3HOYK

Complete rna polymerase ii elongation complex vi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoyK00
5IP9C 3CQZC 2O5JA 2R7ZC 3S17K 4QJVB 4YFXA 2E2JK 4A93C 4AYBL 3S1NK 4LJZA 4Y52C 4QIWL 3GTKK 4A3DK 5C44C 1TWFC 4BBRK 3M3YC 2R92K 2JA5K 4YG2A 3S2HK 5C3EC 3GTQK 5IYDK 3HOXK 5M5WK 1K83K 4A3FK 3HOVC 2NVYC 4Y7NC 4A3JK 3K7AK 3GTJC 2NVQC 2Y0SD 2JA7K 3H3VD 2R93K 1ZYRA 1WCMK 1I3QC 1XPPA 3GTMC 4A3IK 3I4MC 2B63K 2NVXK 4OINA 3GTPK 3M4OK 4A3BK 5FLMK 1I50K 2VUMK 4A3EK 4A3GC 4X6AC 1TWCC 1Y1WC 4XLPA 1Y1VK 1IW7A 4C3HK 3PO3K 3S2DC 3S1MC 2JA8K 1YNJA 4AYBD 2YU9K 2E2HK 3PO2K 4A3LK 4QIWD 4OIPA 4BY7K 4C3IK 5C4XC 2NVTK 2PMZL 2E2IC 1SMYA 3HOUC 1TWHK 3S16K 5M5YK 5IYCK 2CW0A 3GTLC 5C4JC 5IP9K 3CQZK 4KN4A 4MQ9A 3GTGC 4LK0A 3S1QK 4A93K 5TMFA 4JK1A 1TWGC 3S1RC 1TWAK 3I4NC 4A3CC 3HOZC 5C44K 3RZDK 4YFKA 1BDFA 3FKIC 5C3EK 3S14K 4BXXC 3HOVK 4A3MC 1I6HK 2A68A 3DXJA 3GTJK 2NVQK 4C2MK 2PMZD 4A3KK 5IP7C 3S17C 3S15K 3H0GC 3HOWK 4A3GK 4MEYA 1TWCK 4A3DC 4X6AK 4BY1C 4BBRC 4BBSC 4NOIA 5IYBK 4GZYA 4KMUA 4A3FC 4OIQA 1R9TC 5C4XK 3HOYK 4G7OA 2JA6K 2E2IK 1SFOC 1WCMC 4LLGA 3HOUK 4XSXA 2R7ZK 4G7ZA 4A3IC 2B63C 2NVXC 3GTPC 3M4OC 4A3BC 3HKZL 2VUMC 1I50C 5C4JK 3GTGK 4Y52K 1HQMA 1Y1VC 1TWFK 4ZH4A 3M3YK 3PO3C 2A6EA 4QJVA 2JA8C 4XLNA 3S1RK 2YU9C 3I4NK 4A3LC 2A69A 2WB1L 3HOZK 5M5XK 3GTOC 2NVYK 3FKIK 4Y7NK 4BY7C 3RZOC 2NVTC 1I6VA 4BXXK 5M3FK 4G7HA 1I3QK 3GTMK 3I4MK 2WAQL 5M3MK 5IYCC 2E2JC 3S1NC 2PA8L 3S1QC 1Y1WK 4YFNA 3GTKC 5IP7K 4OIRA 2R92C 5IYDC 2JA5C 3S1MK 3H0GK 3GTQC 3HKZD 3HOXC 3S2HC 3S2DK 1K83C 1TWAC 4MEXA 4BY1K 3RZDC 4LK1A 4A3JC 3K7AC 4BBSK 2JA7C 3S14C 2R93C 4OIOA 4KN7A 3WODA 5TMCA 2WB1D 1I6HC 1R9TK 4Q5SA 5FJ8K 3GTLK 5FLMC 1SFOK 2A6HA 4A3EC 2PPBA 4A3KC 2O5IA 3S15C 2WAQD 1YNNA 3HOWC 1TWGK 2PA8D 2E2HC 3PO2C 4A3CK 2BE5A 4Q4ZA 2Y0SL 5IYBC 3EQLA 3H3VL 4C3JK 1TWHC 4XSZA 5D4DA 4A3MK 3GTOK 3HOYC 3RZOK 3S16C 2JA6C
chains in the Genus database with same CATH superfamily
5IP9C 3CQZC 3TFJA 3S1NK 4LJZA 4Y52C 1J6WA 5C44C 5EGHA 2JA5K 1BGWA 4P5BA 2KWAA 3T02A 2NVYC 3GTJC 2JA7K 1VRQC 1ZVUA 1ZXOA 2B63K 1R9TA 5FLMK 2VUMK 1TWCC 1IW7A 1B4BA 2VUMA 2XCQA 2E2HK 4BY7K 4C3IK 4P5AA 1JVIA 4PAAA 4KC6A 2CW0A 5C4JC 5EGEA 1J98A 1WIHA 1IE0A 3GTKA 1BDFA 5C3EK 3HOVK 1K83A 1I6HK 2W7VA 3DXJA 1VLOA 4GTLA 1EH1A 1WCMA 3SZYA 4J3NA 5IP7C 3ERED 3S17C 2NVXA 3CAGA 4A3GK 4X6AK 1XXAA 4A3DC 4LQYA 1O2BA 4BBRC 1O2AA 1WSRA 2V6SA 4GTEA 4KM9A 3IPJA 1SFOC 3AD8C 1WCMC 4LLGA 4BLBA 1WQGA 1TWHA 4FM9A 3LPXA 2R7ZK 2NVXC 4KMAA 4GTDA 3HKZL 1BS2A 3SZZA 1HQMA 4KMHA 2R7ZA 3TFIA 2V6TA 3M3YK 3PO3C 4QJVA 2JA8C 1USMA 3S1RK 3I4NK 4A3LC 4Y7NK 3RZOC 2NVTC 4BXXK 3I4MK 4OIRA 1VGXA 3S2DK 3S2HC 3H0GK 4XCHA 3HKZD 3GTQC 3VA7A 5IOSA 1O26A 4BBSK 3AD7C 2R93C 3AD9C 3GSIA 4C2MC 1XZPA 1PJ7A 1TWGK 4LOWA 3PO2C 4Q4ZA 3OREA 4XSZA 4A3MK 5D4DA 3QX3A 4WILA 3HOYC 3S16C 3LAJA 2O5JA 1F9NA 1I3QA 4GFQA 4QJVB 4YFXA 2E2JK 4A93C 2R92K 5IYDK 3HOXK 1VJEA 4LR2A 3K7AK 1O28A 3GDZA 1I3QC 3A8KA 3M4OK 3GTPK 4PABA 1I50K 3GTLA 4A3EK 3A8JA 4XLPA 1Y1VK 4C3HK 2JH3A 3S1MC 2YU9K 4RMFA 1DCOA 1XZPB 5C4XC 2FQOA 2E2IC 3GEEA 3GTOA 1XXBA 5M5YK 1XXCA 5IYCK 3GTLC 4GTFA 5IP9K 3CQZK 3GTGC 4LK0A 5TMFA 4A3CC 1TWAK 3HOZC 5C44K 3RZDK 3FKIC 2JA5A 1ISEA 3S14K 1O27A 1F93A 3GTJK 1WSVA 2JA7A 1B4AA 4A3KK 2B63A 1TWCK 1V5VA 2GSOA 4NOIA 5IYBK 1DD5A 1L0WA 4GTBA 2E2HA 1R9TC 4G7OA 4P9SA 2JA6K 2B63C 2RGRA 5JFEA 2VUMC 5C4JK 1EK8A 4KATA 1TWFK 1WQFA 3LAPA 1WQHA 3FHZA 1IBAA 4BY7C 4G0WA 3V4GA 4G7HA 3AH5A 3GTMK 1WORA 2WAQL 5M3MK 3BUEA 2PA8L 1Y1WK 4YFNA 3GTKC 5IP7K 1K83C 5E68A 4LK1A 1C0AA 4A3JC 4G0UA 4OIOA 3WODA 5TMCA 1I6HC 4Q5SA 3G4CA 1PJ5A 1SFOK 2PPBA 1O2FB 5HL8A 2WAQD 2PA8D 1F7VA 2Y0SL 3EQLA 3H3VL 1VH2A 1TWHC 2GSNA 3RZOK 2Y3PA 2RH6A 2R7ZC 4AYBL 4QIWL 3BP8C 3M3YC 4YG2A 3S2HK 3GTQK 3H0GA 3G4AA 4ILDA 4A3FK 4Y7NC 2NVQC 2Y0SD 3H3VD 2R93K 1XPPA 4A3IK 3I4MC 4OINA 4A3BK 2GAHC 1ZQ1C 3OEPA 3S2DC 1YNJA 4AYBD 3PO2K 1TWGA 1WOPA 4QIWD 3TTGA 2P8TA 2XCOA 2XCRB 5IOQA 3HOUC 3S16K 1BJTA 4KN4A 4MQ9A 3S1QK 2GAGC 4A93K 2P5MA 4JK1A 1TWGC 3AQOA 2R92A 4A3MC 5CJ9A 1JOEA 1IL2A 4WJ3M 1KQ4A 5IORA 3ADAC 3S15K 3GTPA 3HOWK 5L46A 1I50A 3TFHA 4BY1C 1Y1VA 1DCHA 1J6VA 4GZYA 4KMUA 2YU9A 4GTAA 5C4XK 3T01A 2E2IK 1IS1A 4C45A 3M4OC 1PJ6A 3FOFA 3GTPC 3NUHA 3L4JA 1I50C 3GTGK 3CQZA 4Y52K 1ZBSA 1Y1VC 4C3HC 1HI9A 4C3JC 3Q3QA 2YU9C 2A69A 1TWAA 3HOZK 5M5XK 3GTOC 2NVYK 3FKIK 1EI6A 1INNA 3GTJA 5IYCC 3S1NC 4DDQA 1O24A 3GEHA 4KMDA 2JA5C 1XZQB 3L4KA 3BP3A 1O25A 1TWAC 1TWCA 5CHPA 3RZDC 3OPFA 2JA7C 3S14C 4KARA 1R9TK 5FLMC 2JA6A 1RU0A 2A6HA 4FZBA 4A3KC 4KAWX 1WOOA 3JSTA 2GSUA 2E2HC 2BE5A 4C3IC 1TWFA 4G0VA 5IYBC 2D6FC 3AQPA 2JA6C 3S17K 3GTMA 2ZUEA 1YX2A 4A3DK 3GTKK 1Y1WA 1TWFC 4BBRK 5C3EC 5M5WK 1YCLA 1K83K 3HOVC 4A3JK 2ZFZA 1DCPA 1ZYRA 1WCMK 5JVOA 3GTMC 1IQ0A 2NVXK 1SFOA 4A3GC 4X6AC 1Y1WC 3PO3K 2JA8K 3GEIA 4AH6A 4OIPA 4A3LK 3A8IA 2NVTK 2PMZL 2EBBA 5TJ3A 1SMYA 1TWHK 1AB4A 3FOEA 1GE9A 3S1RC 3I4NC 4YFKA 4BXXC 1F7UA 3GTQA 2A68A 1O29A 2NVQK 4C2MK 2PMZD 2R93A 3N3YA 3H0GC 4MEYA 2PHCB 1J6XA 4KASA 4BBSC 4A3FC 4OIQA 4GTCA 2FQTA 3HOYK 3HOUK 4O2DA 4XSXA 4G7ZA 4A3IC 2CFAA 4A3BC 4ZH4A 4GT9A 2A6EA 4KB4A 4XLNA 3N0CA 1XZQA 2WB1L 3HXAA 1I6VA 1X31C 5M3FK 1I3QK 3S0XA 2E2JC 1UV7A 1EFWA 3S1QC 3N0BA 4KM8A 2R92C 5IYDC 3S1MK 3T00A 3HOXC 4KB2A 5IOTA 4MEXA 4BY1K 3K7AC 4KN7A 2WB1D 3MMLB 1G51A 1EQRA 5FJ8K 3GTLK 4KDDA 2E2IA 2V6UA 4A3EC 1JQWA 2O5IA 3S15C 1YNNA 3HOWC 4A3CK 4M1XA 4BLAA 3GTGA 4BKWA 2ZUFA 4C3JK 3GIRA 1USOA 3GTOK 2CFAB 1WOSA 4WJ4A 2NVYA 3FKIA
chains in the Genus database with same CATH topology
5IP9C 3CQZC 2O5JA 2R7ZC 3S17K 4QJVB 4YFXA 2E2JK 4A93C 4AYBL 3S1NK 4LJZA 4Y52C 4QIWL 3GTKK 4A3DK 5C44C 1TWFC 4BBRK 3M3YC 2R92K 2JA5K 4YG2A 3S2HK 5C3EC 3GTQK 5IYDK 3HOXK 5M5WK 1K83K 4A3FK 3HOVC 2NVYC 4Y7NC 4A3JK 3K7AK 3GTJC 2NVQC 2Y0SD 2JA7K 3H3VD 2R93K 1ZYRA 1WCMK 1I3QC 1XPPA 3GTMC 4A3IK 3I4MC 2B63K 2NVXK 4OINA 3GTPK 3M4OK 4A3BK 5FLMK 1I50K 2VUMK 4A3EK 4A3GC 4X6AC 1TWCC 1Y1WC 4XLPA 1Y1VK 1IW7A 4C3HK 3PO3K 3S2DC 3S1MC 2JA8K 1YNJA 4AYBD 2YU9K 2E2HK 3PO2K 4A3LK 4QIWD 4OIPA 4BY7K 4C3IK 5C4XC 2NVTK 2PMZL 2E2IC 1SMYA 3HOUC 1TWHK 3S16K 5M5YK 5IYCK 2CW0A 3GTLC 5C4JC 5IP9K 3CQZK 4KN4A 4MQ9A 3GTGC 4LK0A 3S1QK 4A93K 5TMFA 4JK1A 1TWGC 3S1RC 1TWAK 3I4NC 4A3CC 3HOZC 5C44K 3RZDK 4YFKA 1BDFA 3FKIC 5C3EK 3S14K 4BXXC 3HOVK 4A3MC 1I6HK 2A68A 3DXJA 3GTJK 2NVQK 4C2MK 2PMZD 4A3KK 5IP7C 3S17C 3S15K 3H0GC 3HOWK 4A3GK 4MEYA 1TWCK 4A3DC 4X6AK 4BY1C 4BBRC 4BBSC 4NOIA 5IYBK 4GZYA 4KMUA 4A3FC 4OIQA 1R9TC 5C4XK 3HOYK 4G7OA 2JA6K 2E2IK 1SFOC 1WCMC 4LLGA 3HOUK 4XSXA 2R7ZK 4G7ZA 4A3IC 2B63C 2NVXC 3GTPC 3M4OC 4A3BC 3HKZL 2VUMC 1I50C 5C4JK 3GTGK 4Y52K 1HQMA 1Y1VC 1TWFK 4ZH4A 3M3YK 3PO3C 2A6EA 4QJVA 2JA8C 4XLNA 3S1RK 2YU9C 3I4NK 4A3LC 2A69A 2WB1L 3HOZK 5M5XK 3GTOC 2NVYK 3FKIK 4Y7NK 4BY7C 3RZOC 2NVTC 1I6VA 4BXXK 5M3FK 4G7HA 1I3QK 3GTMK 3I4MK 2WAQL 5M3MK 5IYCC 2E2JC 3S1NC 2PA8L 3S1QC 1Y1WK 4YFNA 3GTKC 5IP7K 4OIRA 2R92C 5IYDC 2JA5C 3S1MK 3H0GK 3GTQC 3HKZD 3HOXC 3S2HC 3S2DK 1K83C 1TWAC 4MEXA 4BY1K 3RZDC 4LK1A 4A3JC 3K7AC 4BBSK 2JA7C 3S14C 2R93C 4OIOA 4KN7A 3WODA 5TMCA 2WB1D 1I6HC 1R9TK 4Q5SA 5FJ8K 3GTLK 5FLMC 1SFOK 2A6HA 4A3EC 2PPBA 4A3KC 2O5IA 3S15C 2WAQD 1YNNA 3HOWC 1TWGK 2PA8D 2E2HC 3PO2C 4A3CK 2BE5A 4Q4ZA 2Y0SL 5IYBC 3EQLA 3H3VL 4C3JK 1TWHC 4XSZA 5D4DA 4A3MK 3GTOK 3HOYC 3RZOK 3S16C 2JA6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 C;  3CQZ C;  2O5J A;  2R7Z C;  3S17 K;  4QJV B;  4YFX A;  2E2J K;  4A93 C;  4AYB L;  3S1N K;  4LJZ A;  4Y52 C;  4QIW L;  3GTK K;  4A3D K;  5C44 C;  1TWF C;  4BBR K;  3M3Y C;  2R92 K;  2JA5 K;  4YG2 A;  3S2H K;  5C3E C;  3GTQ K;  5IYD K;  3HOX K;  5M5W K;  1K83 K;  4A3F K;  3HOV C;  2NVY C;  4Y7N C;  4A3J K;  3K7A K;  3GTJ C;  2NVQ C;  2Y0S D;  2JA7 K;  3H3V D;  2R93 K;  1ZYR A;  1WCM K;  1I3Q C;  1XPP A;  3GTM C;  4A3I K;  3I4M C;  2B63 K;  2NVX K;  4OIN A;  3GTP K;  3M4O K;  4A3B K;  5FLM K;  1I50 K;  2VUM K;  4A3E K;  4A3G C;  4X6A C;  1TWC C;  1Y1W C;  4XLP A;  1Y1V K;  1IW7 A;  4C3H K;  3PO3 K;  3S2D C;  3S1M C;  2JA8 K;  1YNJ A;  4AYB D;  2YU9 K;  2E2H K;  3PO2 K;  4A3L K;  4QIW D;  4OIP A;  4BY7 K;  4C3I K;  5C4X C;  2NVT K;  2PMZ L;  2E2I C;  1SMY A;  3HOU C;  1TWH K;  3S16 K;  5M5Y K;  5IYC K;  2CW0 A;  3GTL C;  5C4J C;  5IP9 K;  3CQZ K;  4KN4 A;  4MQ9 A;  3GTG C;  4LK0 A;  3S1Q K;  4A93 K;  5TMF A;  4JK1 A;  1TWG C;  3S1R C;  1TWA K;  3I4N C;  4A3C C;  3HOZ C;  5C44 K;  3RZD K;  4YFK A;  1BDF A;  3FKI C;  5C3E K;  3S14 K;  4BXX C;  3HOV K;  4A3M C;  1I6H K;  2A68 A;  3DXJ A;  3GTJ K;  2NVQ K;  4C2M K;  2PMZ D;  4A3K K;  5IP7 C;  3S17 C;  3S15 K;  3H0G C;  3HOW K;  4A3G K;  4MEY A;  1TWC K;  4A3D C;  4X6A K;  4BY1 C;  4BBR C;  4BBS C;  4NOI A;  5IYB K;  4GZY A;  4KMU A;  4A3F C;  4OIQ A;  1R9T C;  5C4X K;  3HOY K;  4G7O A;  2JA6 K;  2E2I K;  1SFO C;  1WCM C;  4LLG A;  3HOU K;  4XSX A;  2R7Z K;  4G7Z A;  4A3I C;  2B63 C;  2NVX C;  3GTP C;  3M4O C;  4A3B C;  3HKZ L;  2VUM C;  1I50 C;  5C4J K;  3GTG K;  4Y52 K;  1HQM A;  1Y1V C;  1TWF K;  4ZH4 A;  3M3Y K;  3PO3 C;  2A6E A;  4QJV A;  2JA8 C;  4XLN A;  3S1R K;  2YU9 C;  3I4N K;  4A3L C;  2A69 A;  2WB1 L;  3HOZ K;  5M5X K;  3GTO C;  2NVY K;  3FKI K;  4Y7N K;  4BY7 C;  3RZO C;  2NVT C;  1I6V A;  4BXX K;  5M3F K;  4G7H A;  1I3Q K;  3GTM K;  3I4M K;  2WAQ L;  5M3M K;  5IYC C;  2E2J C;  3S1N C;  2PA8 L;  3S1Q C;  1Y1W K;  4YFN A;  3GTK C;  5IP7 K;  4OIR A;  2R92 C;  5IYD C;  2JA5 C;  3S1M K;  3H0G K;  3GTQ C;  3HKZ D;  3HOX C;  3S2H C;  3S2D K;  1K83 C;  1TWA C;  4MEX A;  4BY1 K;  3RZD C;  4LK1 A;  4A3J C;  3K7A C;  4BBS K;  2JA7 C;  3S14 C;  2R93 C;  4OIO A;  4KN7 A;  3WOD A;  5TMC A;  2WB1 D;  1I6H C;  1R9T K;  4Q5S A;  5FJ8 K;  3GTL K;  5FLM C;  1SFO K;  2A6H A;  4A3E C;  2PPB A;  4A3K C;  2O5I A;  3S15 C;  2WAQ D;  1YNN A;  3HOW C;  1TWG K;  2PA8 D;  2E2H C;  3PO2 C;  4A3C K;  2BE5 A;  4Q4Z A;  2Y0S L;  5IYB C;  3EQL A;  3H3V L;  4C3J K;  1TWH C;  4XSZ A;  5D4D A;  4A3M K;  3GTO K;  3HOY C;  3RZO K;  3S16 C;  2JA6 C; 
#chains in the Genus database with same CATH topology
 5IP9 C;  3CQZ C;  3TFJ A;  3S1N K;  4LJZ A;  4Y52 C;  1J6W A;  5C44 C;  5EGH A;  2JA5 K;  1BGW A;  4P5B A;  2KWA A;  3T02 A;  2NVY C;  3GTJ C;  2JA7 K;  1VRQ C;  1ZVU A;  1ZXO A;  2B63 K;  1R9T A;  5FLM K;  2VUM K;  1TWC C;  1IW7 A;  1B4B A;  2VUM A;  2XCQ A;  2E2H K;  4BY7 K;  4C3I K;  4P5A A;  1JVI A;  4PAA A;  4KC6 A;  2CW0 A;  5C4J C;  5EGE A;  1J98 A;  1WIH A;  1IE0 A;  3GTK A;  1BDF A;  5C3E K;  3HOV K;  1K83 A;  1I6H K;  2W7V A;  3DXJ A;  1VLO A;  4GTL A;  1EH1 A;  1WCM A;  3SZY A;  4J3N A;  5IP7 C;  3ERE D;  3S17 C;  2NVX A;  3CAG A;  4A3G K;  4X6A K;  1XXA A;  4A3D C;  4LQY A;  1O2B A;  4BBR C;  1O2A A;  1WSR A;  2V6S A;  4GTE A;  4KM9 A;  3IPJ A;  1SFO C;  3AD8 C;  1WCM C;  4LLG A;  4BLB A;  1WQG A;  1TWH A;  4FM9 A;  3LPX A;  2R7Z K;  2NVX C;  4KMA A;  4GTD A;  3HKZ L;  1BS2 A;  3SZZ A;  1HQM A;  4KMH A;  2R7Z A;  3TFI A;  2V6T A;  3M3Y K;  3PO3 C;  4QJV A;  2JA8 C;  1USM A;  3S1R K;  3I4N K;  4A3L C;  4Y7N K;  3RZO C;  2NVT C;  4BXX K;  3I4M K;  4OIR A;  1VGX A;  3S2D K;  3S2H C;  3H0G K;  4XCH A;  3HKZ D;  3GTQ C;  3VA7 A;  5IOS A;  1O26 A;  4BBS K;  3AD7 C;  2R93 C;  3AD9 C;  3GSI A;  4C2M C;  1XZP A;  1PJ7 A;  1TWG K;  4LOW A;  3PO2 C;  4Q4Z A;  3ORE A;  4XSZ A;  4A3M K;  5D4D A;  3QX3 A;  4WIL A;  3HOY C;  3S16 C;  3LAJ A;  2O5J A;  1F9N A;  1I3Q A;  4GFQ A;  4QJV B;  4YFX A;  2E2J K;  4A93 C;  2R92 K;  5IYD K;  3HOX K;  1VJE A;  4LR2 A;  3K7A K;  1O28 A;  3GDZ A;  1I3Q C;  3A8K A;  3M4O K;  3GTP K;  4PAB A;  1I50 K;  3GTL A;  4A3E K;  3A8J A;  4XLP A;  1Y1V K;  4C3H K;  2JH3 A;  3S1M C;  2YU9 K;  4RMF A;  1DCO A;  1XZP B;  5C4X C;  2FQO A;  2E2I C;  3GEE A;  3GTO A;  1XXB A;  5M5Y K;  1XXC A;  5IYC K;  3GTL C;  4GTF A;  5IP9 K;  3CQZ K;  3GTG C;  4LK0 A;  5TMF A;  4A3C C;  1TWA K;  3HOZ C;  5C44 K;  3RZD K;  3FKI C;  2JA5 A;  1ISE A;  3S14 K;  1O27 A;  1F93 A;  3GTJ K;  1WSV A;  2JA7 A;  1B4A A;  4A3K K;  2B63 A;  1TWC K;  1V5V A;  2GSO A;  4NOI A;  5IYB K;  1DD5 A;  1L0W A;  4GTB A;  2E2H A;  1R9T C;  4G7O A;  4P9S A;  2JA6 K;  2B63 C;  2RGR A;  5JFE A;  2VUM C;  5C4J K;  1EK8 A;  4KAT A;  1TWF K;  1WQF A;  3LAP A;  1WQH A;  3FHZ A;  1IBA A;  4BY7 C;  4G0W A;  3V4G A;  4G7H A;  3AH5 A;  3GTM K;  1WOR A;  2WAQ L;  5M3M K;  3BUE A;  2PA8 L;  1Y1W K;  4YFN A;  3GTK C;  5IP7 K;  1K83 C;  5E68 A;  4LK1 A;  1C0A A;  4A3J C;  4G0U A;  4OIO A;  3WOD A;  5TMC A;  1I6H C;  4Q5S A;  3G4C A;  1PJ5 A;  1SFO K;  2PPB A;  1O2F B;  5HL8 A;  2WAQ D;  2PA8 D;  1F7V A;  2Y0S L;  3EQL A;  3H3V L;  1VH2 A;  1TWH C;  2GSN A;  3RZO K;  2Y3P A;  2RH6 A;  2R7Z C;  4AYB L;  4QIW L;  3BP8 C;  3M3Y C;  4YG2 A;  3S2H K;  3GTQ K;  3H0G A;  3G4A A;  4ILD A;  4A3F K;  4Y7N C;  2NVQ C;  2Y0S D;  3H3V D;  2R93 K;  1XPP A;  4A3I K;  3I4M C;  4OIN A;  4A3B K;  2GAH C;  1ZQ1 C;  3OEP A;  3S2D C;  1YNJ A;  4AYB D;  3PO2 K;  1TWG A;  1WOP A;  4QIW D;  3TTG A;  2P8T A;  2XCO A;  2XCR B;  5IOQ A;  3HOU C;  3S16 K;  1BJT A;  4KN4 A;  4MQ9 A;  3S1Q K;  2GAG C;  4A93 K;  2P5M A;  4JK1 A;  1TWG C;  3AQO A;  2R92 A;  4A3M C;  5CJ9 A;  1JOE A;  1IL2 A;  4WJ3 M;  1KQ4 A;  5IOR A;  3ADA C;  3S15 K;  3GTP A;  3HOW K;  5L46 A;  1I50 A;  3TFH A;  4BY1 C;  1Y1V A;  1DCH A;  1J6V A;  4GZY A;  4KMU A;  2YU9 A;  4GTA A;  5C4X K;  3T01 A;  2E2I K;  1IS1 A;  4C45 A;  3M4O C;  1PJ6 A;  3FOF A;  3GTP C;  3NUH A;  3L4J A;  1I50 C;  3GTG K;  3CQZ A;  4Y52 K;  1ZBS A;  1Y1V C;  4C3H C;  1HI9 A;  4C3J C;  3Q3Q A;  2YU9 C;  2A69 A;  1TWA A;  3HOZ K;  5M5X K;  3GTO C;  2NVY K;  3FKI K;  1EI6 A;  1INN A;  3GTJ A;  5IYC C;  3S1N C;  4DDQ A;  1O24 A;  3GEH A;  4KMD A;  2JA5 C;  1XZQ B;  3L4K A;  3BP3 A;  1O25 A;  1TWA C;  1TWC A;  5CHP A;  3RZD C;  3OPF A;  2JA7 C;  3S14 C;  4KAR A;  1R9T K;  5FLM C;  2JA6 A;  1RU0 A;  2A6H A;  4FZB A;  4A3K C;  4KAW X;  1WOO A;  3JST A;  2GSU A;  2E2H C;  2BE5 A;  4C3I C;  1TWF A;  4G0V A;  5IYB C;  2D6F C;  3AQP A;  2JA6 C;  3S17 K;  3GTM A;  2ZUE A;  1YX2 A;  4A3D K;  3GTK K;  1Y1W A;  1TWF C;  4BBR K;  5C3E C;  5M5W K;  1YCL A;  1K83 K;  3HOV C;  4A3J K;  2ZFZ A;  1DCP A;  1ZYR A;  1WCM K;  5JVO A;  3GTM C;  1IQ0 A;  2NVX K;  1SFO A;  4A3G C;  4X6A C;  1Y1W C;  3PO3 K;  2JA8 K;  3GEI A;  4AH6 A;  4OIP A;  4A3L K;  3A8I A;  2NVT K;  2PMZ L;  2EBB A;  5TJ3 A;  1SMY A;  1TWH K;  1AB4 A;  3FOE A;  1GE9 A;  3S1R C;  3I4N C;  4YFK A;  4BXX C;  1F7U A;  3GTQ A;  2A68 A;  1O29 A;  2NVQ K;  4C2M K;  2PMZ D;  2R93 A;  3N3Y A;  3H0G C;  4MEY A;  2PHC B;  1J6X A;  4KAS A;  4BBS C;  4A3F C;  4OIQ A;  4GTC A;  2FQT A;  3HOY K;  3HOU K;  4O2D A;  4XSX A;  4G7Z A;  4A3I C;  2CFA A;  4A3B C;  4ZH4 A;  4GT9 A;  2A6E A;  4KB4 A;  4XLN A;  3N0C A;  1XZQ A;  2WB1 L;  3HXA A;  1I6V A;  1X31 C;  5M3F K;  1I3Q K;  3S0X A;  2E2J C;  1UV7 A;  1EFW A;  3S1Q C;  3N0B A;  4KM8 A;  2R92 C;  5IYD C;  3S1M K;  3T00 A;  3HOX C;  4KB2 A;  5IOT A;  4MEX A;  4BY1 K;  3K7A C;  4KN7 A;  2WB1 D;  3MML B;  1G51 A;  1EQR A;  5FJ8 K;  3GTL K;  4KDD A;  2E2I A;  2V6U A;  4A3E C;  1JQW A;  2O5I A;  3S15 C;  1YNN A;  3HOW C;  4A3C K;  4M1X A;  4BLA A;  3GTG A;  4BKW A;  2ZUF A;  4C3J K;  3GIR A;  1USO A;  3GTO K;  2CFA B;  1WOS A;  4WJ4 A;  2NVY A;  3FKI A; 
#chains in the Genus database with same CATH homology
 5IP9 C;  3CQZ C;  2O5J A;  2R7Z C;  3S17 K;  4QJV B;  4YFX A;  2E2J K;  4A93 C;  4AYB L;  3S1N K;  4LJZ A;  4Y52 C;  4QIW L;  3GTK K;  4A3D K;  5C44 C;  1TWF C;  4BBR K;  3M3Y C;  2R92 K;  2JA5 K;  4YG2 A;  3S2H K;  5C3E C;  3GTQ K;  5IYD K;  3HOX K;  5M5W K;  1K83 K;  4A3F K;  3HOV C;  2NVY C;  4Y7N C;  4A3J K;  3K7A K;  3GTJ C;  2NVQ C;  2Y0S D;  2JA7 K;  3H3V D;  2R93 K;  1ZYR A;  1WCM K;  1I3Q C;  1XPP A;  3GTM C;  4A3I K;  3I4M C;  2B63 K;  2NVX K;  4OIN A;  3GTP K;  3M4O K;  4A3B K;  5FLM K;  1I50 K;  2VUM K;  4A3E K;  4A3G C;  4X6A C;  1TWC C;  1Y1W C;  4XLP A;  1Y1V K;  1IW7 A;  4C3H K;  3PO3 K;  3S2D C;  3S1M C;  2JA8 K;  1YNJ A;  4AYB D;  2YU9 K;  2E2H K;  3PO2 K;  4A3L K;  4QIW D;  4OIP A;  4BY7 K;  4C3I K;  5C4X C;  2NVT K;  2PMZ L;  2E2I C;  1SMY A;  3HOU C;  1TWH K;  3S16 K;  5M5Y K;  5IYC K;  2CW0 A;  3GTL C;  5C4J C;  5IP9 K;  3CQZ K;  4KN4 A;  4MQ9 A;  3GTG C;  4LK0 A;  3S1Q K;  4A93 K;  5TMF A;  4JK1 A;  1TWG C;  3S1R C;  1TWA K;  3I4N C;  4A3C C;  3HOZ C;  5C44 K;  3RZD K;  4YFK A;  1BDF A;  3FKI C;  5C3E K;  3S14 K;  4BXX C;  3HOV K;  4A3M C;  1I6H K;  2A68 A;  3DXJ A;  3GTJ K;  2NVQ K;  4C2M K;  2PMZ D;  4A3K K;  5IP7 C;  3S17 C;  3S15 K;  3H0G C;  3HOW K;  4A3G K;  4MEY A;  1TWC K;  4A3D C;  4X6A K;  4BY1 C;  4BBR C;  4BBS C;  4NOI A;  5IYB K;  4GZY A;  4KMU A;  4A3F C;  4OIQ A;  1R9T C;  5C4X K;  3HOY K;  4G7O A;  2JA6 K;  2E2I K;  1SFO C;  1WCM C;  4LLG A;  3HOU K;  4XSX A;  2R7Z K;  4G7Z A;  4A3I C;  2B63 C;  2NVX C;  3GTP C;  3M4O C;  4A3B C;  3HKZ L;  2VUM C;  1I50 C;  5C4J K;  3GTG K;  4Y52 K;  1HQM A;  1Y1V C;  1TWF K;  4ZH4 A;  3M3Y K;  3PO3 C;  2A6E A;  4QJV A;  2JA8 C;  4XLN A;  3S1R K;  2YU9 C;  3I4N K;  4A3L C;  2A69 A;  2WB1 L;  3HOZ K;  5M5X K;  3GTO C;  2NVY K;  3FKI K;  4Y7N K;  4BY7 C;  3RZO C;  2NVT C;  1I6V A;  4BXX K;  5M3F K;  4G7H A;  1I3Q K;  3GTM K;  3I4M K;  2WAQ L;  5M3M K;  5IYC C;  2E2J C;  3S1N C;  2PA8 L;  3S1Q C;  1Y1W K;  4YFN A;  3GTK C;  5IP7 K;  4OIR A;  2R92 C;  5IYD C;  2JA5 C;  3S1M K;  3H0G K;  3GTQ C;  3HKZ D;  3HOX C;  3S2H C;  3S2D K;  1K83 C;  1TWA C;  4MEX A;  4BY1 K;  3RZD C;  4LK1 A;  4A3J C;  3K7A C;  4BBS K;  2JA7 C;  3S14 C;  2R93 C;  4OIO A;  4KN7 A;  3WOD A;  5TMC A;  2WB1 D;  1I6H C;  1R9T K;  4Q5S A;  5FJ8 K;  3GTL K;  5FLM C;  1SFO K;  2A6H A;  4A3E C;  2PPB A;  4A3K C;  2O5I A;  3S15 C;  2WAQ D;  1YNN A;  3HOW C;  1TWG K;  2PA8 D;  2E2H C;  3PO2 C;  4A3C K;  2BE5 A;  4Q4Z A;  2Y0S L;  5IYB C;  3EQL A;  3H3V L;  4C3J K;  1TWH C;  4XSZ A;  5D4D A;  4A3M K;  3GTO K;  3HOY C;  3RZO K;  3S16 C;  2JA6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...