3HXAA

Crystal structure of dcoh1thr51ser
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
b'AHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMSRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pterin-4-alpha-carbinolamine dehydratase
publication title Crystal Structure of DCoH1Thr51Ser
rcsb
source organism Rattus norvegicus
molecule tags Lyase
total genus 33
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 3hxaA00
4C45A 1USOA 1DCHA 2V6TA 1USMA 3HXAA 3JSTA 4LOWA 1DCOA 1F93A 2EBBA 2V6UA 2V6SA 1RU0A 4WILA 1DCPA
chains in the Genus database with same CATH superfamily
4XSXA 5IP9K 3K7AK 1TWAC 3S1NK 2Y0SL 4RMFA 4BXXC 1IL2A 3S2HC 1VH2A 1DD5A 3HOWK 3Q3QA 4X6AC 3ERED 5IOSA 3HKZD 3GTGA 3M3YC 3FOEA 3N3YA 3S14C 1TWGK 1O2BA 3H0GK 1ZQ1C 2E2IA 3S1QC 2NVXA 2PA8D 4KAWX 5IYCK 4BY7C 4A3CK 2PHCB 4A3EC 1PJ7A 1BDFA 4C45A 4QIWD 1JOEA 4C3HK 2E2HK 3I4MC 5JFEA 1O2AA 4G7HA 1IW7A 2FQOA 4P5BA 3GTLC 2E2JC 1WIHA 5FLMC 1UV7A 2B63C 1WQFA 4LK1A 3HOXC 3S0XA 3GTGK 4FZBA 2NVTK 4BLBA 1F93A 3MMLB 5M5XK 3GTJC 3S15C 2NVXK 5IYDC 2R93C 5IYBC 3HOUK 1I6VA 4J3NA 3AD9C 2VUMA 1ZYRA 4PABA 1TWAK 3IPJA 1F7VA 4BXXK 4A3IC 3S2HK 3AD8C 3NUHA 2XCRB 4A3GK 4X6AK 3BP8C 3M3YK 1GE9A 3AD7C 2PPBA 1Y1WA 1F9NA 1XZPA 3HOVK 3S14K 4KMAA 4YFKA 3BUEA 1TWHA 5IP9C 3S1QK 1O29A 1R9TA 5IP7K 1ZBSA 1HQMA 4OIQA 3S1NC 4OIOA 4NOIA 3L4KA 1VJEA 4A3DK 2WB1L 1TWFA 4A3FK 3FHZA 1O27A 1KQ4A 3FOFA 3GTLK 4YG2A 2E2JK 2A6EA 1TWGC 3H0GC 4C3JC 2B63K 3TFHA 3HOXK 2JA6A 4ZH4A 4C3HC 1EK8A 3H3VD 4MEYA 2PMZD 5TMCA 2E2HC 1K83C 1WSVA 1Y1WK 4YFXA 3S15K 3GTPA 1R9TK 5IYDK 5C4JC 5IYBK 3GEEA 3SZZA 4OINA 1V5VA 3OEPA 3I4NC 3S17K 4KMHA 1TWCA 1TWFK 3GTGC 4KM8A 3G4AA 4A3IK 1J6WA 2NVQC 2E2IC 4GTEA 5IOQA 2NVXC 2P5MA 2JA5A 1PJ6A 2KWAA 3M4OC 3HOUC 1L0WA 4LJZA 4Y7NC 2V6TA 1DCOA 1O24A 5CJ9A 3GTPK 4A3GC 3LAPA 4Q4ZA 1ZVUA 4XCHA 4A3LK 1I50A 4KMUA 2V6SA 3HOVC 5C44K 1ISEA 1TWCK 5IP7C 3GEIA 3N0BA 4C3JK 2R92A 2WAQL 4A3DC 3PO2C 1K83K 2JA5K 4A3FC 4GTDA 3RZDC 3HXAA 2CW0A 3CAGA 4A3JC 5TMFA 5C4JK 2VUMC 5EGEA 4BY1K 4AYBD 3I4NK 4LLGA 2W7VA 1BGWA 5M5YK 1Y1WC 3GTMA 3EQLA 2NVQK 1TWHC 2E2IK 3QX3A 3HKZL 1R9TC 1YX2A 3OREA 3GTQA 3M4OK 2BE5A 3OPFA 1SFOA 3A8KA 2PA8L 3S17C 2R7ZA 4P9SA 4Y7NK 1TWFC 4G0WA 4JK1A 1EQRA 4QIWL 4G0VA 1XZQB 2JA7A 1EI6A 4AH6A 4GT9A 4A93K 5EGHA 5HL8A 1B4BA 5E68A 1PJ5A 1XZQA 1I3QA 3GTPC 4WJ3M 3GTKA 3PO2K 2O5IA 3GTQK 2RH6A 3RZDK 4A3LC 5CHPA 5C44C 4A3JK 2GAGC 1J98A 1J6VA 1TWCC 4C3IK 2VUMK 3CQZA 1XPPA 3PO3C 2GSOA 3A8JA 1VLOA 2XCQA 3T00A 3T02A 1AB4A 3JSTA 1XXCA 1XXBA 2JA5C 4G7ZA 1YCLA 1TWHK 1IS1A 2GAHC 2Y3PA 2YU9A 4QJVB 4BBSK 1I3QK 3LAJA 2CFAB 3L4JA 4BY1C 3WODA 3S1RC 4BBRK 2Y0SD 1INNA 5C4XK 1XXAA 1I50C 1WCMA 4XLNA 1YNJA 3HOYK 4KATA 4BLAA 2ZFZA 3ADAC 4A3BK 2JA6K 2R92C 4O2DA 2JH3A 2NVYA 4KN7A 4XSZA 3A8IA 3GEHA 1HI9A 4P5AA 3H3VL 2YU9K 2PMZL 1WOPA 2GSNA 4LR2A 3VA7A 3SZYA 3S2DK 4A93C 1ZXOA 3FKIA 4M1XA 4GFQA 4FM9A 2XCOA 1DCPA 3RZOK 1WCMK 3GTMC 4LOWA 3PO3K 3S1MC 1O26A 1C0AA 4GTBA 4GTFA 1Y1VA 4PAAA 3GTQC 4KDDA 5IORA 1G51A 2A6HA 4C2MC 1O2FB 1SFOC 3GTOA 4KC6A 2R7ZC 2NVYK 4C3IC 5JVOA 4GZYA 4YFNA 3G4CA 1YNNA 1DCHA 1VRQC 4G7OA 3S1RK 1O25A 4GTLA 2GSUA 2JA7C 1IBAA 1I50K 1J6XA 1JQWA 1USOA 5TJ3A 4MEXA 2D6FC 3FKIK 4A3MK 1TWAA 1SMYA 3T01A 1O28A 4BBSC 1X31C 1I3QC 4OIRA 2R92K 4GTAA 1WQHA 3GTKC 4BBRC 3HOZC 1Y1VK 2A69A 1WOOA 2JA8C 3TTGA 5C4XC 4A3KK 4KB2A 4KARA 2WB1D 2ZUFA 4Y52K 3GTOK 4KB4A 2RGRA 1JVIA 3HOYC 3S16C 3CQZC 5C3EK 1BS2A 4A3BC 2JA6C 1I6HK 1USMA 3TFJA 4DDQA 3GTLA 3GTMK 4GTCA 4AYBL 1WOSA 3S1MK 3GIRA 4ILDA 1XZPB 2YU9C 2B63A 4BKWA 4KM9A 3S2DC 4LK0A 3BP3A 4C2MK 1SFOK 2R7ZK 5D4DA 5IOTA 4XLPA 5M3FK 3GTJA 3RZOC 1WCMC 4BY7K 1RU0A 3K7AC 2R93A 1WORA 4A3EK 2FQTA 2JA7K 1F7UA 3AH5A 4LQYA 3HOWC 3I4MK 2ZUEA 1WQGA 2NVYC 4WJ4A 4MQ9A 5FLMK 5IYCC 3GSIA 4KASA 3GTKK 3HOZK 4A3CC 1EH1A 5M5WK 3DXJA 2JA8K 4QJVA 4OIPA 1WSRA 1B4AA 4G0UA 3V4GA 1BJTA 2CFAA 3FKIC 3LPXA 4A3MC 3AQPA 3S16K 3CQZK 3GDZA 3GTJK 4Q5SA 4WILA 5M3MK 5L46A 5FJ8K 2R93K 2A68A 1Y1VC 2V6UA 1TWGA 3H0GA 1IQ0A 4A3KC 2WAQD 4Y52C 3AQOA 4KN4A 4KMDA 3N0CA 2NVTC 3GTOC 1EFWA 2EBBA 1VGXA 1IE0A 5C3EC 3TFIA 2E2HA 2O5JA 2P8TA 1K83A 1I6HC
chains in the Genus database with same CATH topology
4C45A 1USOA 1DCHA 2V6TA 1USMA 3HXAA 3JSTA 4LOWA 1DCOA 1F93A 2EBBA 2V6UA 2V6SA 1RU0A 4WILA 1DCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C45 A;  1USO A;  1DCH A;  2V6T A;  1USM A;  3HXA A;  3JST A;  4LOW A;  1DCO A;  1F93 A;  2EBB A;  2V6U A;  2V6S A;  1RU0 A;  4WIL A;  1DCP A; 
#chains in the Genus database with same CATH topology
 4XSX A;  5IP9 K;  3K7A K;  1TWA C;  3S1N K;  2Y0S L;  4RMF A;  4BXX C;  1IL2 A;  3S2H C;  1VH2 A;  1DD5 A;  3HOW K;  3Q3Q A;  4X6A C;  3ERE D;  5IOS A;  3HKZ D;  3GTG A;  3M3Y C;  3FOE A;  3N3Y A;  3S14 C;  1TWG K;  1O2B A;  3H0G K;  1ZQ1 C;  2E2I A;  3S1Q C;  2NVX A;  2PA8 D;  4KAW X;  5IYC K;  4BY7 C;  4A3C K;  2PHC B;  4A3E C;  1PJ7 A;  1BDF A;  4C45 A;  4QIW D;  1JOE A;  4C3H K;  2E2H K;  3I4M C;  5JFE A;  1O2A A;  4G7H A;  1IW7 A;  2FQO A;  4P5B A;  3GTL C;  2E2J C;  1WIH A;  5FLM C;  1UV7 A;  2B63 C;  1WQF A;  4LK1 A;  3HOX C;  3S0X A;  3GTG K;  4FZB A;  2NVT K;  4BLB A;  1F93 A;  3MML B;  5M5X K;  3GTJ C;  3S15 C;  2NVX K;  5IYD C;  2R93 C;  5IYB C;  3HOU K;  1I6V A;  4J3N A;  3AD9 C;  2VUM A;  1ZYR A;  4PAB A;  1TWA K;  3IPJ A;  1F7V A;  4BXX K;  4A3I C;  3S2H K;  3AD8 C;  3NUH A;  2XCR B;  4A3G K;  4X6A K;  3BP8 C;  3M3Y K;  1GE9 A;  3AD7 C;  2PPB A;  1Y1W A;  1F9N A;  1XZP A;  3HOV K;  3S14 K;  4KMA A;  4YFK A;  3BUE A;  1TWH A;  5IP9 C;  3S1Q K;  1O29 A;  1R9T A;  5IP7 K;  1ZBS A;  1HQM A;  4OIQ A;  3S1N C;  4OIO A;  4NOI A;  3L4K A;  1VJE A;  4A3D K;  2WB1 L;  1TWF A;  4A3F K;  3FHZ A;  1O27 A;  1KQ4 A;  3FOF A;  3GTL K;  4YG2 A;  2E2J K;  2A6E A;  1TWG C;  3H0G C;  4C3J C;  2B63 K;  3TFH A;  3HOX K;  2JA6 A;  4ZH4 A;  4C3H C;  1EK8 A;  3H3V D;  4MEY A;  2PMZ D;  5TMC A;  2E2H C;  1K83 C;  1WSV A;  1Y1W K;  4YFX A;  3S15 K;  3GTP A;  1R9T K;  5IYD K;  5C4J C;  5IYB K;  3GEE A;  3SZZ A;  4OIN A;  1V5V A;  3OEP A;  3I4N C;  3S17 K;  4KMH A;  1TWC A;  1TWF K;  3GTG C;  4KM8 A;  3G4A A;  4A3I K;  1J6W A;  2NVQ C;  2E2I C;  4GTE A;  5IOQ A;  2NVX C;  2P5M A;  2JA5 A;  1PJ6 A;  2KWA A;  3M4O C;  3HOU C;  1L0W A;  4LJZ A;  4Y7N C;  2V6T A;  1DCO A;  1O24 A;  5CJ9 A;  3GTP K;  4A3G C;  3LAP A;  4Q4Z A;  1ZVU A;  4XCH A;  4A3L K;  1I50 A;  4KMU A;  2V6S A;  3HOV C;  5C44 K;  1ISE A;  1TWC K;  5IP7 C;  3GEI A;  3N0B A;  4C3J K;  2R92 A;  2WAQ L;  4A3D C;  3PO2 C;  1K83 K;  2JA5 K;  4A3F C;  4GTD A;  3RZD C;  3HXA A;  2CW0 A;  3CAG A;  4A3J C;  5TMF A;  5C4J K;  2VUM C;  5EGE A;  4BY1 K;  4AYB D;  3I4N K;  4LLG A;  2W7V A;  1BGW A;  5M5Y K;  1Y1W C;  3GTM A;  3EQL A;  2NVQ K;  1TWH C;  2E2I K;  3QX3 A;  3HKZ L;  1R9T C;  1YX2 A;  3ORE A;  3GTQ A;  3M4O K;  2BE5 A;  3OPF A;  1SFO A;  3A8K A;  2PA8 L;  3S17 C;  2R7Z A;  4P9S A;  4Y7N K;  1TWF C;  4G0W A;  4JK1 A;  1EQR A;  4QIW L;  4G0V A;  1XZQ B;  2JA7 A;  1EI6 A;  4AH6 A;  4GT9 A;  4A93 K;  5EGH A;  5HL8 A;  1B4B A;  5E68 A;  1PJ5 A;  1XZQ A;  1I3Q A;  3GTP C;  4WJ3 M;  3GTK A;  3PO2 K;  2O5I A;  3GTQ K;  2RH6 A;  3RZD K;  4A3L C;  5CHP A;  5C44 C;  4A3J K;  2GAG C;  1J98 A;  1J6V A;  1TWC C;  4C3I K;  2VUM K;  3CQZ A;  1XPP A;  3PO3 C;  2GSO A;  3A8J A;  1VLO A;  2XCQ A;  3T00 A;  3T02 A;  1AB4 A;  3JST A;  1XXC A;  1XXB A;  2JA5 C;  4G7Z A;  1YCL A;  1TWH K;  1IS1 A;  2GAH C;  2Y3P A;  2YU9 A;  4QJV B;  4BBS K;  1I3Q K;  3LAJ A;  2CFA B;  3L4J A;  4BY1 C;  3WOD A;  3S1R C;  4BBR K;  2Y0S D;  1INN A;  5C4X K;  1XXA A;  1I50 C;  1WCM A;  4XLN A;  1YNJ A;  3HOY K;  4KAT A;  4BLA A;  2ZFZ A;  3ADA C;  4A3B K;  2JA6 K;  2R92 C;  4O2D A;  2JH3 A;  2NVY A;  4KN7 A;  4XSZ A;  3A8I A;  3GEH A;  1HI9 A;  4P5A A;  3H3V L;  2YU9 K;  2PMZ L;  1WOP A;  2GSN A;  4LR2 A;  3VA7 A;  3SZY A;  3S2D K;  4A93 C;  1ZXO A;  3FKI A;  4M1X A;  4GFQ A;  4FM9 A;  2XCO A;  1DCP A;  3RZO K;  1WCM K;  3GTM C;  4LOW A;  3PO3 K;  3S1M C;  1O26 A;  1C0A A;  4GTB A;  4GTF A;  1Y1V A;  4PAA A;  3GTQ C;  4KDD A;  5IOR A;  1G51 A;  2A6H A;  4C2M C;  1O2F B;  1SFO C;  3GTO A;  4KC6 A;  2R7Z C;  2NVY K;  4C3I C;  5JVO A;  4GZY A;  4YFN A;  3G4C A;  1YNN A;  1DCH A;  1VRQ C;  4G7O A;  3S1R K;  1O25 A;  4GTL A;  2GSU A;  2JA7 C;  1IBA A;  1I50 K;  1J6X A;  1JQW A;  1USO A;  5TJ3 A;  4MEX A;  2D6F C;  3FKI K;  4A3M K;  1TWA A;  1SMY A;  3T01 A;  1O28 A;  4BBS C;  1X31 C;  1I3Q C;  4OIR A;  2R92 K;  4GTA A;  1WQH A;  3GTK C;  4BBR C;  3HOZ C;  1Y1V K;  2A69 A;  1WOO A;  2JA8 C;  3TTG A;  5C4X C;  4A3K K;  4KB2 A;  4KAR A;  2WB1 D;  2ZUF A;  4Y52 K;  3GTO K;  4KB4 A;  2RGR A;  1JVI A;  3HOY C;  3S16 C;  3CQZ C;  5C3E K;  1BS2 A;  4A3B C;  2JA6 C;  1I6H K;  1USM A;  3TFJ A;  4DDQ A;  3GTL A;  3GTM K;  4GTC A;  4AYB L;  1WOS A;  3S1M K;  3GIR A;  4ILD A;  1XZP B;  2YU9 C;  2B63 A;  4BKW A;  4KM9 A;  3S2D C;  4LK0 A;  3BP3 A;  4C2M K;  1SFO K;  2R7Z K;  5D4D A;  5IOT A;  4XLP A;  5M3F K;  3GTJ A;  3RZO C;  1WCM C;  4BY7 K;  1RU0 A;  3K7A C;  2R93 A;  1WOR A;  4A3E K;  2FQT A;  2JA7 K;  1F7U A;  3AH5 A;  4LQY A;  3HOW C;  3I4M K;  2ZUE A;  1WQG A;  2NVY C;  4WJ4 A;  4MQ9 A;  5FLM K;  5IYC C;  3GSI A;  4KAS A;  3GTK K;  3HOZ K;  4A3C C;  1EH1 A;  5M5W K;  3DXJ A;  2JA8 K;  4QJV A;  4OIP A;  1WSR A;  1B4A A;  4G0U A;  3V4G A;  1BJT A;  2CFA A;  3FKI C;  3LPX A;  4A3M C;  3AQP A;  3S16 K;  3CQZ K;  3GDZ A;  3GTJ K;  4Q5S A;  4WIL A;  5M3M K;  5L46 A;  5FJ8 K;  2R93 K;  2A68 A;  1Y1V C;  2V6U A;  1TWG A;  3H0G A;  1IQ0 A;  4A3K C;  2WAQ D;  4Y52 C;  3AQO A;  4KN4 A;  4KMD A;  3N0C A;  2NVT C;  3GTO C;  1EFW A;  2EBB A;  1VGX A;  1IE0 A;  5C3E C;  3TFI A;  2E2H A;  2O5J A;  2P8T A;  1K83 A;  1I6H C; 
#chains in the Genus database with same CATH homology
 4C45 A;  1USO A;  1DCH A;  2V6T A;  1USM A;  3HXA A;  3JST A;  4LOW A;  1DCO A;  1F93 A;  2EBB A;  2V6U A;  2V6S A;  1RU0 A;  4WIL A;  1DCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...