3N3YA

Crystal structure of thymidylate synthase x (thyx) from helicobacter pylori with fad and dump at 2.31a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
209
structure length
209
Chain Sequence
FMEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAREFLVFVDNEKVNAMSVLALENLRVLLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNLLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Structure, Enzymatic Characterization and Inhibitor Discovery of Thymidylate Synthase X (ThyX) from Helicobacter pylori Strain SS1
rcsb
source organism Helicobacter pylori
total genus 73
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n3yA00
1O27A 2CFAA 3G4CA 1O2AA 4GTFA 5JFEA 4GT9A 4GTEA 5IOTA 4GTCA 1O28A 3N3YA 5IOQA 1O26A 4FZBA 1O29A 4GTDA 3G4AA 5IORA 2CFAB 4KASA 4GTLA 4P5BA 5CHPA 5IOSA 1O2BA 4P5AA 1O24A 4GTAA 4GTBA 4KARA 3AH5A 1KQ4A 3N0CA 1O25A 3N0BA 4KATA
chains in the Genus database with same CATH superfamily
3G4CA 3L4KA 2NVQK 5IP7C 1XPPA 5L46A 1TWHK 2XCOA 4C3IK 2XCRB 5IYCK 5C4XK 1UV7A 4ILDA 4P5BA 2W7VA 3LAPA 1DCHA 4WJ3M 3FHZA 1WIHA 1TWHA 3S1MK 4MEXA 3EQLA 1I6HK 2PPBA 4KN7A 4LLGA 2A6HA 3M3YC 5TMFA 1TWCA 5FLMC 4KARA 1YX2A 4YG2A 2WAQD 3AQOA 1I3QC 1VH2A 2XCQA 1XZPA 4A93C 4KDDA 2KWAA 5IYBC 4GTCA 2B63C 4BKWA 1O29A 4Y7NK 4XSXA 1EI6A 4KMAA 4A3JK 5IYDK 2RGRA 4KB4A 1TWFC 4QJVA 4GTLA 5IOSA 2Y3PA 4QIWD 4GFQA 3SZZA 3GTJK 3HOXK 1WOPA 4G0VA 2E2HK 1XXBA 5FJ8K 4QJVB 1F93A 4A3GC 2P8TA 1I50C 4A3FK 1WQGA 4KC6A 3AD8C 3PO3C 1G51A 3QX3A 5IP7K 2YU9C 4GTEA 4WILA 3HOWC 4YFXA 3GTOC 2WAQL 5EGEA 2NVYC 1BS2A 1BGWA 4PABA 3M3YK 3I4NC 5FLMK 3S1QC 4G7ZA 2ZUFA 1O27A 4P9SA 1ZXOA 2PMZL 1I3QK 4GTFA 1SMYA 4A93K 3S1RC 5IYBK 5EGHA 4KMHA 2RH6A 4QIWL 2B63K 3S0XA 3RZOC 1YNJA 1VRQC 3HXAA 2JA5C 1VLOA 4KMDA 3AD7C 5TMCA 3GSIA 1WQHA 2Y0SD 3WODA 3GTPC 1SFOA 4YFNA 4G7OA 4KM9A 2BE5A 1Y1WC 1XZQA 2R7ZC 3CQZC 1XXAA 1R9TA 4BBSC 4A3GK 1WSVA 2JA7C 1I50K 2O5JA 3PO3K 2FQTA 3GTLA 2YU9K 1XZQB 3GTMC 1WCMA 4KM8A 4LK0A 3HOWK 5M5WK 4KN4A 1Y1VA 2ZFZA 4KASA 3GTGC 4GZYA 4M1XA 3A8KA 1PJ5A 3GTKA 3H0GC 3GTOK 3ERED 2NVYK 1YNNA 4KAWX 1WOSA 4BLAA 2GAGC 2P5MA 3I4NK 1USMA 1O25A 2A6EA 3N0BA 4KATA 3S1QK 4RMFA 5CJ9A 3T02A 1VJEA 1C0AA 5JFEA 3S1RK 2E2IC 4LK1A 1INNA 3RZOK 1IQ0A 4XLPA 2WB1D 4PAAA 4G0WA 1ZVUA 2JA5K 3DXJA 2VUMC 2R92C 2R93C 4GTAA 1V5VA 3GTPK 3FOEA 1Y1WK 3OREA 2R7ZK 5E68A 3CQZK 4BBSK 2PHCB 1HQMA 2JA7K 3Q3QA 1TWAC 3CAGA 4OINA 2D6FC 1DD5A 1J6XA 1USOA 3GTMK 1B4BA 2R7ZA 3S1NC 3S2HC 3GTGK 1J6VA 1XZPB 2JA7A 3S2DC 1WOOA 1K83C 3H0GK 4LR2A 3TTGA 3S16C 3GEHA 3RZDC 4OIRA 3GTQC 4LJZA 3GTMA 1VGXA 3TFHA 3OPFA 3FKIC 2CFAA 3GTGA 3S14C 4FM9A 2E2JC 4A3LC 4A3DC 2WB1L 3GTJA 3A8JA 2E2IK 2E2HA 4BBRC 4C3JC 3HOYC 2V6SA 5IORA 1TWGC 4G0UA 5C3EC 5JVOA 3M4OC 3T00A 1EFWA 1O2BA 4J3NA 1L0WA 2VUMK 2R92K 2R93K 4JK1A 2E2IA 4XCHA 2NVXC 2A69A 2PA8D 1JOEA 1TWAK 1PJ7A 4A3KC 1BJTA 2R92A 4WJ4A 5IOQA 4GTDA 3V4GA 1WQFA 1IL2A 3S1NK 3S2HK 4A3MC 1TWFK 3S2DK 1I3QA 1J6WA 1TWAA 4P5AA 1K83K 3HOVC 2GSOA 3S16K 5M5XK 3RZDK 3GTQK 4DDQA 2B63A 4AYBD 3GEEA 1DCPA 3FKIK 4KMUA 3H3VD 1TWFA 3S14K 4A3LK 2E2JK 3PO2C 1K83A 4A3DK 5IOTA 1TWCC 3N3YA 2JA6C 3G4AA 4C3JK 3HOYK 3LAJA 1BDFA 4C3HC 3FKIA 3LPXA 1TWGK 1WORA 1I50A 5C3EK 1AB4A 2PA8L 3M4OK 3HOUC 4C2MC 5IP9C 2YU9A 1RU0A 1JVIA 4XLNA 2NVXK 4A3CC 3GDZA 4AH6A 3S15C 1O2AA 2JA8C 3GTOA 5M5YK 1O28A 4A3KK 2NVYA 2Y0SL 4ZH4A 2V6TA 3S17C 4BY7C 2GAHC 4A3MK 3L4JA 3H3VL 3HOVK 1O24A 1IE0A 2FQOA 1DCOA 3HKZD 1PJ6A 3AH5A 3N0CA 5C4JC 1B4AA 1EH1A 1J98A 1F7UA 2JA5A 3PO2K 1TWCK 3GTPA 1O26A 4FZBA 2JA6K 1YCLA 3ADAC 3SZYA 1Y1WA 2A68A 2NVTC 1HI9A 3CQZA 5TJ3A 4C3HK 1ISEA 1ZQ1C 4LOWA 4A3BC 4KB2A 4C45A 3HOZC 3HOUK 4C2MK 5IP9K 1GE9A 3TFIA 2ZUEA 2JA6A 5M3FK 4LQYA 4A3IC 4A3CK 4X6AC 3BUEA 3S15K 1SFOC 3A8IA 2JA8K 3H0GA 1WSRA 1F9NA 3AD9C 1X31C 3IPJA 1R9TC 2PMZD 3BP3A 2CFAB 3S17K 4Q4ZA 3HKZL 4BY7K 3FOFA 3GTLC 4BY1C 4A3EC 1WCMC 4GTBA 2O5IA 4O2DA 1Y1VC 5C4JK 3GTKC 3K7AC 4NOIA 4BXXC 4Y52C 5D4DA 4GT9A 1ZYRA 3VA7A 2VUMA 5C44C 2R93A 4OIPA 3NUHA 4G7HA 2NVTK 4OIOA 4YFKA 4A3BK 5HL8A 3HOZK 3GEIA 1KQ4A 3I4MC 4A3IK 1JQWA 2NVQC 4X6AK 1TWHC 2EBBA 4C3IC 1SFOK 5M3MK 1F7VA 5IYCC 5C4XC 3GIRA 1O2FB 2GSUA 3GTQA 2GSNA 1R9TK 4BBRK 1I6VA 3S1MC 1I6HC 5CHPA 3JSTA 3GTLK 4BLBA 4BY1K 3T01A 4A3EK 1WCMK 1EK8A 1IW7A 3MMLB 1IS1A 1Y1VK 1XXCA 4MQ9A 1TWGA 3GTKK 3K7AK 4BXXK 4Y52K 3TFJA 4Y7NC 5C44K 3BP8C 5IYDC 4A3JC 4MEYA 2NVXA 3AQPA 4OIQA 1IBAA 4AYBL 2V6UA 2CW0A 3GTJC 3HOXC 2E2HC 3OEPA 2JH3A 4Q5SA 1ZBSA 4XSZA 1EQRA 4A3FC 3I4MK
chains in the Genus database with same CATH topology
3BUEA 3G4CA 3L4KA 2XCRB 2XCOA 3GTLA 3H0GA 2R92A 1BJTA 1F9NA 5IOQA 4GTDA 1WCMA 3V4GA 4KM8A 1WQFA 2CFAB 1Y1VA 2ZFZA 4ILDA 4KASA 4P5BA 4M1XA 3FOFA 3LAPA 3FHZA 1WIHA 1TWHA 3GTKA 1I3QA 1TWAA 4P5AA 3ERED 2GSOA 4GTBA 4KAWX 4BLAA 1TWCA 2P5MA 4KARA 4DDQA 2B63A 1O25A 3N0BA 4KATA 3AQOA 2XCQA 1TWFA 5CJ9A 5JFEA 4KDDA 4GT9A 1K83A 2KWAA 5IOTA 4GTCA 3VA7A 3N3YA 2VUMA 4BKWA 2R93A 1O29A 3G4AA 3NUHA 4KMAA 3LAJA 2RGRA 4KB4A 4C3HC 3FKIA 3LPXA 4GTLA 4G0WA 1ZVUA 1I50A 5IOSA 1AB4A 4C2MC 2Y3PA 4GFQA 4GTAA 2YU9A 4G0VA 3FOEA 1XXBA 1KQ4A 3OREA 2PHCB 1WQGA 1O2AA 4KC6A 4C3IC 3Q3QA 3QX3A 3CAGA 3GTOA 4GTEA 1O28A 1DD5A 2NVYA 1B4BA 2GSUA 3GTQA 2GSNA 2R7ZA 2JA7A 5CHPA 3L4JA 5EGEA 4BLBA 4LR2A 1O24A 1BGWA 3GTMA 1EK8A 3AH5A 3MMLB 1IS1A 3N0CA 1XXCA 3OPFA 1B4AA 1EH1A 1O27A 2CFAA 3GTGA 1ZXOA 1TWGA 4FM9A 4GTFA 2JA5A 3GTJA 5EGHA 4KMHA 1O26A 2RH6A 4FZBA 3GTPA 3S0XA 2E2HA 4C3JC 1Y1WA 5IORA 2NVXA 3AQPA 5TJ3A 3CQZA 4G0UA 1ISEA 5JVOA 4KMDA 1WQHA 1O2BA 4KB2A 4J3NA 1SFOA 1GE9A 4KM9A 3OEPA 2E2IA 2JA6A 2JH3A 1ZBSA 4LQYA 1R9TA 1XXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O27 A;  2CFA A;  3G4C A;  1O2A A;  4GTF A;  5JFE A;  4GT9 A;  4GTE A;  5IOT A;  4GTC A;  1O28 A;  3N3Y A;  5IOQ A;  1O26 A;  4FZB A;  1O29 A;  4GTD A;  3G4A A;  5IOR A;  2CFA B;  4KAS A;  4GTL A;  4P5B A;  5CHP A;  5IOS A;  1O2B A;  4P5A A;  1O24 A;  4GTA A;  4GTB A;  4KAR A;  3AH5 A;  1KQ4 A;  3N0C A;  1O25 A;  3N0B A;  4KAT A; 
#chains in the Genus database with same CATH topology
 3G4C A;  3L4K A;  2NVQ K;  5IP7 C;  1XPP A;  5L46 A;  1TWH K;  2XCO A;  4C3I K;  2XCR B;  5IYC K;  5C4X K;  1UV7 A;  4ILD A;  4P5B A;  2W7V A;  3LAP A;  1DCH A;  4WJ3 M;  3FHZ A;  1WIH A;  1TWH A;  3S1M K;  4MEX A;  3EQL A;  1I6H K;  2PPB A;  4KN7 A;  4LLG A;  2A6H A;  3M3Y C;  5TMF A;  1TWC A;  5FLM C;  4KAR A;  1YX2 A;  4YG2 A;  2WAQ D;  3AQO A;  1I3Q C;  1VH2 A;  2XCQ A;  1XZP A;  4A93 C;  4KDD A;  2KWA A;  5IYB C;  4GTC A;  2B63 C;  4BKW A;  1O29 A;  4Y7N K;  4XSX A;  1EI6 A;  4KMA A;  4A3J K;  5IYD K;  2RGR A;  4KB4 A;  1TWF C;  4QJV A;  4GTL A;  5IOS A;  2Y3P A;  4QIW D;  4GFQ A;  3SZZ A;  3GTJ K;  3HOX K;  1WOP A;  4G0V A;  2E2H K;  1XXB A;  5FJ8 K;  4QJV B;  1F93 A;  4A3G C;  2P8T A;  1I50 C;  4A3F K;  1WQG A;  4KC6 A;  3AD8 C;  3PO3 C;  1G51 A;  3QX3 A;  5IP7 K;  2YU9 C;  4GTE A;  4WIL A;  3HOW C;  4YFX A;  3GTO C;  2WAQ L;  5EGE A;  2NVY C;  1BS2 A;  1BGW A;  4PAB A;  3M3Y K;  3I4N C;  5FLM K;  3S1Q C;  4G7Z A;  2ZUF A;  1O27 A;  4P9S A;  1ZXO A;  2PMZ L;  1I3Q K;  4GTF A;  1SMY A;  4A93 K;  3S1R C;  5IYB K;  5EGH A;  4KMH A;  2RH6 A;  4QIW L;  2B63 K;  3S0X A;  3RZO C;  1YNJ A;  1VRQ C;  3HXA A;  2JA5 C;  1VLO A;  4KMD A;  3AD7 C;  5TMC A;  3GSI A;  1WQH A;  2Y0S D;  3WOD A;  3GTP C;  1SFO A;  4YFN A;  4G7O A;  4KM9 A;  2BE5 A;  1Y1W C;  1XZQ A;  2R7Z C;  3CQZ C;  1XXA A;  1R9T A;  4BBS C;  4A3G K;  1WSV A;  2JA7 C;  1I50 K;  2O5J A;  3PO3 K;  2FQT A;  3GTL A;  2YU9 K;  1XZQ B;  3GTM C;  1WCM A;  4KM8 A;  4LK0 A;  3HOW K;  5M5W K;  4KN4 A;  1Y1V A;  2ZFZ A;  4KAS A;  3GTG C;  4GZY A;  4M1X A;  3A8K A;  1PJ5 A;  3GTK A;  3H0G C;  3GTO K;  3ERE D;  2NVY K;  1YNN A;  4KAW X;  1WOS A;  4BLA A;  2GAG C;  2P5M A;  3I4N K;  1USM A;  1O25 A;  2A6E A;  3N0B A;  4KAT A;  3S1Q K;  4RMF A;  5CJ9 A;  3T02 A;  1VJE A;  1C0A A;  5JFE A;  3S1R K;  2E2I C;  4LK1 A;  1INN A;  3RZO K;  1IQ0 A;  4XLP A;  2WB1 D;  4PAA A;  4G0W A;  1ZVU A;  2JA5 K;  3DXJ A;  2VUM C;  2R92 C;  2R93 C;  4GTA A;  1V5V A;  3GTP K;  3FOE A;  1Y1W K;  3ORE A;  2R7Z K;  5E68 A;  3CQZ K;  4BBS K;  2PHC B;  1HQM A;  2JA7 K;  3Q3Q A;  1TWA C;  3CAG A;  4OIN A;  2D6F C;  1DD5 A;  1J6X A;  1USO A;  3GTM K;  1B4B A;  2R7Z A;  3S1N C;  3S2H C;  3GTG K;  1J6V A;  1XZP B;  2JA7 A;  3S2D C;  1WOO A;  1K83 C;  3H0G K;  4LR2 A;  3TTG A;  3S16 C;  3GEH A;  3RZD C;  4OIR A;  3GTQ C;  4LJZ A;  3GTM A;  1VGX A;  3TFH A;  3OPF A;  3FKI C;  2CFA A;  3GTG A;  3S14 C;  4FM9 A;  2E2J C;  4A3L C;  4A3D C;  2WB1 L;  3GTJ A;  3A8J A;  2E2I K;  2E2H A;  4BBR C;  4C3J C;  3HOY C;  2V6S A;  5IOR A;  1TWG C;  4G0U A;  5C3E C;  5JVO A;  3M4O C;  3T00 A;  1EFW A;  1O2B A;  4J3N A;  1L0W A;  2VUM K;  2R92 K;  2R93 K;  4JK1 A;  2E2I A;  4XCH A;  2NVX C;  2A69 A;  2PA8 D;  1JOE A;  1TWA K;  1PJ7 A;  4A3K C;  1BJT A;  2R92 A;  4WJ4 A;  5IOQ A;  4GTD A;  3V4G A;  1WQF A;  1IL2 A;  3S1N K;  3S2H K;  4A3M C;  1TWF K;  3S2D K;  1I3Q A;  1J6W A;  1TWA A;  4P5A A;  1K83 K;  3HOV C;  2GSO A;  3S16 K;  5M5X K;  3RZD K;  3GTQ K;  4DDQ A;  2B63 A;  4AYB D;  3GEE A;  1DCP A;  3FKI K;  4KMU A;  3H3V D;  1TWF A;  3S14 K;  4A3L K;  2E2J K;  3PO2 C;  1K83 A;  4A3D K;  5IOT A;  1TWC C;  3N3Y A;  2JA6 C;  3G4A A;  4C3J K;  3HOY K;  3LAJ A;  1BDF A;  4C3H C;  3FKI A;  3LPX A;  1TWG K;  1WOR A;  1I50 A;  5C3E K;  1AB4 A;  2PA8 L;  3M4O K;  3HOU C;  4C2M C;  5IP9 C;  2YU9 A;  1RU0 A;  1JVI A;  4XLN A;  2NVX K;  4A3C C;  3GDZ A;  4AH6 A;  3S15 C;  1O2A A;  2JA8 C;  3GTO A;  5M5Y K;  1O28 A;  4A3K K;  2NVY A;  2Y0S L;  4ZH4 A;  2V6T A;  3S17 C;  4BY7 C;  2GAH C;  4A3M K;  3L4J A;  3H3V L;  3HOV K;  1O24 A;  1IE0 A;  2FQO A;  1DCO A;  3HKZ D;  1PJ6 A;  3AH5 A;  3N0C A;  5C4J C;  1B4A A;  1EH1 A;  1J98 A;  1F7U A;  2JA5 A;  3PO2 K;  1TWC K;  3GTP A;  1O26 A;  4FZB A;  2JA6 K;  1YCL A;  3ADA C;  3SZY A;  1Y1W A;  2A68 A;  2NVT C;  1HI9 A;  3CQZ A;  5TJ3 A;  4C3H K;  1ISE A;  1ZQ1 C;  4LOW A;  4A3B C;  4KB2 A;  4C45 A;  3HOZ C;  3HOU K;  4C2M K;  5IP9 K;  1GE9 A;  3TFI A;  2ZUE A;  2JA6 A;  5M3F K;  4LQY A;  4A3I C;  4A3C K;  4X6A C;  3BUE A;  3S15 K;  1SFO C;  3A8I A;  2JA8 K;  3H0G A;  1WSR A;  1F9N A;  3AD9 C;  1X31 C;  3IPJ A;  1R9T C;  2PMZ D;  3BP3 A;  2CFA B;  3S17 K;  4Q4Z A;  3HKZ L;  4BY7 K;  3FOF A;  3GTL C;  4BY1 C;  4A3E C;  1WCM C;  4GTB A;  2O5I A;  4O2D A;  1Y1V C;  5C4J K;  3GTK C;  3K7A C;  4NOI A;  4BXX C;  4Y52 C;  5D4D A;  4GT9 A;  1ZYR A;  3VA7 A;  2VUM A;  5C44 C;  2R93 A;  4OIP A;  3NUH A;  4G7H A;  2NVT K;  4OIO A;  4YFK A;  4A3B K;  5HL8 A;  3HOZ K;  3GEI A;  1KQ4 A;  3I4M C;  4A3I K;  1JQW A;  2NVQ C;  4X6A K;  1TWH C;  2EBB A;  4C3I C;  1SFO K;  5M3M K;  1F7V A;  5IYC C;  5C4X C;  3GIR A;  1O2F B;  2GSU A;  3GTQ A;  2GSN A;  1R9T K;  4BBR K;  1I6V A;  3S1M C;  1I6H C;  5CHP A;  3JST A;  3GTL K;  4BLB A;  4BY1 K;  3T01 A;  4A3E K;  1WCM K;  1EK8 A;  1IW7 A;  3MML B;  1IS1 A;  1Y1V K;  1XXC A;  4MQ9 A;  1TWG A;  3GTK K;  3K7A K;  4BXX K;  4Y52 K;  3TFJ A;  4Y7N C;  5C44 K;  3BP8 C;  5IYD C;  4A3J C;  4MEY A;  2NVX A;  3AQP A;  4OIQ A;  1IBA A;  4AYB L;  2V6U A;  2CW0 A;  3GTJ C;  3HOX C;  2E2H C;  3OEP A;  2JH3 A;  4Q5S A;  1ZBS A;  4XSZ A;  1EQR A;  4A3F C;  3I4M K; 
#chains in the Genus database with same CATH homology
 3BUE A;  3G4C A;  3L4K A;  2XCR B;  2XCO A;  3GTL A;  3H0G A;  2R92 A;  1BJT A;  1F9N A;  5IOQ A;  4GTD A;  1WCM A;  3V4G A;  4KM8 A;  1WQF A;  2CFA B;  1Y1V A;  2ZFZ A;  4ILD A;  4KAS A;  4P5B A;  4M1X A;  3FOF A;  3LAP A;  3FHZ A;  1WIH A;  1TWH A;  3GTK A;  1I3Q A;  1TWA A;  4P5A A;  3ERE D;  2GSO A;  4GTB A;  4KAW X;  4BLA A;  1TWC A;  2P5M A;  4KAR A;  4DDQ A;  2B63 A;  1O25 A;  3N0B A;  4KAT A;  3AQO A;  2XCQ A;  1TWF A;  5CJ9 A;  5JFE A;  4KDD A;  4GT9 A;  1K83 A;  2KWA A;  5IOT A;  4GTC A;  3VA7 A;  3N3Y A;  2VUM A;  4BKW A;  2R93 A;  1O29 A;  3G4A A;  3NUH A;  4KMA A;  3LAJ A;  2RGR A;  4KB4 A;  4C3H C;  3FKI A;  3LPX A;  4GTL A;  4G0W A;  1ZVU A;  1I50 A;  5IOS A;  1AB4 A;  4C2M C;  2Y3P A;  4GFQ A;  4GTA A;  2YU9 A;  4G0V A;  3FOE A;  1XXB A;  1KQ4 A;  3ORE A;  2PHC B;  1WQG A;  1O2A A;  4KC6 A;  4C3I C;  3Q3Q A;  3QX3 A;  3CAG A;  3GTO A;  4GTE A;  1O28 A;  1DD5 A;  2NVY A;  1B4B A;  2GSU A;  3GTQ A;  2GSN A;  2R7Z A;  2JA7 A;  5CHP A;  3L4J A;  5EGE A;  4BLB A;  4LR2 A;  1O24 A;  1BGW A;  3GTM A;  1EK8 A;  3AH5 A;  3MML B;  1IS1 A;  3N0C A;  1XXC A;  3OPF A;  1B4A A;  1EH1 A;  1O27 A;  2CFA A;  3GTG A;  1ZXO A;  1TWG A;  4FM9 A;  4GTF A;  2JA5 A;  3GTJ A;  5EGH A;  4KMH A;  1O26 A;  2RH6 A;  4FZB A;  3GTP A;  3S0X A;  2E2H A;  4C3J C;  1Y1W A;  5IOR A;  2NVX A;  3AQP A;  5TJ3 A;  3CQZ A;  4G0U A;  1ISE A;  5JVO A;  4KMD A;  1WQH A;  1O2B A;  4KB2 A;  4J3N A;  1SFO A;  1GE9 A;  4KM9 A;  3OEP A;  2E2I A;  2JA6 A;  2JH3 A;  1ZBS A;  4LQY A;  1R9T A;  1XXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...