3HXAA

Crystal structure of dcoh1thr51ser
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
AHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMSRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pterin-4-alpha-carbinolamine dehydratase
publication title Crystal Structure of DCoH1Thr51Ser
rcsb
source organism Rattus norvegicus
molecule tags Lyase
total genus 33
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 3hxaA00
1DCHA 2V6SA 1F93A 2V6TA 1DCOA 1RU0A 4LOWA 2EBBA 1USOA 1USMA 1DCPA 3HXAA 2V6UA 4C45A 4WILA 3JSTA
chains in the Genus database with same CATH superfamily
3L4JA 5IOTA 1ZYRA 3G4AA 2E2HA 2JA5C 4BY7C 4G0UA 1TWHK 1WSRA 1Y1WC 5C4JK 3S1NC 4A3MK 1R9TA 2B63C 1WORA 3TFIA 5IP9C 3H0GA 1VRQC 4BXXC 3S17K 3A8JA 4X6AC 2GAGC 2JA8K 3BP3A 3GTKK 2NVQC 3CQZC 1BDFA 4KC6A 1IQ0A 2E2HC 4OIRA 2JA6A 2R7ZK 4LQYA 3HOWK 2W7VA 3HKZD 3K7AC 1R9TC 1XPPA 3G4CA 3FKIK 3H0GC 2A6HA 5IYBK 2ZFZA 2BE5A 1JVIA 1J6XA 3S2HC 1WOOA 2FQOA 4O2DA 3TFHA 1TWCK 1SFOK 4C3HC 4Y52C 1YCLA 3PO2K 4A3LC 2PMZL 4LOWA 3GTJA 3SZYA 1K83C 4BKWA 5FLMK 4BBSC 1ISEA 4Y7NK 2Y3PA 1TWFK 2FQTA 5CJ9A 2NVXA 3PO3K 4BBRK 3HOVC 1BGWA 1GE9A 5TJ3A 3HOXC 5JVOA 4FM9A 5C3EK 1WSVA 1BJTA 3A8KA 3FOEA 3N3YA 3QX3A 4C2MC 4LLGA 2R7ZA 3GTQK 2GSUA 4A3JC 4ILDA 1I3QA 3L4KA 2NVYK 3GEIA 4MQ9A 5M3MK 3I4MK 2ZUEA 2E2JK 4OINA 2PHCB 2NVXC 3HOZC 4C45A 1HI9A 4GTLA 3FKIA 5IP7K 3RZDC 3S17C 4KM9A 2JA8C 4Q4ZA 1ZQ1C 3GTKC 3S15K 1C0AA 3Q3QA 4KMDA 2R7ZC 3M4OK 2WB1L 3LAPA 2R93A 3HOWC 1YNNA 1TWCA 1TWAK 4GTBA 2Y0SL 2E2IA 1IL2A 2R92A 4KMHA 1G51A 2GSNA 2WAQL 3FKIC 4BLAA 4XLNA 1WQFA 1J98A 2P5MA 5IYBC 4WJ4A 4KMUA 3AH5A 4BLBA 1TWFA 1I6VA 4KAWX 2R93C 4A3CC 1XZQA 1TWCC 1SFOC 4KARA 3TTGA 1O2BA 1X31C 3PO2C 5M3FK 1JOEA 3GTGK 1WQGA 4GFQA 4Y7NC 4WJ3M 4RMFA 1TWFC 3GTLK 1YNJA 3GDZA 3PO3C 4BBRC 1IBAA 2YU9K 4J3NA 4A3KC 5IOQA 5C3EC 3GEEA 3V4GA 1B4AA 1IE0A 3GTQC 4AH6A 3S1QK 2NVYC 3T02A 1TWAA 4GTEA 1J6WA 1XZQB 3I4MC 3I4NK 2CFAA 2E2JC 1Y1VK 3GIRA 3GTPA 3WODA 4AYBL 1WIHA 3RZOK 3TFJA 3S15C 4A3FC 1K83A 1F7UA 3S1MK 4G0VA 4LK0A 2PMZD 3H3VD 1PJ6A 1ZXOA 4A93K 1EH1A 3S2DK 1TWAC 3DXJA 4C3IK 4KM8A 3GTPC 3NUHA 2JH3A 3AQPA 5IORA 3IPJA 3BP8C 4LK1A 3AQOA 1I6HK 4KB2A 2A6EA 1V5VA 2JA7K 3GTMK 1TWHA 1O29A 2CFAB 1O2AA 5C44K 4OIOA 1F9NA 3EQLA 3HKZL 1DD5A 4G7HA 1O2FB 1PJ5A 2XCRB 1WQHA 4FZBA 3N0BA 4C3JK 4QJVA 2D6FC 1TWGK 3GTKA 1AB4A 2EBBA 1O25A 1VJEA 1ZVUA 1Y1VA 1TWHC 4KN7A 5C4JC 4A3MC 2YU9C 2PA8D 4BY7K 4KB4A 3AD8C 1YX2A 2Y0SD 2B63K 1WCMK 2WAQD 1DCOA 1RU0A 5IP9K 5CHPA 3S1QC 1O27A 4BXXK 3T00A 5IYDK 5TMCA 3I4NC 5TMFA 1Y1VC 1F7VA 1SFOA 4GTCA 4QJVB 3N0CA 3OEPA 3RZOC 1R9TK 3OREA 3S1MC 5FJ8K 4GTAA 4DDQA 3H0GK 4A93C 4QIWD 4KN4A 2XCOA 5HL8A 1O24A 3S2DC 2XCQA 3T01A 3S2HK 1EI6A 3S16K 1ZBSA 3GEHA 3GSIA 2JA6K 5E68A 1TWGA 4ZH4A 2VUMK 4GTFA 5FLMC 3GTQA 1I6HC 3OPFA 4P9SA 2NVYA 4A3IK 4GZYA 5C44C 1IS1A 2GSOA 1BS2A 3ERED 2PPBA 4G0WA 4C3JC 3SZZA 5C4XK 3M3YK 1TWGC 3CAGA 2O5JA 3HOXK 1JQWA 5M5WK 4KATA 3HXAA 4A3DK 3MMLB 3GTJK 3AD7C 4A3JK 1USOA 4OIPA 3BUEA 5IP7C 3HOZK 4XSXA 2NVXK 1WCMC 5EGHA 3RZDK 4GT9A 2RH6A 3M4OC 5IYDC 1XZPA 2A68A 3HOUK 3JSTA 1F93A 3CQZA 1UV7A 1I3QK 1I50K 4MEYA 3GTGA 2VUMA 4OIQA 4XCHA 1DCPA 3S14K 2GAHC 1EK8A 4A3EK 3GTLA 4YFKA 4A3GK 3HOYK 2YU9A 2NVTK 3S16C 3GTOK 1J6VA 2A69A 2P8TA 4YFXA 2O5IA 2JA6C 2R93K 3FHZA 4A3CK 5L46A 4A3BK 1HQMA 3LPXA 4KMAA 5D4DA 2E2IK 2R92K 3GTGC 2VUMC 4KDDA 4G7ZA 4M1XA 3S1RK 1XZPB 5EGEA 4A3IC 3H3VL 1DCHA 3GTLC 5IYCK 2CW0A 4BY1K 2WB1D 5M5YK 2JA5K 1Y1WK 3S0XA 1VLOA 3S1NK 5C4XC 3M3YC 4LJZA 4A3KK 4P5BA 1EQRA 4PAAA 4MEXA 1KQ4A 4X6AK 2V6TA 2ZUFA 2RGRA 3GTJC 4A3DC 3A8IA 1INNA 1VH2A 2NVQK 3CQZK 2V6UA 4WILA 1I50A 4GTDA 4YG2A 4XLPA 2E2HK 3LAJA 1VGXA 3FOFA 3VA7A 3K7AK 1WOPA 1SMYA 2JA7A 3GTMA 3ADAC 4A3FK 3HOUC 4KASA 3GTOA 5JFEA 2KWAA 1XXBA 2PA8L 4C3IC 4NOIA 1I3QC 4XSZA 2V6SA 1I50C 1IW7A 1USMA 4Q5SA 4P5AA 5IOSA 1EFWA 5M5XK 4C3HK 3GTPK 3S14C 4Y52K 1WOSA 1O28A 4YFNA 4A3EC 2JA7C 3GTMC 4A3LK 1L0WA 4A3GC 3HOYC 4JK1A 2NVTC 1K83K 3GTOC 4BBSK 2JA5A 1Y1WA 4LR2A 4A3BC 2B63A 1WCMA 1XXCA 2E2IC 3AD9C 2R92C 3HOVK 1O26A 1B4BA 4PABA 4AYBD 1PJ7A 3S1RC 4G7OA 1XXAA 4QIWL 5IYCC 4C2MK 4BY1C
chains in the Genus database with same CATH topology
1DCHA 2V6SA 1F93A 2V6TA 1DCOA 1RU0A 4LOWA 2EBBA 1USOA 1USMA 1DCPA 3HXAA 2V6UA 4C45A 4WILA 3JSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCH A;  2V6S A;  1F93 A;  2V6T A;  1DCO A;  1RU0 A;  4LOW A;  2EBB A;  1USO A;  1USM A;  1DCP A;  3HXA A;  2V6U A;  4C45 A;  4WIL A;  3JST A; 
#chains in the Genus database with same CATH topology
 3L4J A;  5IOT A;  1ZYR A;  3G4A A;  2E2H A;  2JA5 C;  4BY7 C;  4G0U A;  1TWH K;  1WSR A;  1Y1W C;  5C4J K;  3S1N C;  4A3M K;  1R9T A;  2B63 C;  1WOR A;  3TFI A;  5IP9 C;  3H0G A;  1VRQ C;  4BXX C;  3S17 K;  3A8J A;  4X6A C;  2GAG C;  2JA8 K;  3BP3 A;  3GTK K;  2NVQ C;  3CQZ C;  1BDF A;  4KC6 A;  1IQ0 A;  2E2H C;  4OIR A;  2JA6 A;  2R7Z K;  4LQY A;  3HOW K;  2W7V A;  3HKZ D;  3K7A C;  1R9T C;  1XPP A;  3G4C A;  3FKI K;  3H0G C;  2A6H A;  5IYB K;  2ZFZ A;  2BE5 A;  1JVI A;  1J6X A;  3S2H C;  1WOO A;  2FQO A;  4O2D A;  3TFH A;  1TWC K;  1SFO K;  4C3H C;  4Y52 C;  1YCL A;  3PO2 K;  4A3L C;  2PMZ L;  4LOW A;  3GTJ A;  3SZY A;  1K83 C;  4BKW A;  5FLM K;  4BBS C;  1ISE A;  4Y7N K;  2Y3P A;  1TWF K;  2FQT A;  5CJ9 A;  2NVX A;  3PO3 K;  4BBR K;  3HOV C;  1BGW A;  1GE9 A;  5TJ3 A;  3HOX C;  5JVO A;  4FM9 A;  5C3E K;  1WSV A;  1BJT A;  3A8K A;  3FOE A;  3N3Y A;  3QX3 A;  4C2M C;  4LLG A;  2R7Z A;  3GTQ K;  2GSU A;  4A3J C;  4ILD A;  1I3Q A;  3L4K A;  2NVY K;  3GEI A;  4MQ9 A;  5M3M K;  3I4M K;  2ZUE A;  2E2J K;  4OIN A;  2PHC B;  2NVX C;  3HOZ C;  4C45 A;  1HI9 A;  4GTL A;  3FKI A;  5IP7 K;  3RZD C;  3S17 C;  4KM9 A;  2JA8 C;  4Q4Z A;  1ZQ1 C;  3GTK C;  3S15 K;  1C0A A;  3Q3Q A;  4KMD A;  2R7Z C;  3M4O K;  2WB1 L;  3LAP A;  2R93 A;  3HOW C;  1YNN A;  1TWC A;  1TWA K;  4GTB A;  2Y0S L;  2E2I A;  1IL2 A;  2R92 A;  4KMH A;  1G51 A;  2GSN A;  2WAQ L;  3FKI C;  4BLA A;  4XLN A;  1WQF A;  1J98 A;  2P5M A;  5IYB C;  4WJ4 A;  4KMU A;  3AH5 A;  4BLB A;  1TWF A;  1I6V A;  4KAW X;  2R93 C;  4A3C C;  1XZQ A;  1TWC C;  1SFO C;  4KAR A;  3TTG A;  1O2B A;  1X31 C;  3PO2 C;  5M3F K;  1JOE A;  3GTG K;  1WQG A;  4GFQ A;  4Y7N C;  4WJ3 M;  4RMF A;  1TWF C;  3GTL K;  1YNJ A;  3GDZ A;  3PO3 C;  4BBR C;  1IBA A;  2YU9 K;  4J3N A;  4A3K C;  5IOQ A;  5C3E C;  3GEE A;  3V4G A;  1B4A A;  1IE0 A;  3GTQ C;  4AH6 A;  3S1Q K;  2NVY C;  3T02 A;  1TWA A;  4GTE A;  1J6W A;  1XZQ B;  3I4M C;  3I4N K;  2CFA A;  2E2J C;  1Y1V K;  3GIR A;  3GTP A;  3WOD A;  4AYB L;  1WIH A;  3RZO K;  3TFJ A;  3S15 C;  4A3F C;  1K83 A;  1F7U A;  3S1M K;  4G0V A;  4LK0 A;  2PMZ D;  3H3V D;  1PJ6 A;  1ZXO A;  4A93 K;  1EH1 A;  3S2D K;  1TWA C;  3DXJ A;  4C3I K;  4KM8 A;  3GTP C;  3NUH A;  2JH3 A;  3AQP A;  5IOR A;  3IPJ A;  3BP8 C;  4LK1 A;  3AQO A;  1I6H K;  4KB2 A;  2A6E A;  1V5V A;  2JA7 K;  3GTM K;  1TWH A;  1O29 A;  2CFA B;  1O2A A;  5C44 K;  4OIO A;  1F9N A;  3EQL A;  3HKZ L;  1DD5 A;  4G7H A;  1O2F B;  1PJ5 A;  2XCR B;  1WQH A;  4FZB A;  3N0B A;  4C3J K;  4QJV A;  2D6F C;  1TWG K;  3GTK A;  1AB4 A;  2EBB A;  1O25 A;  1VJE A;  1ZVU A;  1Y1V A;  1TWH C;  4KN7 A;  5C4J C;  4A3M C;  2YU9 C;  2PA8 D;  4BY7 K;  4KB4 A;  3AD8 C;  1YX2 A;  2Y0S D;  2B63 K;  1WCM K;  2WAQ D;  1DCO A;  1RU0 A;  5IP9 K;  5CHP A;  3S1Q C;  1O27 A;  4BXX K;  3T00 A;  5IYD K;  5TMC A;  3I4N C;  5TMF A;  1Y1V C;  1F7V A;  1SFO A;  4GTC A;  4QJV B;  3N0C A;  3OEP A;  3RZO C;  1R9T K;  3ORE A;  3S1M C;  5FJ8 K;  4GTA A;  4DDQ A;  3H0G K;  4A93 C;  4QIW D;  4KN4 A;  2XCO A;  5HL8 A;  1O24 A;  3S2D C;  2XCQ A;  3T01 A;  3S2H K;  1EI6 A;  3S16 K;  1ZBS A;  3GEH A;  3GSI A;  2JA6 K;  5E68 A;  1TWG A;  4ZH4 A;  2VUM K;  4GTF A;  5FLM C;  3GTQ A;  1I6H C;  3OPF A;  4P9S A;  2NVY A;  4A3I K;  4GZY A;  5C44 C;  1IS1 A;  2GSO A;  1BS2 A;  3ERE D;  2PPB A;  4G0W A;  4C3J C;  3SZZ A;  5C4X K;  3M3Y K;  1TWG C;  3CAG A;  2O5J A;  3HOX K;  1JQW A;  5M5W K;  4KAT A;  3HXA A;  4A3D K;  3MML B;  3GTJ K;  3AD7 C;  4A3J K;  1USO A;  4OIP A;  3BUE A;  5IP7 C;  3HOZ K;  4XSX A;  2NVX K;  1WCM C;  5EGH A;  3RZD K;  4GT9 A;  2RH6 A;  3M4O C;  5IYD C;  1XZP A;  2A68 A;  3HOU K;  3JST A;  1F93 A;  3CQZ A;  1UV7 A;  1I3Q K;  1I50 K;  4MEY A;  3GTG A;  2VUM A;  4OIQ A;  4XCH A;  1DCP A;  3S14 K;  2GAH C;  1EK8 A;  4A3E K;  3GTL A;  4YFK A;  4A3G K;  3HOY K;  2YU9 A;  2NVT K;  3S16 C;  3GTO K;  1J6V A;  2A69 A;  2P8T A;  4YFX A;  2O5I A;  2JA6 C;  2R93 K;  3FHZ A;  4A3C K;  5L46 A;  4A3B K;  1HQM A;  3LPX A;  4KMA A;  5D4D A;  2E2I K;  2R92 K;  3GTG C;  2VUM C;  4KDD A;  4G7Z A;  4M1X A;  3S1R K;  1XZP B;  5EGE A;  4A3I C;  3H3V L;  1DCH A;  3GTL C;  5IYC K;  2CW0 A;  4BY1 K;  2WB1 D;  5M5Y K;  2JA5 K;  1Y1W K;  3S0X A;  1VLO A;  3S1N K;  5C4X C;  3M3Y C;  4LJZ A;  4A3K K;  4P5B A;  1EQR A;  4PAA A;  4MEX A;  1KQ4 A;  4X6A K;  2V6T A;  2ZUF A;  2RGR A;  3GTJ C;  4A3D C;  3A8I A;  1INN A;  1VH2 A;  2NVQ K;  3CQZ K;  2V6U A;  4WIL A;  1I50 A;  4GTD A;  4YG2 A;  4XLP A;  2E2H K;  3LAJ A;  1VGX A;  3FOF A;  3VA7 A;  3K7A K;  1WOP A;  1SMY A;  2JA7 A;  3GTM A;  3ADA C;  4A3F K;  3HOU C;  4KAS A;  3GTO A;  5JFE A;  2KWA A;  1XXB A;  2PA8 L;  4C3I C;  4NOI A;  1I3Q C;  4XSZ A;  2V6S A;  1I50 C;  1IW7 A;  1USM A;  4Q5S A;  4P5A A;  5IOS A;  1EFW A;  5M5X K;  4C3H K;  3GTP K;  3S14 C;  4Y52 K;  1WOS A;  1O28 A;  4YFN A;  4A3E C;  2JA7 C;  3GTM C;  4A3L K;  1L0W A;  4A3G C;  3HOY C;  4JK1 A;  2NVT C;  1K83 K;  3GTO C;  4BBS K;  2JA5 A;  1Y1W A;  4LR2 A;  4A3B C;  2B63 A;  1WCM A;  1XXC A;  2E2I C;  3AD9 C;  2R92 C;  3HOV K;  1O26 A;  1B4B A;  4PAB A;  4AYB D;  1PJ7 A;  3S1R C;  4G7O A;  1XXA A;  4QIW L;  5IYC C;  4C2M K;  4BY1 C; 
#chains in the Genus database with same CATH homology
 1DCH A;  2V6S A;  1F93 A;  2V6T A;  1DCO A;  1RU0 A;  4LOW A;  2EBB A;  1USO A;  1USM A;  1DCP A;  3HXA A;  2V6U A;  4C45 A;  4WIL A;  3JST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...