C;  4BBS K;  1WQF A;  3CAG A;  1BS2 A;  3S1R K;  2E2I K;  5IP7 K;  4KN4 A;  4A3K C;  1WIH A;  3S17 C;  3SZY A;  5FLM K;  3S1M C;  1I50 C;  4Q5S A;  1TWA C;  2EBB A;  5D4D A;  4A3I C;  3HOW K;  4Y52 C;  4A3K K;  3S17 K;  4XLP A;  3S1M K;  1I50 K;  1Y1V C;  4LLG A;  1O2B A;  4YFK A;  3AD8 C;  3GEI A;  1TWA K;  4A3I K;  4GTE A;  4Y52 K;  1IW7 A;  3FOE A;  3Q3Q A;  2WAQ L;  3GTK C;  3GIR A;  4KDD A;  4BY1 C;  3M3Y C;  2O5J A;  5C44 C;  2KWA A;  1Y1V K;  3SZZ A;  5CHP A;  1KQ4 A;  2GSU A;  2GSO A;  2Y0S L;  4LOW A;  3CQZ C;  4BY1 K;  3GTQ K;  3M3Y K;  5C44 K;  2NVY C;  2WAQ D;  1TWF C;  4A3F K;  2R93 C;  5JVO A;  4RMF A;  1USM A;  3H3V D;  3LAP A;  4ILD A;  1GE9 A;  2NVY K;  4Y7N C;  4KAW X;  4KAR A;  4WJ3 M;  3JST A;  3S1Q K;  5M5Y K;  5JFE A;  2JH3 A;  5M5X K;  3S0X A;  2R93 K;  2ZFZ A;  5TMC A;  4LQY A;  2R7Z C;  2V6S A;  2JA6 A;  4GZY A;  3GTL K;  1K83 C;  1WCM C;  2VUM A;  1XZP A;  2B63 K;  2GSN A;  4KN7 A;  3TTG A;  1BJT A;  5IYD K;  4PAA A; 
#chains in the Genus database with same CATH homology
 3HXA A;  4WIL A;  1F93 A;  2EBB A;  4C45 A;  3JST A;  2V6U A;  1DCH A;  1DCP A;  1RU0 A;  1USM A;  2V6S A;  4LOW A;  1USO A;  1DCO A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...