3HOYK

Complete rna polymerase ii elongation complex vi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoyK00
4AYBD 1K83K 3CQZK 2A69A 3HKZD 3M3YC 3GTJK 2NVYC 4A3KK 1R9TK 2E2JC 1I6VA 2A6HA 1Y1VC 3S1NK 4A93C 4Y52C 4C2MK 4X6AK 2PPBA 3FKIC 1TWFK 3DXJA 4A3BC 2JA6C 5M5WK 2PA8D 3S2DC 1TWHC 3HOYK 1TWFC 4A3IC 2O5IA 1I3QK 2E2HC 1K83C 3CQZC 1Y1VK 3S2HK 4MEXA 4A93K 3EQLA 5M5YK 3GTJC 5IP9K 4A3KC 4YFKA 4BY1C 4QIWL 4A3EK 4Y52K 4OIQA 3GTPC 3M4OK 5IYBC 4JK1A 3S1QK 2JA5C 3HOVK 1HQMA 3GTLC 1I6HK 4A3MK 5C4JC 2YU9C 3S17C 5TMCA 4A3DC 3S16K 4QJVA 2R7ZK 1I6HC 1TWAK 1YNNA 3GTMK 4A3FK 4GZYA 3GTOK 2JA8K 2JA8C 2NVQC 2NVQK 2A68A 1TWGK 3S1MK 3GTKC 4A3LC 4XLPA 3I4NC 3I4NK 4A3DK 3H0GC 1TWGC 5M3MK 3RZOK 3S1MC 4AYBL 4Q5SA 3GTOC 4A3LK 4YFNA 1WCMC 3S14K 5C4XC 3K7AK 3RZDC 4KMUA 3S16C 3GTQC 1SFOK 4G7HA 1SMYA 2Y0SL 2WB1L 3WODA 1I50K 2PMZL 3HOWC 3PO3C 2PMZD 3S17K 5IYBK 2R92K 2R93C 4BY7K 3GTLK 2PA8L 3GTPK 3M4OC 4A3EC 4Y7NC 3I4MK 5C4XK 4OIRA 3S1QC 5TMFA 2NVXC 1TWCK 5FLMK 1I3QC 4LLGA 3S1NC 1IW7A 4A3IK 1Y1WC 2NVTK 4XSZA 2E2HK 2JA6K 4A3JK 3S2HC 4XSXA 3S15K 1TWHK 4A3JC 3HOYC 4G7OA 4X6AC 4BBRC 4BBRK 3HOXC 3HOXK 2E2JK 3PO2C 3PO2K 3S2DK 3S15C 1XPPA 2NVYK 3FKIK 4YG2A 1R9TC 3H3VL 4MEYA 3H3VD 4A3BK 3M3YK 2NVTC 1Y1WK 2NVXK 4A3GK 4Y7NK 3I4MC 2JA7K 2WB1D 4BBSK 5IYCC 2CW0A 5FLMC 1TWCC 4BY7C 4OINA 3HOWK 2BE5A 4KN7A 1I50C 4BXXK 2VUMK 2R92C 4A3CK 3GTQK 2R93K 5IP7K 3GTGC 3HOZC 5IYDK 3PO3K 2WAQL 1WCMK 3S14C 5C44C 3RZOC 3H0GK 1SFOC 4QIWD 1YNJA 2B63C 3S1RK 3K7AC 3RZDK 4C3HK 4KN4A 2E2IC 4ZH4A 5C3EK 5C3EC 3HOUC 4LK1A 3HOUK 2E2IK 4LJZA 4QJVB 1ZYRA 4MQ9A 5FJ8K 3GTKK 5C44K 4A3FC 1TWAC 4OIOA 3GTMC 2R7ZC 2WAQD 3S1RC 4C3JK 5IP7C 3HKZL 4NOIA 2YU9K 2B63K 4A3MC 3GTGK 4A3CC 2O5JA 4Q4ZA 1BDFA 2Y0SD 4BXXC 5D4DA 4XLNA 2JA5K 3HOVC 5IYDC 3HOZK 2A6EA 5M5XK 5C4JK 4LK0A 5IYCK 4C3IK 2VUMC 4OIPA 2JA7C 4BBSC 4YFXA 5IP9C 4BY1K 4A3GC 4G7ZA 5M3FK
chains in the Genus database with same CATH superfamily
4AYBD 3CQZK 1INNA 2A69A 3N3YA 3M3YC 3GTJK 1R9TK 1I6VA 2A6HA 1Y1VC 4Y52C 1XZQA 3GTPA 4RMFA 2O5IA 3GTJA 2E2HC 3CQZC 1X31C 3CQZA 3GTJC 4QIWL 4A3EK 2RH6A 3S1QK 3HOVK 1JOEA 5L46A 4A3MK 1DCPA 2CFAB 3N0CA 5TMCA 5JFEA 4QJVA 1I6HC 3GSIA 3GTMK 1YNNA 3GTOK 2JA8K 2NVQC 3S1MK 1EK8A 4XLPA 3I4NK 3OREA 4A3DK 4Q5SA 3LPXA 2W7VA 1Y1VA 4J3NA 1SMYA 2Y0SL 2WB1L 4KATA 1KQ4A 2R93A 2PMZL 2R93C 3M4OC 3FOEA 1JQWA 4Y7NC 5C4XK 1DCOA 5TMFA 3BP8C 5FLMK 4LR2A 1I3QC 3L4JA 4PAAA 1PJ7A 1WOPA 2JA6K 1PJ6A 3S15K 4G7OA 3HOYC 1ISEA 3S2DK 3S15C 2NVYK 4YG2A 4MEYA 2XCRB 2NVTC 1Y1WK 2NVXK 1USMA 1XZQB 3ERED 3VA7A 4P9SA 4BBSK 5IYCC 1WQGA 1O28A 2CW0A 1DD5A 5FLMC 3FHZA 2BE5A 4KN7A 1UV7A 1V5VA 3SZZA 1I50A 2R93K 3GTGC 2V6TA 5C44C 1O26A 1SFOC 3AH5A 3K7AC 2E2IC 2GSOA 3GTOA 2D6FC 1VH2A 1I6HK 2WAQD 4C3JK 5IP7C 4NOIA 2ZFZA 4A3MC 1Y1WA 3HOVC 5C4JK 4LK0A 4C3IK 2ZUFA 2XCOA 4G7ZA 4A3GC 1USOA 3HKZD 4ILDA 3NUHA 2E2JC 4X6AK 2PPBA 1WOOA 4FM9A 3FKIC 1TWFK 3TFIA 5CHPA 4A3BC 2KWAA 3V4GA 5TJ3A 3AQPA 1WQFA 1K83C 5EGHA 1Y1VK 4MEXA 3QX3A 3EQLA 5M5YK 4A3KC 4BLBA 4JK1A 3GDZA 4KMDA 1G51A 2YU9C 2R7ZA 3L4KA 1TWCA 5E68A 3S16K 1ZXOA 1TWAK 2A68A 4LOWA 3RZOK 3S1MC 4AYBL 1IL2A 3S14K 3RZDC 4KMUA 3S16C 3GTQC 1I50K 1WSRA 3PO3C 5IYBK 4BY7K 3GTPK 2JH3A 1HI9A 1J6VA 3GTMA 3S1QC 1J98A 4GTEA 1VJEA 1IW7A 1R9TA 4A3IK 1XZPB 4KB2A 2E2HK 4A3JK 1WORA 4BBRC 2E2JK 4FZBA 3FKIK 4A3BK 3H3VD 3A8IA 1GE9A 2PHCB 4A3GK 2B63A 3I4MC 2JA7K 1F7VA 4C3IC 2R92A 4A3CK 5IP7K 5IYDK 1WCMK 1B4AA 1EH1A 4C3JC 4O2DA 4PABA 5C3EK 5C3EC 1TWGA 4QJVB 1ZYRA 4KARA 4MQ9A 3HXAA 3GTKK 5C44K 4A3FC 3GTGK 4A3CC 2O5JA 4Q4ZA 2Y0SD 5D4DA 3GIRA 3FKIA 3HOZK 5M5XK 5IORA 5IYCK 4BBSC 2VUMC 2JA7C 4YFXA 5IP9C 4BY1K 1ZQ1C 5IOSA 3T02A 2NVYC 3GEEA 3TFJA 4C2MK 3OPFA 1IBAA 4LQYA 5M5WK 1TWFA 2PA8D 3S2DC 4GTBA 2GAGC 3HOYK 4A3IC 1VRQC 2EBBA 1F7UA 2GAHC 1I3QK 3S2HK 4A93K 5C4XC 5IP9K 4BY1C 4YFKA 3GTPC 5IYBC 1EI6A 4KC6A 4KM9A 1YX2A 2JA5C 3LAPA 2JA5A 1VGXA 1BS2A 1L0WA 2GSUA 3GTGA 1BJTA 1O2FB 4KASA 5CJ9A 2R7ZK 1BGWA 1EFWA 2JA8C 2NVQK 2P5MA 1O24A 3GTKC 3I4NC 3H0GC 3GTOC 4YFNA 1WCMC 4KB4A 4GTDA 4G7HA 3A8KA 1WQHA 3T00A 2R92K 4M1XA 3GTLK 4A3EC 3I4MK 1TWAA 4OIRA 2JA7A 1TWCK 1IS1A 4XSZA 1WIHA 4XSXA 4X6AC 3AQOA 4Y52K 3HOXK 3HOXC 3PO2C 3PO2K 1RU0A 1XPPA 1R9TC 3H3VL 3M3YK 5JVOA 3FOFA 3S0XA 2WB1D 4BY7C 1TWCC 3HOWK 1ZVUA 4BLAA 1F9NA 2R92C 4GFQA 3AD7C 3AD8C 1SFOA 3S14C 3RZOC 3H0GK 1O25A 2B63C 4P5BA 3RZDK 2GSNA 4ZH4A 4LK1A 2E2IK 4G0UA 1O27A 3T01A 1ZBSA 3BP3A 4GTFA 1XZPA 4XCHA 4KDDA 1TWAC 4OIOA 4DDQA 2YU9A 2R7ZC 3S1RC 3HKZL 2YU9K 2V6UA 4BXXC 2CFAA 2JA5K 4GTCA 2A6EA 4C45A 4WJ3M 3TTGA 3HOWC 4AH6A 5M3FK 4OINA 3H0GA 1K83K 1YCLA 3CAGA 4A3KK 1I3QA 3S1NK 3LAJA 4A93C 5HL8A 2FQOA 4KMAA 3DXJA 2JA6C 3GTLA 1TWHC 1TWFC 1DCHA 1O29A 4KMHA 1K83A 3N0BA 2NVYA 4OIQA 2RGRA 3M4OK 3GEIA 1J6XA 1HQMA 3GTLC 2JA6A 5C4JC 3S17C 3JSTA 4A3DC 3G4CA 4GZYA 4A3FK 4A3LC 2E2IA 1TWGK 3AD9C 4BKWA 5M3MK 1TWGC 4A3LK 1WSVA 3K7AK 4WJ4A 1SFOK 1WCMA 1XXCA 1XXAA 3OEPA 3WODA 3S17K 2PMZD 1O2AA 5EGEA 3A8JA 3GEHA 2PA8L 1C0AA 1IQ0A 2Y3PA 2P8TA 1O2BA 2NVXC 4LLGA 2NVXA 1B4BA 4GTAA 4WILA 5IOQA 1Y1WC 2NVTK 3S2HC 4GT9A 5IOTA 4KAWX 1TWHK 3SZYA 4A3JC 4BBRK 4GTLA 3S1NC 1AB4A 3Q3QA 1F93A 4C2MC 3TFHA 3MMLB 4Y7NK 1JVIA 1VLOA 1I50C 4KM8A 4BXXK 2VUMK 3G4AA 2FQTA 3GTQK 3BUEA 3HOZC 3PO3K 2WAQL 4G0WA 1XXBA 3ADAC 1EQRA 4QIWD 1YNJA 3S1RK 1WOSA 3GTQA 4C3HK 4KN4A 2V6SA 3HOUK 3HOUC 2VUMA 1PJ5A 4C3HC 4LJZA 4G0VA 2ZUEA 5FJ8K 2XCQA 3IPJA 3GTMC 2B63K 1BDFA 1IE0A 4XLNA 3GTKA 5IYDC 4P5AA 1J6WA 1TWHA 4OIPA 2E2HA
chains in the Genus database with same CATH topology
4AYBD 1K83K 3CQZK 2A69A 3HKZD 3M3YC 3GTJK 2NVYC 4A3KK 1R9TK 2E2JC 1I6VA 2A6HA 1Y1VC 3S1NK 4A93C 4Y52C 4C2MK 4X6AK 2PPBA 3FKIC 1TWFK 3DXJA 4A3BC 2JA6C 5M5WK 2PA8D 3S2DC 1TWHC 3HOYK 1TWFC 4A3IC 2O5IA 1I3QK 2E2HC 1K83C 3CQZC 1Y1VK 3S2HK 4MEXA 4A93K 3EQLA 5M5YK 3GTJC 5IP9K 4A3KC 4YFKA 4BY1C 4QIWL 4A3EK 4Y52K 4OIQA 3GTPC 3M4OK 5IYBC 4JK1A 3S1QK 2JA5C 3HOVK 1HQMA 3GTLC 1I6HK 4A3MK 5C4JC 2YU9C 3S17C 5TMCA 4A3DC 3S16K 4QJVA 2R7ZK 1I6HC 1TWAK 1YNNA 3GTMK 4A3FK 4GZYA 3GTOK 2JA8K 2JA8C 2NVQC 2NVQK 2A68A 1TWGK 3S1MK 3GTKC 4A3LC 4XLPA 3I4NC 3I4NK 4A3DK 3H0GC 1TWGC 5M3MK 3RZOK 3S1MC 4AYBL 4Q5SA 3GTOC 4A3LK 4YFNA 1WCMC 3S14K 5C4XC 3K7AK 3RZDC 4KMUA 3S16C 3GTQC 1SFOK 4G7HA 1SMYA 2Y0SL 2WB1L 3WODA 1I50K 2PMZL 3HOWC 3PO3C 2PMZD 3S17K 5IYBK 2R92K 2R93C 4BY7K 3GTLK 2PA8L 3GTPK 3M4OC 4A3EC 4Y7NC 3I4MK 5C4XK 4OIRA 3S1QC 5TMFA 2NVXC 1TWCK 5FLMK 1I3QC 4LLGA 3S1NC 1IW7A 4A3IK 1Y1WC 2NVTK 4XSZA 2E2HK 2JA6K 4A3JK 3S2HC 4XSXA 3S15K 1TWHK 4A3JC 3HOYC 4G7OA 4X6AC 4BBRC 4BBRK 3HOXC 3HOXK 2E2JK 3PO2C 3PO2K 3S2DK 3S15C 1XPPA 2NVYK 3FKIK 4YG2A 1R9TC 3H3VL 4MEYA 3H3VD 4A3BK 3M3YK 2NVTC 1Y1WK 2NVXK 4A3GK 4Y7NK 3I4MC 2JA7K 2WB1D 4BBSK 5IYCC 2CW0A 5FLMC 1TWCC 4BY7C 4OINA 3HOWK 2BE5A 4KN7A 1I50C 4BXXK 2VUMK 2R92C 4A3CK 3GTQK 2R93K 5IP7K 3GTGC 3HOZC 5IYDK 3PO3K 2WAQL 1WCMK 3S14C 5C44C 3RZOC 3H0GK 1SFOC 4QIWD 1YNJA 2B63C 3S1RK 3K7AC 3RZDK 4C3HK 4KN4A 2E2IC 4ZH4A 5C3EK 5C3EC 3HOUC 4LK1A 3HOUK 2E2IK 4LJZA 4QJVB 1ZYRA 4MQ9A 5FJ8K 3GTKK 5C44K 4A3FC 1TWAC 4OIOA 3GTMC 2R7ZC 2WAQD 3S1RC 4C3JK 5IP7C 3HKZL 4NOIA 2YU9K 2B63K 4A3MC 3GTGK 4A3CC 2O5JA 4Q4ZA 1BDFA 2Y0SD 4BXXC 5D4DA 4XLNA 2JA5K 3HOVC 5IYDC 3HOZK 2A6EA 5M5XK 5C4JK 4LK0A 5IYCK 4C3IK 2VUMC 4OIPA 2JA7C 4BBSC 4YFXA 5IP9C 4BY1K 4A3GC 4G7ZA 5M3FK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB D;  1K83 K;  3CQZ K;  2A69 A;  3HKZ D;  3M3Y C;  3GTJ K;  2NVY C;  4A3K K;  1R9T K;  2E2J C;  1I6V A;  2A6H A;  1Y1V C;  3S1N K;  4A93 C;  4Y52 C;  4C2M K;  4X6A K;  2PPB A;  3FKI C;  1TWF K;  3DXJ A;  4A3B C;  2JA6 C;  5M5W K;  2PA8 D;  3S2D C;  1TWH C;  3HOY K;  1TWF C;  4A3I C;  2O5I A;  1I3Q K;  2E2H C;  1K83 C;  3CQZ C;  1Y1V K;  3S2H K;  4MEX A;  4A93 K;  3EQL A;  5M5Y K;  3GTJ C;  5IP9 K;  4A3K C;  4YFK A;  4BY1 C;  4QIW L;  4A3E K;  4Y52 K;  4OIQ A;  3GTP C;  3M4O K;  5IYB C;  4JK1 A;  3S1Q K;  2JA5 C;  3HOV K;  1HQM A;  3GTL C;  1I6H K;  4A3M K;  5C4J C;  2YU9 C;  3S17 C;  5TMC A;  4A3D C;  3S16 K;  4QJV A;  2R7Z K;  1I6H C;  1TWA K;  1YNN A;  3GTM K;  4A3F K;  4GZY A;  3GTO K;  2JA8 K;  2JA8 C;  2NVQ C;  2NVQ K;  2A68 A;  1TWG K;  3S1M K;  3GTK C;  4A3L C;  4XLP A;  3I4N C;  3I4N K;  4A3D K;  3H0G C;  1TWG C;  5M3M K;  3RZO K;  3S1M C;  4AYB L;  4Q5S A;  3GTO C;  4A3L K;  4YFN A;  1WCM C;  3S14 K;  5C4X C;  3K7A K;  3RZD C;  4KMU A;  3S16 C;  3GTQ C;  1SFO K;  4G7H A;  1SMY A;  2Y0S L;  2WB1 L;  3WOD A;  1I50 K;  2PMZ L;  3HOW C;  3PO3 C;  2PMZ D;  3S17 K;  5IYB K;  2R92 K;  2R93 C;  4BY7 K;  3GTL K;  2PA8 L;  3GTP K;  3M4O C;  4A3E C;  4Y7N C;  3I4M K;  5C4X K;  4OIR A;  3S1Q C;  5TMF A;  2NVX C;  1TWC K;  5FLM K;  1I3Q C;  4LLG A;  3S1N C;  1IW7 A;  4A3I K;  1Y1W C;  2NVT K;  4XSZ A;  2E2H K;  2JA6 K;  4A3J K;  3S2H C;  4XSX A;  3S15 K;  1TWH K;  4A3J C;  3HOY C;  4G7O A;  4X6A C;  4BBR C;  4BBR K;  3HOX C;  3HOX K;  2E2J K;  3PO2 C;  3PO2 K;  3S2D K;  3S15 C;  1XPP A;  2NVY K;  3FKI K;  4YG2 A;  1R9T C;  3H3V L;  4MEY A;  3H3V D;  4A3B K;  3M3Y K;  2NVT C;  1Y1W K;  2NVX K;  4A3G K;  4Y7N K;  3I4M C;  2JA7 K;  2WB1 D;  4BBS K;  5IYC C;  2CW0 A;  5FLM C;  1TWC C;  4BY7 C;  4OIN A;  3HOW K;  2BE5 A;  4KN7 A;  1I50 C;  4BXX K;  2VUM K;  2R92 C;  4A3C K;  3GTQ K;  2R93 K;  5IP7 K;  3GTG C;  3HOZ C;  5IYD K;  3PO3 K;  2WAQ L;  1WCM K;  3S14 C;  5C44 C;  3RZO C;  3H0G K;  1SFO C;  4QIW D;  1YNJ A;  2B63 C;  3S1R K;  3K7A C;  3RZD K;  4C3H K;  4KN4 A;  2E2I C;  4ZH4 A;  5C3E K;  5C3E C;  3HOU C;  4LK1 A;  3HOU K;  2E2I K;  4LJZ A;  4QJV B;  1ZYR A;  4MQ9 A;  5FJ8 K;  3GTK K;  5C44 K;  4A3F C;  1TWA C;  4OIO A;  3GTM C;  2R7Z C;  2WAQ D;  3S1R C;  4C3J K;  5IP7 C;  3HKZ L;  4NOI A;  2YU9 K;  2B63 K;  4A3M C;  3GTG K;  4A3C C;  2O5J A;  4Q4Z A;  1BDF A;  2Y0S D;  4BXX C;  5D4D A;  4XLN A;  2JA5 K;  3HOV C;  5IYD C;  3HOZ K;  2A6E A;  5M5X K;  5C4J K;  4LK0 A;  5IYC K;  4C3I K;  2VUM C;  4OIP A;  2JA7 C;  4BBS C;  4YFX A;  5IP9 C;  4BY1 K;  4A3G C;  4G7Z A;  5M3F K; 
#chains in the Genus database with same CATH topology
 4AYB D;  3CQZ K;  1INN A;  2A69 A;  3N3Y A;  3M3Y C;  3GTJ K;  1R9T K;  1I6V A;  2A6H A;  1Y1V C;  4Y52 C;  1XZQ A;  3GTP A;  4RMF A;  2O5I A;  3GTJ A;  2E2H C;  3CQZ C;  1X31 C;  3CQZ A;  3GTJ C;  4QIW L;  4A3E K;  2RH6 A;  3S1Q K;  3HOV K;  1JOE A;  5L46 A;  4A3M K;  1DCP A;  2CFA B;  3N0C A;  5TMC A;  5JFE A;  4QJV A;  1I6H C;  3GSI A;  3GTM K;  1YNN A;  3GTO K;  2JA8 K;  2NVQ C;  3S1M K;  1EK8 A;  4XLP A;  3I4N K;  3ORE A;  4A3D K;  4Q5S A;  3LPX A;  2W7V A;  1Y1V A;  4J3N A;  1SMY A;  2Y0S L;  2WB1 L;  4KAT A;  1KQ4 A;  2R93 A;  2PMZ L;  2R93 C;  3M4O C;  3FOE A;  1JQW A;  4Y7N C;  5C4X K;  1DCO A;  5TMF A;  3BP8 C;  5FLM K;  4LR2 A;  1I3Q C;  3L4J A;  4PAA A;  1PJ7 A;  1WOP A;  2JA6 K;  1PJ6 A;  3S15 K;  4G7O A;  3HOY C;  1ISE A;  3S2D K;  3S15 C;  2NVY K;  4YG2 A;  4MEY A;  2XCR B;  2NVT C;  1Y1W K;  2NVX K;  1USM A;  1XZQ B;  3ERE D;  3VA7 A;  4P9S A;  4BBS K;  5IYC C;  1WQG A;  1O28 A;  2CW0 A;  1DD5 A;  5FLM C;  3FHZ A;  2BE5 A;  4KN7 A;  1UV7 A;  1V5V A;  3SZZ A;  1I50 A;  2R93 K;  3GTG C;  2V6T A;  5C44 C;  1O26 A;  1SFO C;  3AH5 A;  3K7A C;  2E2I C;  2GSO A;  3GTO A;  2D6F C;  1VH2 A;  1I6H K;  2WAQ D;  4C3J K;  5IP7 C;  4NOI A;  2ZFZ A;  4A3M C;  1Y1W A;  3HOV C;  5C4J K;  4LK0 A;  4C3I K;  2ZUF A;  2XCO A;  4G7Z A;  4A3G C;  1USO A;  3HKZ D;  4ILD A;  3NUH A;  2E2J C;  4X6A K;  2PPB A;  1WOO A;  4FM9 A;  3FKI C;  1TWF K;  3TFI A;  5CHP A;  4A3B C;  2KWA A;  3V4G A;  5TJ3 A;  3AQP A;  1WQF A;  1K83 C;  5EGH A;  1Y1V K;  4MEX A;  3QX3 A;  3EQL A;  5M5Y K;  4A3K C;  4BLB A;  4JK1 A;  3GDZ A;  4KMD A;  1G51 A;  2YU9 C;  2R7Z A;  3L4K A;  1TWC A;  5E68 A;  3S16 K;  1ZXO A;  1TWA K;  2A68 A;  4LOW A;  3RZO K;  3S1M C;  4AYB L;  1IL2 A;  3S14 K;  3RZD C;  4KMU A;  3S16 C;  3GTQ C;  1I50 K;  1WSR A;  3PO3 C;  5IYB K;  4BY7 K;  3GTP K;  2JH3 A;  1HI9 A;  1J6V A;  3GTM A;  3S1Q C;  1J98 A;  4GTE A;  1VJE A;  1IW7 A;  1R9T A;  4A3I K;  1XZP B;  4KB2 A;  2E2H K;  4A3J K;  1WOR A;  4BBR C;  2E2J K;  4FZB A;  3FKI K;  4A3B K;  3H3V D;  3A8I A;  1GE9 A;  2PHC B;  4A3G K;  2B63 A;  3I4M C;  2JA7 K;  1F7V A;  4C3I C;  2R92 A;  4A3C K;  5IP7 K;  5IYD K;  1WCM K;  1B4A A;  1EH1 A;  4C3J C;  4O2D A;  4PAB A;  5C3E K;  5C3E C;  1TWG A;  4QJV B;  1ZYR A;  4KAR A;  4MQ9 A;  3HXA A;  3GTK K;  5C44 K;  4A3F C;  3GTG K;  4A3C C;  2O5J A;  4Q4Z A;  2Y0S D;  5D4D A;  3GIR A;  3FKI A;  3HOZ K;  5M5X K;  5IOR A;  5IYC K;  4BBS C;  2VUM C;  2JA7 C;  4YFX A;  5IP9 C;  4BY1 K;  1ZQ1 C;  5IOS A;  3T02 A;  2NVY C;  3GEE A;  3TFJ A;  4C2M K;  3OPF A;  1IBA A;  4LQY A;  5M5W K;  1TWF A;  2PA8 D;  3S2D C;  4GTB A;  2GAG C;  3HOY K;  4A3I C;  1VRQ C;  2EBB A;  1F7U A;  2GAH C;  1I3Q K;  3S2H K;  4A93 K;  5C4X C;  5IP9 K;  4BY1 C;  4YFK A;  3GTP C;  5IYB C;  1EI6 A;  4KC6 A;  4KM9 A;  1YX2 A;  2JA5 C;  3LAP A;  2JA5 A;  1VGX A;  1BS2 A;  1L0W A;  2GSU A;  3GTG A;  1BJT A;  1O2F B;  4KAS A;  5CJ9 A;  2R7Z K;  1BGW A;  1EFW A;  2JA8 C;  2NVQ K;  2P5M A;  1O24 A;  3GTK C;  3I4N C;  3H0G C;  3GTO C;  4YFN A;  1WCM C;  4KB4 A;  4GTD A;  4G7H A;  3A8K A;  1WQH A;  3T00 A;  2R92 K;  4M1X A;  3GTL K;  4A3E C;  3I4M K;  1TWA A;  4OIR A;  2JA7 A;  1TWC K;  1IS1 A;  4XSZ A;  1WIH A;  4XSX A;  4X6A C;  3AQO A;  4Y52 K;  3HOX K;  3HOX C;  3PO2 C;  3PO2 K;  1RU0 A;  1XPP A;  1R9T C;  3H3V L;  3M3Y K;  5JVO A;  3FOF A;  3S0X A;  2WB1 D;  4BY7 C;  1TWC C;  3HOW K;  1ZVU A;  4BLA A;  1F9N A;  2R92 C;  4GFQ A;  3AD7 C;  3AD8 C;  1SFO A;  3S14 C;  3RZO C;  3H0G K;  1O25 A;  2B63 C;  4P5B A;  3RZD K;  2GSN A;  4ZH4 A;  4LK1 A;  2E2I K;  4G0U A;  1O27 A;  3T01 A;  1ZBS A;  3BP3 A;  4GTF A;  1XZP A;  4XCH A;  4KDD A;  1TWA C;  4OIO A;  4DDQ A;  2YU9 A;  2R7Z C;  3S1R C;  3HKZ L;  2YU9 K;  2V6U A;  4BXX C;  2CFA A;  2JA5 K;  4GTC A;  2A6E A;  4C45 A;  4WJ3 M;  3TTG A;  3HOW C;  4AH6 A;  5M3F K;  4OIN A;  3H0G A;  1K83 K;  1YCL A;  3CAG A;  4A3K K;  1I3Q A;  3S1N K;  3LAJ A;  4A93 C;  5HL8 A;  2FQO A;  4KMA A;  3DXJ A;  2JA6 C;  3GTL A;  1TWH C;  1TWF C;  1DCH A;  1O29 A;  4KMH A;  1K83 A;  3N0B A;  2NVY A;  4OIQ A;  2RGR A;  3M4O K;  3GEI A;  1J6X A;  1HQM A;  3GTL C;  2JA6 A;  5C4J C;  3S17 C;  3JST A;  4A3D C;  3G4C A;  4GZY A;  4A3F K;  4A3L C;  2E2I A;  1TWG K;  3AD9 C;  4BKW A;  5M3M K;  1TWG C;  4A3L K;  1WSV A;  3K7A K;  4WJ4 A;  1SFO K;  1WCM A;  1XXC A;  1XXA A;  3OEP A;  3WOD A;  3S17 K;  2PMZ D;  1O2A A;  5EGE A;  3A8J A;  3GEH A;  2PA8 L;  1C0A A;  1IQ0 A;  2Y3P A;  2P8T A;  1O2B A;  2NVX C;  4LLG A;  2NVX A;  1B4B A;  4GTA A;  4WIL A;  5IOQ A;  1Y1W C;  2NVT K;  3S2H C;  4GT9 A;  5IOT A;  4KAW X;  1TWH K;  3SZY A;  4A3J C;  4BBR K;  4GTL A;  3S1N C;  1AB4 A;  3Q3Q A;  1F93 A;  4C2M C;  3TFH A;  3MML B;  4Y7N K;  1JVI A;  1VLO A;  1I50 C;  4KM8 A;  4BXX K;  2VUM K;  3G4A A;  2FQT A;  3GTQ K;  3BUE A;  3HOZ C;  3PO3 K;  2WAQ L;  4G0W A;  1XXB A;  3ADA C;  1EQR A;  4QIW D;  1YNJ A;  3S1R K;  1WOS A;  3GTQ A;  4C3H K;  4KN4 A;  2V6S A;  3HOU K;  3HOU C;  2VUM A;  1PJ5 A;  4C3H C;  4LJZ A;  4G0V A;  2ZUE A;  5FJ8 K;  2XCQ A;  3IPJ A;  3GTM C;  2B63 K;  1BDF A;  1IE0 A;  4XLN A;  3GTK A;  5IYD C;  4P5A A;  1J6W A;  1TWH A;  4OIP A;  2E2H A; 
#chains in the Genus database with same CATH homology
 4AYB D;  1K83 K;  3CQZ K;  2A69 A;  3HKZ D;  3M3Y C;  3GTJ K;  2NVY C;  4A3K K;  1R9T K;  2E2J C;  1I6V A;  2A6H A;  1Y1V C;  3S1N K;  4A93 C;  4Y52 C;  4C2M K;  4X6A K;  2PPB A;  3FKI C;  1TWF K;  3DXJ A;  4A3B C;  2JA6 C;  5M5W K;  2PA8 D;  3S2D C;  1TWH C;  3HOY K;  1TWF C;  4A3I C;  2O5I A;  1I3Q K;  2E2H C;  1K83 C;  3CQZ C;  1Y1V K;  3S2H K;  4MEX A;  4A93 K;  3EQL A;  5M5Y K;  3GTJ C;  5IP9 K;  4A3K C;  4YFK A;  4BY1 C;  4QIW L;  4A3E K;  4Y52 K;  4OIQ A;  3GTP C;  3M4O K;  5IYB C;  4JK1 A;  3S1Q K;  2JA5 C;  3HOV K;  1HQM A;  3GTL C;  1I6H K;  4A3M K;  5C4J C;  2YU9 C;  3S17 C;  5TMC A;  4A3D C;  3S16 K;  4QJV A;  2R7Z K;  1I6H C;  1TWA K;  1YNN A;  3GTM K;  4A3F K;  4GZY A;  3GTO K;  2JA8 K;  2JA8 C;  2NVQ C;  2NVQ K;  2A68 A;  1TWG K;  3S1M K;  3GTK C;  4A3L C;  4XLP A;  3I4N C;  3I4N K;  4A3D K;  3H0G C;  1TWG C;  5M3M K;  3RZO K;  3S1M C;  4AYB L;  4Q5S A;  3GTO C;  4A3L K;  4YFN A;  1WCM C;  3S14 K;  5C4X C;  3K7A K;  3RZD C;  4KMU A;  3S16 C;  3GTQ C;  1SFO K;  4G7H A;  1SMY A;  2Y0S L;  2WB1 L;  3WOD A;  1I50 K;  2PMZ L;  3HOW C;  3PO3 C;  2PMZ D;  3S17 K;  5IYB K;  2R92 K;  2R93 C;  4BY7 K;  3GTL K;  2PA8 L;  3GTP K;  3M4O C;  4A3E C;  4Y7N C;  3I4M K;  5C4X K;  4OIR A;  3S1Q C;  5TMF A;  2NVX C;  1TWC K;  5FLM K;  1I3Q C;  4LLG A;  3S1N C;  1IW7 A;  4A3I K;  1Y1W C;  2NVT K;  4XSZ A;  2E2H K;  2JA6 K;  4A3J K;  3S2H C;  4XSX A;  3S15 K;  1TWH K;  4A3J C;  3HOY C;  4G7O A;  4X6A C;  4BBR C;  4BBR K;  3HOX C;  3HOX K;  2E2J K;  3PO2 C;  3PO2 K;  3S2D K;  3S15 C;  1XPP A;  2NVY K;  3FKI K;  4YG2 A;  1R9T C;  3H3V L;  4MEY A;  3H3V D;  4A3B K;  3M3Y K;  2NVT C;  1Y1W K;  2NVX K;  4A3G K;  4Y7N K;  3I4M C;  2JA7 K;  2WB1 D;  4BBS K;  5IYC C;  2CW0 A;  5FLM C;  1TWC C;  4BY7 C;  4OIN A;  3HOW K;  2BE5 A;  4KN7 A;  1I50 C;  4BXX K;  2VUM K;  2R92 C;  4A3C K;  3GTQ K;  2R93 K;  5IP7 K;  3GTG C;  3HOZ C;  5IYD K;  3PO3 K;  2WAQ L;  1WCM K;  3S14 C;  5C44 C;  3RZO C;  3H0G K;  1SFO C;  4QIW D;  1YNJ A;  2B63 C;  3S1R K;  3K7A C;  3RZD K;  4C3H K;  4KN4 A;  2E2I C;  4ZH4 A;  5C3E K;  5C3E C;  3HOU C;  4LK1 A;  3HOU K;  2E2I K;  4LJZ A;  4QJV B;  1ZYR A;  4MQ9 A;  5FJ8 K;  3GTK K;  5C44 K;  4A3F C;  1TWA C;  4OIO A;  3GTM C;  2R7Z C;  2WAQ D;  3S1R C;  4C3J K;  5IP7 C;  3HKZ L;  4NOI A;  2YU9 K;  2B63 K;  4A3M C;  3GTG K;  4A3C C;  2O5J A;  4Q4Z A;  1BDF A;  2Y0S D;  4BXX C;  5D4D A;  4XLN A;  2JA5 K;  3HOV C;  5IYD C;  3HOZ K;  2A6E A;  5M5X K;  5C4J K;  4LK0 A;  5IYC K;  4C3I K;  2VUM C;  4OIP A;  2JA7 C;  4BBS C;  4YFX A;  5IP9 C;  4BY1 K;  4A3G C;  4G7Z A;  5M3F K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...