3HOYK

Complete rna polymerase ii elongation complex vi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoyK00
2R7ZC 3S16K 4GZYA 4BY1K 2R7ZK 3I4NC 2CW0A 4LK1A 4XLNA 3GTKC 3I4NK 3S1QC 1TWHC 3S17C 4YFKA 1TWCC 3PO3K 4A3JC 2E2HC 4LLGA 3S17K 4A3MK 1TWCK 4A3JK 2E2HK 3H3VL 4Q5SA 4A3GC 2A6EA 4A3GK 2R92C 4ZH4A 4QIWD 5IP7C 3HOXC 2JA8C 2R92K 4XSXA 4A3EC 4A3BC 5IP7K 3HOXK 2PMZD 3GTJC 4A3EK 2JA8K 3GTGC 2WB1D 1HQMA 4AYBD 3GTGK 3RZOK 3PO2C 2JA5K 4A3CC 4YFNA 4G7OA 3PO2K 4C3HK 4Y7NC 4A3FK 4A3CK 4BBRC 3S1MC 4Y7NK 4BBRK 4BBSC 3S1MK 3HKZD 1TWFK 4Y52C 2PA8L 4BBSK 2JA7C 4Y52K 2NVTC 4KMUA 2JA7K 5IYCC 4A3IC 4MEXA 1WCMC 2NVTK 3GTKK 2BE5A 2Y0SD 3GTQC 4A3IK 3GTMC 1WCMK 3S1QK 1TWHK 3GTQK 5C44C 3GTMK 1SFOC 4A93C 1SFOK 2NVXC 4A93K 5C3EC 3S14C 1I3QC 3HOWC 4YG2A 5M5WK 5FJ8K 5C3EK 5M5XK 3S14K 4OIPA 4A3BK 5M3FK 4BXXC 4A3DC 4XLPA 2A69A 1SMYA 4X6AC 3GTJK 4BXXK 4A3DK 2B63C 3CQZC 4QJVB 4OINA 2B63K 3H0GC 3GTOC 3CQZK 2WAQL 4LK0A 4Q4ZA 2NVYC 3H0GK 3GTOK 3GTPC 1I50C 3K7AC 4KN7A 1XPPA 2A68A 2A6HA 3H3VD 3S1RC 3GTPK 1I50K 3K7AK 3M3YC 2PPBA 3S1RK 5C4JC 4A3LC 3M3YK 4JK1A 5C4JK 5C4XC 4A3LK 3S1NC 4C3JK 3HOUC 5IYCK 4QJVA 5C4XK 4OIQA 3RZDC 3S1NK 5FLMC 3HOUK 4C3IK 4A3KC 3DXJA 5FLMK 5C44K 4A3KK 1K83C 2JA6C 1TWGC 1K83K 4MQ9A 5M5YK 1YNNA 1TWGK 2NVXK 2JA6K 4MEYA 1YNJA 1I3QK 5D4DA 3HOWK 3I4MK 3HOYC 5TMFA 3HOYK 3HOZC 4XSZA 4QIWL 5IYBC 2NVQC 3HOVC 3HOZK 4X6AK 2PA8D 2NVQK 2PMZL 5TMCA 4BY1C 2O5IA 4LJZA 1TWAC 1BDFA 1IW7A 2WB1L 4AYBL 1TWAK 3S2HC 3M4OC 2O5JA 3PO3C 2NVYK 4OIOA 4G7HA 3S2HK 3M4OK 2R93C 4A3MC 5IYDC 3S2DC 2R93K 3S2DK 3EQLA 1Y1VC 2E2JC 3HKZL 5IYDK 1ZYRA 4YFXA 1Y1VK 1R9TC 2E2JK 2E2IC 3I4MC 5IP9C 1R9TK 2E2IK 3FKIC 3RZDK 5IP9K 2Y0SL 3FKIK 4NOIA 2YU9C 3RZOC 3GTLC 2VUMC 2YU9K 1Y1WC 2WAQD 5M3MK 2JA5C 3WODA 2VUMK 3GTLK 3S15C 4BY7C 1Y1WK 4C2MK 4G7ZA 4A3FC 3S15K 4BY7K 1I6HC 4OIRA 1I6HK 4KN4A 1I6VA 3HOVK 5IYBK 3S16C 1TWFC
chains in the Genus database with same CATH superfamily
3OREA 2R7ZC 2GAGC 1WIHA 4XLNA 1TWHC 3S17C 4M1XA 4LLGA 1TWCK 4A3JK 2E2HK 4J3NA 1J6VA 4GTCA 2R92C 3HOXC 4KMHA 5IP7K 2JA8K 3SZYA 1USOA 2GSUA 2V6UA 1HQMA 3GTGK 4LR2A 2D6FC 3AD8C 4C3HK 4A3FK 4KAWX 4A3CK 1YX2A 4KMAA 3TFHA 1WOOA 4Y7NK 1WCMA 4BBRK 1TWFK 2JA7C 4KMUA 3GSIA 1SFOA 4P9SA 5IYCC 1YCLA 3GTQC 1EK8A 4A3IK 3GTMC 1TWHK 1INNA 3S14K 1VRQC 5M3FK 4RMFA 3GTOA 1SMYA 2JH3A 3N3YA 3T02A 2B63K 3H0GC 5JFEA 4LK0A 2CFAB 2ZUFA 5IOQA 3GTPC 1I50C 4P5BA 1F7UA 1L0WA 5C4JC 3G4AA 4A3LC 4GTAA 1K83A 2JA6A 1TWGA 5IYCK 4QJVA 4OIQA 3RZDC 3HOUK 3DXJA 4XCHA 4BLBA 3N0CA 5M5YK 1YNNA 4MEYA 1EFWA 4WJ3M 3QX3A 3GEIA 1TWAA 3HOYK 3HOVC 2NVQC 1O2BA 5TMCA 4BY1C 1IW7A 3S2HC 4OIOA 4G7HA 1R9TA 5IYDC 1EQRA 3FKIA 1XZPB 3S2DK 2E2JC 1O29A 4GFQA 2VUMA 2E2IK 3RZDK 3AD7C 2YU9C 3RZOC 2WAQD 4C2MC 3S15C 1Y1WK 4OIRA 3HOVK 5IOSA 3S16K 4GZYA 3AQOA 4BY1K 2CW0A 4LK1A 3GTKC 1BGWA 4WJ4A 4YFKA 1TWCC 4A3JC 2E2HC 2XCRB 2ZFZA 3BUEA 4ILDA 1VH2A 3GTJA 2A6EA 5EGEA 4A3GK 3A8IA 1X31C 5IP7C 2JA8C 3S0XA 1O26A 4A3BC 2JA5A 1USMA 3GTGC 3RZOK 1VGXA 4C3HC 3FHZA 4A3CC 4YFNA 4G7OA 2P5MA 4Y7NC 4BBRC 1F9NA 1O27A 4DDQA 3FOEA 3S1MK 4Y52K 5IOTA 2V6TA 4C3JC 4A3IC 3GTKK 1WCMK 4PABA 4GT9A 1SFOK 1JOEA 1KQ4A 2GSOA 3LAPA 3S14C 1I3QC 4OIPA 1WQHA 4A3BK 1DCHA 1WORA 1ZVUA 3CQZA 2A69A 4BXXK 4BKWA 2NVYA 4G0WA 2B63C 4QJVB 1VJEA 2WAQL 3T00A 3GTOK 5EGHA 3H3VD 1WOSA 3S1RK 2FQOA 2NVXA 4C3JK 3HOUC 5TJ3A 4C3IK 2V6SA 2ZUEA 4A3KK 1IE0A 3L4KA 1K83K 4MQ9A 2JA6K 1DD5A 1TWGK 1I3QK 3I4MK 1XXCA 3HOYC 2GAHC 3HOZK 2R93A 1BDFA 1TWAK 3A8KA 1Y1VA 4A3MC 3S2DC 1B4BA 1XZQB 1O24A 1JVIA 2E2IC 3GTLA 1R9TK 1WSVA 3FKIK 4LQYA 4NOIA 4AH6A 1V5VA 1Y1WC 2XCOA 2JA5C 1TWFA 2VUMK 3AQPA 2R7ZA 3A8JA 4BY7K 4KMDA 4KB4A 1BS2A 1I6HK 4KN4A 3S16C 5L46A 3ADAC 1TWHA 2EBBA 3ERED 4KARA 3I4NK 3LPXA 2R92A 4A3MK 3H3VL 4Q5SA 4A3GC 3GIRA 1J6XA 4GTEA 4XSXA 4A3EK 4GTDA 3BP8C 3TFIA 2WB1D 4AYBD 1O2AA 3CAGA 2JA5K 3PO2K 2JA7A 4FZBA 1HI9A 3AH5A 4PAAA 3S1MC 3TTGA 3AD9C 3GTQA 3HKZD 4Y52C 3GTMA 1IBAA 4BBSK 2KWAA 2NVTK 4MEXA 1WCMC 2Y0SD 2Y3PA 3G4CA 3T01A 2XCQA 2GSNA 2CFAA 4KASA 1SFOC 1ISEA 2NVXC 1UV7A 4A93K 1O2FB 1O25A 4YG2A 5M5WK 5FJ8K 5C3EK 5M5XK 3HOWC 1ZXOA 4BXXC 3H0GA 4XLPA 1G51A 4A3DK 3GTPA 3N0BA 1I50A 3GTOC 3CQZK 4Q4ZA 4FM9A 1IQ0A 1B4AA 2A68A 1ZQ1C 3S1RC 3K7AK 1WOPA 3M3YK 3MMLB 4C3IC 5C4XK 4KC6A 3S1NK 4A3KC 1O28A 5FLMK 3GDZA 1K83C 2JA6C 1TWGC 2NVXK 3I4MC 1YNJA 1BJTA 1XZPA 5D4DA 3HOWK 1XXAA 3HOZC 4XSZA 3V4GA 2PA8D 2O5IA 1TWAC 2WB1L 1C0AA 4AYBL 2O5JA 4KM9A 3PO3C 3M4OK 4O2DA 2R93K 1GE9A 1F93A 3HXAA 3EQLA 1IS1A 3HKZL 1ZYRA 1Y1VK 1WSRA 1R9TC 2YU9A 3FKIC 5IP9K 2Y0SL 2VUMC 2PHCB 4GTFA 3OEPA 3GTLK 4BY7C 1I6HC 4BLAA 5CJ9A 4LOWA 3GTKA 1PJ6A 3WODA 1TWCA 2E2HA 2R7ZK 3I4NC 1PJ7A 1JQWA 3S1QC 3PO3K 3SZZA 3S17K 3VA7A 1VLOA 4GTBA 3Q3QA 3GTGA 4ZH4A 4KB2A 4QIWD 2R92K 4A3EC 3HOXK 2PMZD 3GTJC 1EH1A 1J98A 3PO2C 3IPJA 3BP3A 3FOFA 1DCPA 1WQFA 1WQGA 2RGRA 4BBSC 4KM8A 2PA8L 3NUHA 2NVTC 2JA7K 2RH6A 1XXBA 2BE5A 1I3QA 3S1QK 3GTQK 5C44C 3GTMK 4A93C 3LAJA 4G0UA 5C3EC 3TFJA 2W7VA 2B63A 3L4JA 4A3DC 4X6AC 3GTJK 1AB4A 2P8TA 3CQZC 4GTLA 4OINA 4KATA 1DCOA 5CHPA 2NVYC 3H0GK 4WILA 3K7AC 4KN7A 1XPPA 2A6HA 3GTPK 1I50K 3JSTA 3M3YC 2PPBA 4C45A 4JK1A 5C4JK 5C4XC 4A3LK 3S1NC 1RU0A 5FLMC 3GEHA 5C44K 4G0VA 5JVOA 4KDDA 1XZQA 5TMFA 4QIWL 5IYBC 4X6AK 2NVQK 2PMZL 1J6WA 4LJZA 1F7VA 2FQTA 3M4OC 4P5AA 2NVYK 3OPFA 1ZBSA 3S2HK 2R93C 2E2IA 5HL8A 5IYDK 1Y1VC 1PJ5A 4YFXA 2E2JK 5IORA 5IP9C 3GEEA 1Y1WA 3GTLC 2YU9K 1IL2A 5M3MK 1EI6A 4C2MK 4G7ZA 4A3FC 3S15K 5E68A 1I6VA 5IYBK 1TWFC
chains in the Genus database with same CATH topology
2R7ZC 3S16K 4GZYA 4BY1K 2R7ZK 3I4NC 2CW0A 4LK1A 4XLNA 3GTKC 3I4NK 3S1QC 1TWHC 3S17C 4YFKA 1TWCC 3PO3K 4A3JC 2E2HC 4LLGA 3S17K 4A3MK 1TWCK 4A3JK 2E2HK 3H3VL 4Q5SA 4A3GC 2A6EA 4A3GK 2R92C 4ZH4A 4QIWD 5IP7C 3HOXC 2JA8C 2R92K 4XSXA 4A3EC 4A3BC 5IP7K 3HOXK 2PMZD 3GTJC 4A3EK 2JA8K 3GTGC 2WB1D 1HQMA 4AYBD 3GTGK 3RZOK 3PO2C 2JA5K 4A3CC 4YFNA 4G7OA 3PO2K 4C3HK 4Y7NC 4A3FK 4A3CK 4BBRC 3S1MC 4Y7NK 4BBRK 4BBSC 3S1MK 3HKZD 1TWFK 4Y52C 2PA8L 4BBSK 2JA7C 4Y52K 2NVTC 4KMUA 2JA7K 5IYCC 4A3IC 4MEXA 1WCMC 2NVTK 3GTKK 2BE5A 2Y0SD 3GTQC 4A3IK 3GTMC 1WCMK 3S1QK 1TWHK 3GTQK 5C44C 3GTMK 1SFOC 4A93C 1SFOK 2NVXC 4A93K 5C3EC 3S14C 1I3QC 3HOWC 4YG2A 5M5WK 5FJ8K 5C3EK 5M5XK 3S14K 4OIPA 4A3BK 5M3FK 4BXXC 4A3DC 4XLPA 2A69A 1SMYA 4X6AC 3GTJK 4BXXK 4A3DK 2B63C 3CQZC 4QJVB 4OINA 2B63K 3H0GC 3GTOC 3CQZK 2WAQL 4LK0A 4Q4ZA 2NVYC 3H0GK 3GTOK 3GTPC 1I50C 3K7AC 4KN7A 1XPPA 2A68A 2A6HA 3H3VD 3S1RC 3GTPK 1I50K 3K7AK 3M3YC 2PPBA 3S1RK 5C4JC 4A3LC 3M3YK 4JK1A 5C4JK 5C4XC 4A3LK 3S1NC 4C3JK 3HOUC 5IYCK 4QJVA 5C4XK 4OIQA 3RZDC 3S1NK 5FLMC 3HOUK 4C3IK 4A3KC 3DXJA 5FLMK 5C44K 4A3KK 1K83C 2JA6C 1TWGC 1K83K 4MQ9A 5M5YK 1YNNA 1TWGK 2NVXK 2JA6K 4MEYA 1YNJA 1I3QK 5D4DA 3HOWK 3I4MK 3HOYC 5TMFA 3HOYK 3HOZC 4XSZA 4QIWL 5IYBC 2NVQC 3HOVC 3HOZK 4X6AK 2PA8D 2NVQK 2PMZL 5TMCA 4BY1C 2O5IA 4LJZA 1TWAC 1BDFA 1IW7A 2WB1L 4AYBL 1TWAK 3S2HC 3M4OC 2O5JA 3PO3C 2NVYK 4OIOA 4G7HA 3S2HK 3M4OK 2R93C 4A3MC 5IYDC 3S2DC 2R93K 3S2DK 3EQLA 1Y1VC 2E2JC 3HKZL 5IYDK 1ZYRA 4YFXA 1Y1VK 1R9TC 2E2JK 2E2IC 3I4MC 5IP9C 1R9TK 2E2IK 3FKIC 3RZDK 5IP9K 2Y0SL 3FKIK 4NOIA 2YU9C 3RZOC 3GTLC 2VUMC 2YU9K 1Y1WC 2WAQD 5M3MK 2JA5C 3WODA 2VUMK 3GTLK 3S15C 4BY7C 1Y1WK 4C2MK 4G7ZA 4A3FC 3S15K 4BY7K 1I6HC 4OIRA 1I6HK 4KN4A 1I6VA 3HOVK 5IYBK 3S16C 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z C;  3S16 K;  4GZY A;  4BY1 K;  2R7Z K;  3I4N C;  2CW0 A;  4LK1 A;  4XLN A;  3GTK C;  3I4N K;  3S1Q C;  1TWH C;  3S17 C;  4YFK A;  1TWC C;  3PO3 K;  4A3J C;  2E2H C;  4LLG A;  3S17 K;  4A3M K;  1TWC K;  4A3J K;  2E2H K;  3H3V L;  4Q5S A;  4A3G C;  2A6E A;  4A3G K;  2R92 C;  4ZH4 A;  4QIW D;  5IP7 C;  3HOX C;  2JA8 C;  2R92 K;  4XSX A;  4A3E C;  4A3B C;  5IP7 K;  3HOX K;  2PMZ D;  3GTJ C;  4A3E K;  2JA8 K;  3GTG C;  2WB1 D;  1HQM A;  4AYB D;  3GTG K;  3RZO K;  3PO2 C;  2JA5 K;  4A3C C;  4YFN A;  4G7O A;  3PO2 K;  4C3H K;  4Y7N C;  4A3F K;  4A3C K;  4BBR C;  3S1M C;  4Y7N K;  4BBR K;  4BBS C;  3S1M K;  3HKZ D;  1TWF K;  4Y52 C;  2PA8 L;  4BBS K;  2JA7 C;  4Y52 K;  2NVT C;  4KMU A;  2JA7 K;  5IYC C;  4A3I C;  4MEX A;  1WCM C;  2NVT K;  3GTK K;  2BE5 A;  2Y0S D;  3GTQ C;  4A3I K;  3GTM C;  1WCM K;  3S1Q K;  1TWH K;  3GTQ K;  5C44 C;  3GTM K;  1SFO C;  4A93 C;  1SFO K;  2NVX C;  4A93 K;  5C3E C;  3S14 C;  1I3Q C;  3HOW C;  4YG2 A;  5M5W K;  5FJ8 K;  5C3E K;  5M5X K;  3S14 K;  4OIP A;  4A3B K;  5M3F K;  4BXX C;  4A3D C;  4XLP A;  2A69 A;  1SMY A;  4X6A C;  3GTJ K;  4BXX K;  4A3D K;  2B63 C;  3CQZ C;  4QJV B;  4OIN A;  2B63 K;  3H0G C;  3GTO C;  3CQZ K;  2WAQ L;  4LK0 A;  4Q4Z A;  2NVY C;  3H0G K;  3GTO K;  3GTP C;  1I50 C;  3K7A C;  4KN7 A;  1XPP A;  2A68 A;  2A6H A;  3H3V D;  3S1R C;  3GTP K;  1I50 K;  3K7A K;  3M3Y C;  2PPB A;  3S1R K;  5C4J C;  4A3L C;  3M3Y K;  4JK1 A;  5C4J K;  5C4X C;  4A3L K;  3S1N C;  4C3J K;  3HOU C;  5IYC K;  4QJV A;  5C4X K;  4OIQ A;  3RZD C;  3S1N K;  5FLM C;  3HOU K;  4C3I K;  4A3K C;  3DXJ A;  5FLM K;  5C44 K;  4A3K K;  1K83 C;  2JA6 C;  1TWG C;  1K83 K;  4MQ9 A;  5M5Y K;  1YNN A;  1TWG K;  2NVX K;  2JA6 K;  4MEY A;  1YNJ A;  1I3Q K;  5D4D A;  3HOW K;  3I4M K;  3HOY C;  5TMF A;  3HOY K;  3HOZ C;  4XSZ A;  4QIW L;  5IYB C;  2NVQ C;  3HOV C;  3HOZ K;  4X6A K;  2PA8 D;  2NVQ K;  2PMZ L;  5TMC A;  4BY1 C;  2O5I A;  4LJZ A;  1TWA C;  1BDF A;  1IW7 A;  2WB1 L;  4AYB L;  1TWA K;  3S2H C;  3M4O C;  2O5J A;  3PO3 C;  2NVY K;  4OIO A;  4G7H A;  3S2H K;  3M4O K;  2R93 C;  4A3M C;  5IYD C;  3S2D C;  2R93 K;  3S2D K;  3EQL A;  1Y1V C;  2E2J C;  3HKZ L;  5IYD K;  1ZYR A;  4YFX A;  1Y1V K;  1R9T C;  2E2J K;  2E2I C;  3I4M C;  5IP9 C;  1R9T K;  2E2I K;  3FKI C;  3RZD K;  5IP9 K;  2Y0S L;  3FKI K;  4NOI A;  2YU9 C;  3RZO C;  3GTL C;  2VUM C;  2YU9 K;  1Y1W C;  2WAQ D;  5M3M K;  2JA5 C;  3WOD A;  2VUM K;  3GTL K;  3S15 C;  4BY7 C;  1Y1W K;  4C2M K;  4G7Z A;  4A3F C;  3S15 K;  4BY7 K;  1I6H C;  4OIR A;  1I6H K;  4KN4 A;  1I6V A;  3HOV K;  5IYB K;  3S16 C;  1TWF C; 
#chains in the Genus database with same CATH topology
 3ORE A;  2R7Z C;  2GAG C;  1WIH A;  4XLN A;  1TWH C;  3S17 C;  4M1X A;  4LLG A;  1TWC K;  4A3J K;  2E2H K;  4J3N A;  1J6V A;  4GTC A;  2R92 C;  3HOX C;  4KMH A;  5IP7 K;  2JA8 K;  3SZY A;  1USO A;  2GSU A;  2V6U A;  1HQM A;  3GTG K;  4LR2 A;  2D6F C;  3AD8 C;  4C3H K;  4A3F K;  4KAW X;  4A3C K;  1YX2 A;  4KMA A;  3TFH A;  1WOO A;  4Y7N K;  1WCM A;  4BBR K;  1TWF K;  2JA7 C;  4KMU A;  3GSI A;  1SFO A;  4P9S A;  5IYC C;  1YCL A;  3GTQ C;  1EK8 A;  4A3I K;  3GTM C;  1TWH K;  1INN A;  3S14 K;  1VRQ C;  5M3F K;  4RMF A;  3GTO A;  1SMY A;  2JH3 A;  3N3Y A;  3T02 A;  2B63 K;  3H0G C;  5JFE A;  4LK0 A;  2CFA B;  2ZUF A;  5IOQ A;  3GTP C;  1I50 C;  4P5B A;  1F7U A;  1L0W A;  5C4J C;  3G4A A;  4A3L C;  4GTA A;  1K83 A;  2JA6 A;  1TWG A;  5IYC K;  4QJV A;  4OIQ A;  3RZD C;  3HOU K;  3DXJ A;  4XCH A;  4BLB A;  3N0C A;  5M5Y K;  1YNN A;  4MEY A;  1EFW A;  4WJ3 M;  3QX3 A;  3GEI A;  1TWA A;  3HOY K;  3HOV C;  2NVQ C;  1O2B A;  5TMC A;  4BY1 C;  1IW7 A;  3S2H C;  4OIO A;  4G7H A;  1R9T A;  5IYD C;  1EQR A;  3FKI A;  1XZP B;  3S2D K;  2E2J C;  1O29 A;  4GFQ A;  2VUM A;  2E2I K;  3RZD K;  3AD7 C;  2YU9 C;  3RZO C;  2WAQ D;  4C2M C;  3S15 C;  1Y1W K;  4OIR A;  3HOV K;  5IOS A;  3S16 K;  4GZY A;  3AQO A;  4BY1 K;  2CW0 A;  4LK1 A;  3GTK C;  1BGW A;  4WJ4 A;  4YFK A;  1TWC C;  4A3J C;  2E2H C;  2XCR B;  2ZFZ A;  3BUE A;  4ILD A;  1VH2 A;  3GTJ A;  2A6E A;  5EGE A;  4A3G K;  3A8I A;  1X31 C;  5IP7 C;  2JA8 C;  3S0X A;  1O26 A;  4A3B C;  2JA5 A;  1USM A;  3GTG C;  3RZO K;  1VGX A;  4C3H C;  3FHZ A;  4A3C C;  4YFN A;  4G7O A;  2P5M A;  4Y7N C;  4BBR C;  1F9N A;  1O27 A;  4DDQ A;  3FOE A;  3S1M K;  4Y52 K;  5IOT A;  2V6T A;  4C3J C;  4A3I C;  3GTK K;  1WCM K;  4PAB A;  4GT9 A;  1SFO K;  1JOE A;  1KQ4 A;  2GSO A;  3LAP A;  3S14 C;  1I3Q C;  4OIP A;  1WQH A;  4A3B K;  1DCH A;  1WOR A;  1ZVU A;  3CQZ A;  2A69 A;  4BXX K;  4BKW A;  2NVY A;  4G0W A;  2B63 C;  4QJV B;  1VJE A;  2WAQ L;  3T00 A;  3GTO K;  5EGH A;  3H3V D;  1WOS A;  3S1R K;  2FQO A;  2NVX A;  4C3J K;  3HOU C;  5TJ3 A;  4C3I K;  2V6S A;  2ZUE A;  4A3K K;  1IE0 A;  3L4K A;  1K83 K;  4MQ9 A;  2JA6 K;  1DD5 A;  1TWG K;  1I3Q K;  3I4M K;  1XXC A;  3HOY C;  2GAH C;  3HOZ K;  2R93 A;  1BDF A;  1TWA K;  3A8K A;  1Y1V A;  4A3M C;  3S2D C;  1B4B A;  1XZQ B;  1O24 A;  1JVI A;  2E2I C;  3GTL A;  1R9T K;  1WSV A;  3FKI K;  4LQY A;  4NOI A;  4AH6 A;  1V5V A;  1Y1W C;  2XCO A;  2JA5 C;  1TWF A;  2VUM K;  3AQP A;  2R7Z A;  3A8J A;  4BY7 K;  4KMD A;  4KB4 A;  1BS2 A;  1I6H K;  4KN4 A;  3S16 C;  5L46 A;  3ADA C;  1TWH A;  2EBB A;  3ERE D;  4KAR A;  3I4N K;  3LPX A;  2R92 A;  4A3M K;  3H3V L;  4Q5S A;  4A3G C;  3GIR A;  1J6X A;  4GTE A;  4XSX A;  4A3E K;  4GTD A;  3BP8 C;  3TFI A;  2WB1 D;  4AYB D;  1O2A A;  3CAG A;  2JA5 K;  3PO2 K;  2JA7 A;  4FZB A;  1HI9 A;  3AH5 A;  4PAA A;  3S1M C;  3TTG A;  3AD9 C;  3GTQ A;  3HKZ D;  4Y52 C;  3GTM A;  1IBA A;  4BBS K;  2KWA A;  2NVT K;  4MEX A;  1WCM C;  2Y0S D;  2Y3P A;  3G4C A;  3T01 A;  2XCQ A;  2GSN A;  2CFA A;  4KAS A;  1SFO C;  1ISE A;  2NVX C;  1UV7 A;  4A93 K;  1O2F B;  1O25 A;  4YG2 A;  5M5W K;  5FJ8 K;  5C3E K;  5M5X K;  3HOW C;  1ZXO A;  4BXX C;  3H0G A;  4XLP A;  1G51 A;  4A3D K;  3GTP A;  3N0B A;  1I50 A;  3GTO C;  3CQZ K;  4Q4Z A;  4FM9 A;  1IQ0 A;  1B4A A;  2A68 A;  1ZQ1 C;  3S1R C;  3K7A K;  1WOP A;  3M3Y K;  3MML B;  4C3I C;  5C4X K;  4KC6 A;  3S1N K;  4A3K C;  1O28 A;  5FLM K;  3GDZ A;  1K83 C;  2JA6 C;  1TWG C;  2NVX K;  3I4M C;  1YNJ A;  1BJT A;  1XZP A;  5D4D A;  3HOW K;  1XXA A;  3HOZ C;  4XSZ A;  3V4G A;  2PA8 D;  2O5I A;  1TWA C;  2WB1 L;  1C0A A;  4AYB L;  2O5J A;  4KM9 A;  3PO3 C;  3M4O K;  4O2D A;  2R93 K;  1GE9 A;  1F93 A;  3HXA A;  3EQL A;  1IS1 A;  3HKZ L;  1ZYR A;  1Y1V K;  1WSR A;  1R9T C;  2YU9 A;  3FKI C;  5IP9 K;  2Y0S L;  2VUM C;  2PHC B;  4GTF A;  3OEP A;  3GTL K;  4BY7 C;  1I6H C;  4BLA A;  5CJ9 A;  4LOW A;  3GTK A;  1PJ6 A;  3WOD A;  1TWC A;  2E2H A;  2R7Z K;  3I4N C;  1PJ7 A;  1JQW A;  3S1Q C;  3PO3 K;  3SZZ A;  3S17 K;  3VA7 A;  1VLO A;  4GTB A;  3Q3Q A;  3GTG A;  4ZH4 A;  4KB2 A;  4QIW D;  2R92 K;  4A3E C;  3HOX K;  2PMZ D;  3GTJ C;  1EH1 A;  1J98 A;  3PO2 C;  3IPJ A;  3BP3 A;  3FOF A;  1DCP A;  1WQF A;  1WQG A;  2RGR A;  4BBS C;  4KM8 A;  2PA8 L;  3NUH A;  2NVT C;  2JA7 K;  2RH6 A;  1XXB A;  2BE5 A;  1I3Q A;  3S1Q K;  3GTQ K;  5C44 C;  3GTM K;  4A93 C;  3LAJ A;  4G0U A;  5C3E C;  3TFJ A;  2W7V A;  2B63 A;  3L4J A;  4A3D C;  4X6A C;  3GTJ K;  1AB4 A;  2P8T A;  3CQZ C;  4GTL A;  4OIN A;  4KAT A;  1DCO A;  5CHP A;  2NVY C;  3H0G K;  4WIL A;  3K7A C;  4KN7 A;  1XPP A;  2A6H A;  3GTP K;  1I50 K;  3JST A;  3M3Y C;  2PPB A;  4C45 A;  4JK1 A;  5C4J K;  5C4X C;  4A3L K;  3S1N C;  1RU0 A;  5FLM C;  3GEH A;  5C44 K;  4G0V A;  5JVO A;  4KDD A;  1XZQ A;  5TMF A;  4QIW L;  5IYB C;  4X6A K;  2NVQ K;  2PMZ L;  1J6W A;  4LJZ A;  1F7V A;  2FQT A;  3M4O C;  4P5A A;  2NVY K;  3OPF A;  1ZBS A;  3S2H K;  2R93 C;  2E2I A;  5HL8 A;  5IYD K;  1Y1V C;  1PJ5 A;  4YFX A;  2E2J K;  5IOR A;  5IP9 C;  3GEE A;  1Y1W A;  3GTL C;  2YU9 K;  1IL2 A;  5M3M K;  1EI6 A;  4C2M K;  4G7Z A;  4A3F C;  3S15 K;  5E68 A;  1I6V A;  5IYB K;  1TWF C; 
#chains in the Genus database with same CATH homology
 2R7Z C;  3S16 K;  4GZY A;  4BY1 K;  2R7Z K;  3I4N C;  2CW0 A;  4LK1 A;  4XLN A;  3GTK C;  3I4N K;  3S1Q C;  1TWH C;  3S17 C;  4YFK A;  1TWC C;  3PO3 K;  4A3J C;  2E2H C;  4LLG A;  3S17 K;  4A3M K;  1TWC K;  4A3J K;  2E2H K;  3H3V L;  4Q5S A;  4A3G C;  2A6E A;  4A3G K;  2R92 C;  4ZH4 A;  4QIW D;  5IP7 C;  3HOX C;  2JA8 C;  2R92 K;  4XSX A;  4A3E C;  4A3B C;  5IP7 K;  3HOX K;  2PMZ D;  3GTJ C;  4A3E K;  2JA8 K;  3GTG C;  2WB1 D;  1HQM A;  4AYB D;  3GTG K;  3RZO K;  3PO2 C;  2JA5 K;  4A3C C;  4YFN A;  4G7O A;  3PO2 K;  4C3H K;  4Y7N C;  4A3F K;  4A3C K;  4BBR C;  3S1M C;  4Y7N K;  4BBR K;  4BBS C;  3S1M K;  3HKZ D;  1TWF K;  4Y52 C;  2PA8 L;  4BBS K;  2JA7 C;  4Y52 K;  2NVT C;  4KMU A;  2JA7 K;  5IYC C;  4A3I C;  4MEX A;  1WCM C;  2NVT K;  3GTK K;  2BE5 A;  2Y0S D;  3GTQ C;  4A3I K;  3GTM C;  1WCM K;  3S1Q K;  1TWH K;  3GTQ K;  5C44 C;  3GTM K;  1SFO C;  4A93 C;  1SFO K;  2NVX C;  4A93 K;  5C3E C;  3S14 C;  1I3Q C;  3HOW C;  4YG2 A;  5M5W K;  5FJ8 K;  5C3E K;  5M5X K;  3S14 K;  4OIP A;  4A3B K;  5M3F K;  4BXX C;  4A3D C;  4XLP A;  2A69 A;  1SMY A;  4X6A C;  3GTJ K;  4BXX K;  4A3D K;  2B63 C;  3CQZ C;  4QJV B;  4OIN A;  2B63 K;  3H0G C;  3GTO C;  3CQZ K;  2WAQ L;  4LK0 A;  4Q4Z A;  2NVY C;  3H0G K;  3GTO K;  3GTP C;  1I50 C;  3K7A C;  4KN7 A;  1XPP A;  2A68 A;  2A6H A;  3H3V D;  3S1R C;  3GTP K;  1I50 K;  3K7A K;  3M3Y C;  2PPB A;  3S1R K;  5C4J C;  4A3L C;  3M3Y K;  4JK1 A;  5C4J K;  5C4X C;  4A3L K;  3S1N C;  4C3J K;  3HOU C;  5IYC K;  4QJV A;  5C4X K;  4OIQ A;  3RZD C;  3S1N K;  5FLM C;  3HOU K;  4C3I K;  4A3K C;  3DXJ A;  5FLM K;  5C44 K;  4A3K K;  1K83 C;  2JA6 C;  1TWG C;  1K83 K;  4MQ9 A;  5M5Y K;  1YNN A;  1TWG K;  2NVX K;  2JA6 K;  4MEY A;  1YNJ A;  1I3Q K;  5D4D A;  3HOW K;  3I4M K;  3HOY C;  5TMF A;  3HOY K;  3HOZ C;  4XSZ A;  4QIW L;  5IYB C;  2NVQ C;  3HOV C;  3HOZ K;  4X6A K;  2PA8 D;  2NVQ K;  2PMZ L;  5TMC A;  4BY1 C;  2O5I A;  4LJZ A;  1TWA C;  1BDF A;  1IW7 A;  2WB1 L;  4AYB L;  1TWA K;  3S2H C;  3M4O C;  2O5J A;  3PO3 C;  2NVY K;  4OIO A;  4G7H A;  3S2H K;  3M4O K;  2R93 C;  4A3M C;  5IYD C;  3S2D C;  2R93 K;  3S2D K;  3EQL A;  1Y1V C;  2E2J C;  3HKZ L;  5IYD K;  1ZYR A;  4YFX A;  1Y1V K;  1R9T C;  2E2J K;  2E2I C;  3I4M C;  5IP9 C;  1R9T K;  2E2I K;  3FKI C;  3RZD K;  5IP9 K;  2Y0S L;  3FKI K;  4NOI A;  2YU9 C;  3RZO C;  3GTL C;  2VUM C;  2YU9 K;  1Y1W C;  2WAQ D;  5M3M K;  2JA5 C;  3WOD A;  2VUM K;  3GTL K;  3S15 C;  4BY7 C;  1Y1W K;  4C2M K;  4G7Z A;  4A3F C;  3S15 K;  4BY7 K;  1I6H C;  4OIR A;  1I6H K;  4KN4 A;  1I6V A;  3HOV K;  5IYB K;  3S16 C;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...