3N3YA

Crystal structure of thymidylate synthase x (thyx) from helicobacter pylori with fad and dump at 2.31a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
209
structure length
209
Chain Sequence
FMEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAREFLVFVDNEKVNAMSVLALENLRVLLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNLLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Structure, Enzymatic Characterization and Inhibitor Discovery of Thymidylate Synthase X (ThyX) from Helicobacter pylori Strain SS1
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 73
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n3yA00
1O2BA 1O24A 4P5AA 4GT9A 4GTFA 4GTAA 1KQ4A 1O27A 3N3YA 5IOSA 2CFAB 3AH5A 4KASA 4GTLA 5IOTA 5IORA 1O25A 1O29A 3N0BA 5IOQA 4FZBA 1O26A 4GTCA 2CFAA 4GTBA 4GTDA 4KARA 3G4CA 4KATA 4GTEA 5CHPA 4P5BA 3G4AA 5JFEA 3N0CA 1O2AA 1O28A
chains in the Genus database with same CATH superfamily
4P5AA 3FKIK 3FOEA 3AQOA 1K83K 2GAHC 4C3HK 2GSUA 3GTMA 4A3EC 2VUMC 5C4JC 4A3CK 4KMAA 2JA8C 3L4JA 4GTDA 1IW7A 5M3FK 2PPBA 2D6FC 3GTKK 2GAGC 3S15C 4AYBD 3GTLK 3S1QC 1R9TA 2ZUEA 1F7VA 4KMUA 3CQZK 2E2HC 3H0GC 3S1MK 4GTAA 1I50K 4LLGA 3T00A 4G7HA 2Y0SL 1I3QC 2PHCB 3S0XA 4BXXC 3M4OC 1HQMA 2NVYA 3RZDC 4QIWD 3PO3K 1VLOA 4KASA 1IS1A 5IYDK 3GTQK 3A8KA 3HOXC 2JA6K 2V6TA 4XLNA 2E2IA 1WSVA 4KARA 1JQWA 5CJ9A 3V4GA 4G0UA 3HOWK 4OINA 4A93C 4YFXA 3TFIA 1EFWA 2CFAB 2A69A 3WODA 2YU9C 1VH2A 2NVXA 1TWGK 2R92A 1Y1VC 3N0BA 2FQTA 4A3IK 1UV7A 2B63K 4WJ3M 3K7AK 3GTMC 3MMLB 4Y52C 3TTGA 3N0CA 5EGEA 5C44K 3S1NK 4A3LK 4BY7K 2BE5A 2V6SA 4BKWA 3S2HK 1XZQA 3HOUK 1EK8A 3AQPA 1L0WA 4A3JK 3HXAA 4LR2A 3OREA 1BDFA 3FKIC 3N3YA 5IP7K 2O5JA 1R9TC 5IYBK 2R93C 1IBAA 1K83C 4P9SA 3GTJC 4A3MK 1USMA 1WQFA 4C3HC 2R7ZK 5IORA 1VGXA 1TWHK 2Y3PA 1O26A 1F93A 3H0GA 3GTOK 3SZZA 4BBSK 4GTEA 1I3QA 2V6UA 1TWAA 4C3IC 4YFKA 3GTKC 1AB4A 1V5VA 1XZPA 2E2IC 3HOZC 1J6XA 1ZVUA 4A3BK 1TWCK 1XXAA 4KMDA 1I50C 2CW0A 4C2MK 3GEIA 4A3FK 4GFQA 2A6EA 1WOOA 1YX2A 5TMCA 4WILA 1VRQC 5M5WK 3GTQC 1WCMA 3SZYA 4BBRK 3S17K 2PMZL 2R92C 4P5BA 4ZH4A 4OIPA 1YNNA 3S14K 4GT9A 4GTFA 4A3DK 3I4MK 2YU9A 4BY1C 2W7VA 1Y1VA 1TWFA 1SFOK 1BS2A 3S16C 4KB2A 1GE9A 2WB1D 5IP9K 3S2DC 4BLBA 3GTGK 1TWGC 1DCHA 5IYCK 1WIHA 3LPXA 3T02A 4C3JC 1DD5A 4OIOA 4KM9A 3PO2C 2WAQL 3FKIA 2PA8D 1O28A 3HKZL 4A3GK 2R93A 1K83A 2RH6A 3GTJA 3L4KA 5C44C 4A3LC 3I4NK 1YNJA 1TWAC 2P8TA 4Y7NC 2NVYK 1I6HC 3OPFA 3FHZA 4A3KC 5M5YK 1ISEA 2O5IA 3GTKA 4QJVA 2R7ZC 3BP8C 3G4CA 3DXJA 2NVQK 3CQZA 2JA5K 3ERED 1JOEA 1I50A 4BBSC 1J98A 4J3NA 2E2JK 2JH3A 4O2DA 3VA7A 1Y1WC 1WCMC 3QX3A 1F7UA 2XCOA 2A68A 3GTQA 5FLMK 4XLPA 4C2MC 1EH1A 1TWFC 1XPPA 5C4XK 3HOYK 5M5XK 5C3EC 5JFEA 3NUHA 1O2AA 4XSXA 3AD7C 5HL8A 3AD9C 1ZXOA 4X6AC 3GTPK 1RU0A 5IOSA 4A3EK 4A3DC 2VUMK 5L46A 1TWGA 2JA8K 3AH5A 4LOWA 4RMFA 1SFOC 4MEYA 2Y0SD 2B63A 3H3VL 3S15K 4AH6A 3S1QK 5IP9C 5D4DA 3LAJA 3HOVK 2E2HK 4A3CC 3GTGC 4MEXA 4KATA 3TFHA 3G4AA 1I3QK 1J6WA 1EI6A 4KAWX 4BXXK 3M4OK 3IPJA 3RZDK 3GTLC 3CQZC 5TJ3A 3HOXK 3S1MC 2R7ZA 4KN7A 3S1RK 3GTOA 4AYBL 3PO3C 4Q4ZA 1IL2A 2JA7K 4GTBA 2XCRB 5IYDC 4M1XA 1Y1WA 3FOFA 1JVIA 3JSTA 2KWAA 2JA6C 2GSNA 3M3YK 3GEHA 4A93K 5M3MK 1WORA 4LQYA 1IQ0A 1TWCA 4QIWL 5FJ8K 2YU9K 4BLAA 1Y1VK 4OIRA 4WJ4A 1ZYRA 3HOWC 4GTLA 3RZOK 3GTMK 5E68A 1O29A 3ADAC 4Y52K 2CFAA 1XZQB 2ZUFA 1WOSA 3TFJA 1XXCA 4A3IC 2GSOA 1J6VA 3BP3A 1BJTA 2B63C 1ZBSA 2XCQA 1O2BA 3K7AC 1R9TK 1SFOA 4MQ9A 2R93K 4YFNA 4LJZA 3GTJK 3S1NC 4BY7C 5TMFA 3S2HC 1B4BA 3HOUC 3GTPC 4A3JC 4FM9A 4NOIA 3A8IA 3GTGA 5IP7C 1EQRA 5IYBC 5IOQA 4KMHA 4C3IK 1C0AA 4A3MC 1XZPB 1DCOA 1WSRA 1WQHA 3GTLA 1TWHC 5CHPA 4KB4A 2E2IK 3HOZK 3HOVC 3GTOC 1YCLA 4JK1A 2EBBA 2PMZD 1O27A 3GEEA 2FQOA 1G51A 2NVTK 1PJ6A 4A3BC 1TWCC 2JA6A 3GIRA 4OIQA 4PABA 4A3FC 2NVXK 4C45A 2R92K 1F9NA 3S1RC 1VJEA 2JA5A 4KM8A 4BY1K 2JA7C 3GSIA 1O24A 1X31C 4BBRC 1DCPA 3S16K 3M3YC 3S17C 5EGHA 2WAQD 3GDZA 3HKZD 3S14C 3S2DK 4LK0A 3I4MC 5C4JK 1SMYA 2RGRA 5IOTA 1I6VA 4C3JK 4G7ZA 4FZBA 3PO2K 3RZOC 1PJ7A 1XXBA 4GZYA 3H0GK 2A6HA 3A8JA 3T01A 5IYCC 1TWAK 3GTPA 4DDQA 4XSZA 4Y7NK 2VUMA 1I6HK 4A3KK 2WB1L 1IE0A 3OEPA 4A3GC 1WOPA 4QJVB 2ZFZA 4ILDA 3I4NC 1B4AA 1TWHA 2E2HA 2NVYC 4KN4A 4GTCA 5JVOA 2PA8L 4G0WA 4KC6A 3BUEA 4PAAA 1Y1WK 4XCHA 1WCMK 1ZQ1C 4YG2A 4G0VA 2P5MA 2NVQC 1HI9A 1KQ4A 3AD8C 2JA5C 4Q5SA 3Q3QA 4G7OA 3EQLA 1PJ5A 2E2JC 1TWFK 4LK1A 3CAGA 1O2FB 4KDDA 2NVTC 1O25A 2JA7A 1USOA 5C3EK 1WQGA 1INNA 5FLMC 3LAPA 2NVXC 3H3VD 4X6AK 5C4XC 3HOYC 1BGWA
chains in the Genus database with same CATH topology
1AB4A 4P5AA 3FOEA 3AQOA 1ZXOA 1ZVUA 1O27A 1XXAA 5IOSA 2GSUA 4KMDA 1TWGA 3AH5A 3GTMA 4GFQA 2JA6A 2B63A 4KMAA 3L4JA 1F9NA 4GTDA 3LAJA 1WCMA 2JA5A 4KM8A 4KATA 3G4AA 1R9TA 4P5BA 4KAWX 1O24A 4GT9A 4GTFA 4GTAA 2YU9A 5EGHA 1Y1VA 1TWFA 2PHCB 3S0XA 5TJ3A 2NVYA 4KB2A 2R7ZA 1GE9A 4KASA 1IS1A 2RGRA 5IOTA 3GTOA 4BLBA 4FZBA 4GTBA 2XCRB 1XXBA 4M1XA 2E2IA 1Y1WA 1WIHA 4KARA 5CJ9A 3LPXA 3V4GA 3FOFA 4C3JC 1DD5A 2KWAA 4KM9A 2GSNA 3FKIA 1O28A 4LQYA 2R93A 3GTPA 1K83A 4DDQA 1TWCA 2RH6A 3GTJA 4G0UA 3L4KA 2VUMA 4BLAA 3OEPA 2CFAB 2ZFZA 4ILDA 4GTLA 3OPFA 3FHZA 1B4AA 1O2AA 2NVXA 1TWHA 2R92A 3N0BA 1O29A 1ISEA 3GTKA 2E2HA 4GTCA 2CFAA 5JVOA 4G0WA 4KC6A 3BUEA 1XXCA 3G4CA 3MMLB 2GSOA 3CQZA 1BJTA 3N0CA 5EGEA 3ERED 1ZBSA 1I50A 2XCQA 1O2BA 4BKWA 4G0VA 1SFOA 2P5MA 4J3NA 1EK8A 2JH3A 3AQPA 3VA7A 3QX3A 1KQ4A 4LR2A 3Q3QA 3OREA 3N3YA 1B4BA 2XCOA 3GTQA 4FM9A 3CAGA 1WQFA 3GTGA 4C3HC 4KDDA 5IORA 1O25A 4C2MC 2JA7A 1EH1A 5IOQA 2Y3PA 1WQGA 1O26A 4KMHA 3H0GA 1WQHA 3GTLA 3LAPA 4GTEA 1I3QA 5CHPA 1TWAA 4KB4A 5JFEA 4C3IC 3NUHA 1BGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2B A;  1O24 A;  4P5A A;  4GT9 A;  4GTF A;  4GTA A;  1KQ4 A;  1O27 A;  3N3Y A;  5IOS A;  2CFA B;  3AH5 A;  4KAS A;  4GTL A;  5IOT A;  5IOR A;  1O25 A;  1O29 A;  3N0B A;  5IOQ A;  4FZB A;  1O26 A;  4GTC A;  2CFA A;  4GTB A;  4GTD A;  4KAR A;  3G4C A;  4KAT A;  4GTE A;  5CHP A;  4P5B A;  3G4A A;  5JFE A;  3N0C A;  1O2A A;  1O28 A; 
#chains in the Genus database with same CATH topology
 4P5A A;  3FKI K;  3FOE A;  3AQO A;  1K83 K;  2GAH C;  4C3H K;  2GSU A;  3GTM A;  4A3E C;  2VUM C;  5C4J C;  4A3C K;  4KMA A;  2JA8 C;  3L4J A;  4GTD A;  1IW7 A;  5M3F K;  2PPB A;  2D6F C;  3GTK K;  2GAG C;  3S15 C;  4AYB D;  3GTL K;  3S1Q C;  1R9T A;  2ZUE A;  1F7V A;  4KMU A;  3CQZ K;  2E2H C;  3H0G C;  3S1M K;  4GTA A;  1I50 K;  4LLG A;  3T00 A;  4G7H A;  2Y0S L;  1I3Q C;  2PHC B;  3S0X A;  4BXX C;  3M4O C;  1HQM A;  2NVY A;  3RZD C;  4QIW D;  3PO3 K;  1VLO A;  4KAS A;  1IS1 A;  5IYD K;  3GTQ K;  3A8K A;  3HOX C;  2JA6 K;  2V6T A;  4XLN A;  2E2I A;  1WSV A;  4KAR A;  1JQW A;  5CJ9 A;  3V4G A;  4G0U A;  3HOW K;  4OIN A;  4A93 C;  4YFX A;  3TFI A;  1EFW A;  2CFA B;  2A69 A;  3WOD A;  2YU9 C;  1VH2 A;  2NVX A;  1TWG K;  2R92 A;  1Y1V C;  3N0B A;  2FQT A;  4A3I K;  1UV7 A;  2B63 K;  4WJ3 M;  3K7A K;  3GTM C;  3MML B;  4Y52 C;  3TTG A;  3N0C A;  5EGE A;  5C44 K;  3S1N K;  4A3L K;  4BY7 K;  2BE5 A;  2V6S A;  4BKW A;  3S2H K;  1XZQ A;  3HOU K;  1EK8 A;  3AQP A;  1L0W A;  4A3J K;  3HXA A;  4LR2 A;  3ORE A;  1BDF A;  3FKI C;  3N3Y A;  5IP7 K;  2O5J A;  1R9T C;  5IYB K;  2R93 C;  1IBA A;  1K83 C;  4P9S A;  3GTJ C;  4A3M K;  1USM A;  1WQF A;  4C3H C;  2R7Z K;  5IOR A;  1VGX A;  1TWH K;  2Y3P A;  1O26 A;  1F93 A;  3H0G A;  3GTO K;  3SZZ A;  4BBS K;  4GTE A;  1I3Q A;  2V6U A;  1TWA A;  4C3I C;  4YFK A;  3GTK C;  1AB4 A;  1V5V A;  1XZP A;  2E2I C;  3HOZ C;  1J6X A;  1ZVU A;  4A3B K;  1TWC K;  1XXA A;  4KMD A;  1I50 C;  2CW0 A;  4C2M K;  3GEI A;  4A3F K;  4GFQ A;  2A6E A;  1WOO A;  1YX2 A;  5TMC A;  4WIL A;  1VRQ C;  5M5W K;  3GTQ C;  1WCM A;  3SZY A;  4BBR K;  3S17 K;  2PMZ L;  2R92 C;  4P5B A;  4ZH4 A;  4OIP A;  1YNN A;  3S14 K;  4GT9 A;  4GTF A;  4A3D K;  3I4M K;  2YU9 A;  4BY1 C;  2W7V A;  1Y1V A;  1TWF A;  1SFO K;  1BS2 A;  3S16 C;  4KB2 A;  1GE9 A;  2WB1 D;  5IP9 K;  3S2D C;  4BLB A;  3GTG K;  1TWG C;  1DCH A;  5IYC K;  1WIH A;  3LPX A;  3T02 A;  4C3J C;  1DD5 A;  4OIO A;  4KM9 A;  3PO2 C;  2WAQ L;  3FKI A;  2PA8 D;  1O28 A;  3HKZ L;  4A3G K;  2R93 A;  1K83 A;  2RH6 A;  3GTJ A;  3L4K A;  5C44 C;  4A3L C;  3I4N K;  1YNJ A;  1TWA C;  2P8T A;  4Y7N C;  2NVY K;  1I6H C;  3OPF A;  3FHZ A;  4A3K C;  5M5Y K;  1ISE A;  2O5I A;  3GTK A;  4QJV A;  2R7Z C;  3BP8 C;  3G4C A;  3DXJ A;  2NVQ K;  3CQZ A;  2JA5 K;  3ERE D;  1JOE A;  1I50 A;  4BBS C;  1J98 A;  4J3N A;  2E2J K;  2JH3 A;  4O2D A;  3VA7 A;  1Y1W C;  1WCM C;  3QX3 A;  1F7U A;  2XCO A;  2A68 A;  3GTQ A;  5FLM K;  4XLP A;  4C2M C;  1EH1 A;  1TWF C;  1XPP A;  5C4X K;  3HOY K;  5M5X K;  5C3E C;  5JFE A;  3NUH A;  1O2A A;  4XSX A;  3AD7 C;  5HL8 A;  3AD9 C;  1ZXO A;  4X6A C;  3GTP K;  1RU0 A;  5IOS A;  4A3E K;  4A3D C;  2VUM K;  5L46 A;  1TWG A;  2JA8 K;  3AH5 A;  4LOW A;  4RMF A;  1SFO C;  4MEY A;  2Y0S D;  2B63 A;  3H3V L;  3S15 K;  4AH6 A;  3S1Q K;  5IP9 C;  5D4D A;  3LAJ A;  3HOV K;  2E2H K;  4A3C C;  3GTG C;  4MEX A;  4KAT A;  3TFH A;  3G4A A;  1I3Q K;  1J6W A;  1EI6 A;  4KAW X;  4BXX K;  3M4O K;  3IPJ A;  3RZD K;  3GTL C;  3CQZ C;  5TJ3 A;  3HOX K;  3S1M C;  2R7Z A;  4KN7 A;  3S1R K;  3GTO A;  4AYB L;  3PO3 C;  4Q4Z A;  1IL2 A;  2JA7 K;  4GTB A;  2XCR B;  5IYD C;  4M1X A;  1Y1W A;  3FOF A;  1JVI A;  3JST A;  2KWA A;  2JA6 C;  2GSN A;  3M3Y K;  3GEH A;  4A93 K;  5M3M K;  1WOR A;  4LQY A;  1IQ0 A;  1TWC A;  4QIW L;  5FJ8 K;  2YU9 K;  4BLA A;  1Y1V K;  4OIR A;  4WJ4 A;  1ZYR A;  3HOW C;  4GTL A;  3RZO K;  3GTM K;  5E68 A;  1O29 A;  3ADA C;  4Y52 K;  2CFA A;  1XZQ B;  2ZUF A;  1WOS A;  3TFJ A;  1XXC A;  4A3I C;  2GSO A;  1J6V A;  3BP3 A;  1BJT A;  2B63 C;  1ZBS A;  2XCQ A;  1O2B A;  3K7A C;  1R9T K;  1SFO A;  4MQ9 A;  2R93 K;  4YFN A;  4LJZ A;  3GTJ K;  3S1N C;  4BY7 C;  5TMF A;  3S2H C;  1B4B A;  3HOU C;  3GTP C;  4A3J C;  4FM9 A;  4NOI A;  3A8I A;  3GTG A;  5IP7 C;  1EQR A;  5IYB C;  5IOQ A;  4KMH A;  4C3I K;  1C0A A;  4A3M C;  1XZP B;  1DCO A;  1WSR A;  1WQH A;  3GTL A;  1TWH C;  5CHP A;  4KB4 A;  2E2I K;  3HOZ K;  3HOV C;  3GTO C;  1YCL A;  4JK1 A;  2EBB A;  2PMZ D;  1O27 A;  3GEE A;  2FQO A;  1G51 A;  2NVT K;  1PJ6 A;  4A3B C;  1TWC C;  2JA6 A;  3GIR A;  4OIQ A;  4PAB A;  4A3F C;  2NVX K;  4C45 A;  2R92 K;  1F9N A;  3S1R C;  1VJE A;  2JA5 A;  4KM8 A;  4BY1 K;  2JA7 C;  3GSI A;  1O24 A;  1X31 C;  4BBR C;  1DCP A;  3S16 K;  3M3Y C;  3S17 C;  5EGH A;  2WAQ D;  3GDZ A;  3HKZ D;  3S14 C;  3S2D K;  4LK0 A;  3I4M C;  5C4J K;  1SMY A;  2RGR A;  5IOT A;  1I6V A;  4C3J K;  4G7Z A;  4FZB A;  3PO2 K;  3RZO C;  1PJ7 A;  1XXB A;  4GZY A;  3H0G K;  2A6H A;  3A8J A;  3T01 A;  5IYC C;  1TWA K;  3GTP A;  4DDQ A;  4XSZ A;  4Y7N K;  2VUM A;  1I6H K;  4A3K K;  2WB1 L;  1IE0 A;  3OEP A;  4A3G C;  1WOP A;  4QJV B;  2ZFZ A;  4ILD A;  3I4N C;  1B4A A;  1TWH A;  2E2H A;  2NVY C;  4KN4 A;  4GTC A;  5JVO A;  2PA8 L;  4G0W A;  4KC6 A;  3BUE A;  4PAA A;  1Y1W K;  4XCH A;  1WCM K;  1ZQ1 C;  4YG2 A;  4G0V A;  2P5M A;  2NVQ C;  1HI9 A;  1KQ4 A;  3AD8 C;  2JA5 C;  4Q5S A;  3Q3Q A;  4G7O A;  3EQL A;  1PJ5 A;  2E2J C;  1TWF K;  4LK1 A;  3CAG A;  1O2F B;  4KDD A;  2NVT C;  1O25 A;  2JA7 A;  1USO A;  5C3E K;  1WQG A;  1INN A;  5FLM C;  3LAP A;  2NVX C;  3H3V D;  4X6A K;  5C4X C;  3HOY C;  1BGW A; 
#chains in the Genus database with same CATH homology
 1AB4 A;  4P5A A;  3FOE A;  3AQO A;  1ZXO A;  1ZVU A;  1O27 A;  1XXA A;  5IOS A;  2GSU A;  4KMD A;  1TWG A;  3AH5 A;  3GTM A;  4GFQ A;  2JA6 A;  2B63 A;  4KMA A;  3L4J A;  1F9N A;  4GTD A;  3LAJ A;  1WCM A;  2JA5 A;  4KM8 A;  4KAT A;  3G4A A;  1R9T A;  4P5B A;  4KAW X;  1O24 A;  4GT9 A;  4GTF A;  4GTA A;  2YU9 A;  5EGH A;  1Y1V A;  1TWF A;  2PHC B;  3S0X A;  5TJ3 A;  2NVY A;  4KB2 A;  2R7Z A;  1GE9 A;  4KAS A;  1IS1 A;  2RGR A;  5IOT A;  3GTO A;  4BLB A;  4FZB A;  4GTB A;  2XCR B;  1XXB A;  4M1X A;  2E2I A;  1Y1W A;  1WIH A;  4KAR A;  5CJ9 A;  3LPX A;  3V4G A;  3FOF A;  4C3J C;  1DD5 A;  2KWA A;  4KM9 A;  2GSN A;  3FKI A;  1O28 A;  4LQY A;  2R93 A;  3GTP A;  1K83 A;  4DDQ A;  1TWC A;  2RH6 A;  3GTJ A;  4G0U A;  3L4K A;  2VUM A;  4BLA A;  3OEP A;  2CFA B;  2ZFZ A;  4ILD A;  4GTL A;  3OPF A;  3FHZ A;  1B4A A;  1O2A A;  2NVX A;  1TWH A;  2R92 A;  3N0B A;  1O29 A;  1ISE A;  3GTK A;  2E2H A;  4GTC A;  2CFA A;  5JVO A;  4G0W A;  4KC6 A;  3BUE A;  1XXC A;  3G4C A;  3MML B;  2GSO A;  3CQZ A;  1BJT A;  3N0C A;  5EGE A;  3ERE D;  1ZBS A;  1I50 A;  2XCQ A;  1O2B A;  4BKW A;  4G0V A;  1SFO A;  2P5M A;  4J3N A;  1EK8 A;  2JH3 A;  3AQP A;  3VA7 A;  3QX3 A;  1KQ4 A;  4LR2 A;  3Q3Q A;  3ORE A;  3N3Y A;  1B4B A;  2XCO A;  3GTQ A;  4FM9 A;  3CAG A;  1WQF A;  3GTG A;  4C3H C;  4KDD A;  5IOR A;  1O25 A;  4C2M C;  2JA7 A;  1EH1 A;  5IOQ A;  2Y3P A;  1WQG A;  1O26 A;  4KMH A;  3H0G A;  1WQH A;  3GTL A;  3LAP A;  4GTE A;  1I3Q A;  5CHP A;  1TWA A;  4KB4 A;  5JFE A;  4C3I C;  3NUH A;  1BGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...