3N3YA

Crystal structure of thymidylate synthase x (thyx) from helicobacter pylori with fad and dump at 2.31a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
209
structure length
209
Chain Sequence
FMEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAREFLVFVDNEKVNAMSVLALENLRVLLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNLLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Structure, Enzymatic Characterization and Inhibitor Discovery of Thymidylate Synthase X (ThyX) from Helicobacter pylori Strain SS1
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 73
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n3yA00
4GTLA 1O2BA 3N3YA 5IOQA 1O28A 4GTFA 3G4CA 4GTDA 5IORA 3N0CA 3AH5A 4P5BA 1O24A 4KASA 1O27A 1O25A 4FZBA 4P5AA 2CFAA 4GTCA 5JFEA 5CHPA 1O26A 4KATA 5IOTA 1O29A 1O2AA 3N0BA 4GTAA 1KQ4A 4GTBA 4KARA 4GT9A 4GTEA 3G4AA 2CFAB 5IOSA
chains in the Genus database with same CATH superfamily
1I50K 4Y52C 3AD8C 3PO3K 1IW7A 1TWAK 2E2IA 4P5BA 4OIPA 3RZOC 4JK1A 1WCMA 1I3QK 3TFIA 3ERED 4G7HA 4X6AC 1BJTA 2R92A 2Y0SD 4KATA 3M4OC 3GTJC 3HOVK 4KM8A 4RMFA 1K83A 3K7AK 2WB1L 2BE5A 3GEIA 1X31C 1O2BA 1EQRA 5TMCA 3FKIK 1ZXOA 1I50C 2JH3A 3AH5A 3PO3C 1TWAC 2D6FC 4BXXK 1YNJA 4BY1K 2PMZD 5IYCK 1R9TA 2B63A 1O25A 3T02A 4P5AA 1I3QC 4MQ9A 1SFOA 4GTAA 4GTBA 4KARA 1F7VA 4YFXA 3ADAC 1L0WA 3HOVC 3A8JA 4ZH4A 2YU9A 3K7AC 1BS2A 3GTMA 5E68A 2FQTA 1WQFA 1ZVUA 4A3IK 2E2HK 1VH2A 1IL2A 1F7UA 4YFKA 2NVYA 2XCQA 4BXXC 4BY1C 5IYCC 3M3YK 1TWGK 2PMZL 2JA5A 1EH1A 1PJ7A 2W7VA 1XXCA 3GTGK 5M5XK 4LJZA 3GTLK 2XCOA 1YNNA 3GTOK 4KC6A 1TWCA 4M1XA 3OEPA 1J98A 4LR2A 4AH6A 3A8IA 4GTFA 4J3NA 2NVQK 4A3IC 3BP8C 2NVXK 2E2HC 3FOFA 3FHZA 3AQPA 2PA8L 4OIQA 3M3YC 1TWGC 4WJ3M 1EK8A 4XSXA 5IYBK 1WOSA 3GTGC 1SMYA 3GTLC 3SZZA 4GFQA 5FLMK 1XZQA 1IBAA 4KMHA 2NVQC 4KASA 1IQ0A 1Y1WK 1XXBA 2NVXC 3OPFA 4XSZA 4GTCA 1HI9A 5C44C 1O26A 2R7ZA 3FOEA 1I6VA 4GT9A 1TWHK 3HOYK 3S2HK 5IYBC 2VUMA 4O2DA 4KMDA 3GTPA 1Y1VA 3VA7A 4KMUA 3T00A 5FLMC 3GEEA 1WCMK 2JA7A 3S15K 1WQHA 2A69A 4A3KK 3HOZK 3H0GC 2CFAA 1Y1WC 4OIRA 4BBSK 1TWFK 5M5YK 1O2FB 3DXJA 2A6EA 1TWHC 3LAJA 3L4KA 1WORA 3HOYC 4GTLA 3S2HC 2PHCB 4WILA 3BP3A 1O28A 1RU0A 4KN4A 2KWAA 3GSIA 4OINA 1VLOA 4P9SA 1R9TK 4XLPA 2B63K 1WCMC 3S15C 3TFHA 3GTQA 4KAWX 3H3VD 2R93A 2FQOA 4A3KC 1O29A 1SFOK 3HOZC 3S1NK 2JA6A 4BBSC 4A3FK 1TWFC 2Y0SL 2WAQD 1JQWA 3HOUK 1K83C 3HOWK 2YU9K 3GTMK 5IOQA 3FKIA 1ZBSA 4PABA 4YFNA 3S16C 5M3FK 1HQMA 3QX3A 2O5IA 2V6TA 3PO2K 3A8KA 3MMLB 1WSVA 4QJVA 3RZDK 1XZQB 1XZPB 1O27A 3S0XA 3EQLA 1R9TC 2B63C 4KMAA 2JA5K 1J6XA 2NVTK 3S1NC 3H3VL 1SFOC 1DCHA 4A3FC 1BDFA 1ISEA 4C3IK 4PAAA 3HOUC 2WAQL 3WODA 3HOWC 2YU9C 3GTMC 2EBBA 5IP9K 4G0VA 1ZYRA 2E2HA 4BLBA 1BGWA 2CW0A 1F9NA 5D4DA 5FJ8K 3PO2C 4KN7A 5C44K 4WJ4A 4AYBD 3RZDC 5M3MK 5CJ9A 5TMFA 1KQ4A 2JA5C 4A93K 2CFAB 2NVTC 2P8TA 3GTOA 4A3DK 2A6HA 4C3IC 3TFJA 2GAGC 3LPXA 4Q5SA 1IS1A 1DCPA 5IP9C 3T01A 2JA8K 3I4MC 2NVXA 4A3JC 1WIHA 1USMA 4A3EK 1WOOA 3H0GK 1VRQC 3GTKA 1VJEA 1VGXA 2R7ZK 2P5MA 2ZFZA 3V4GA 1O2AA 3OREA 3CQZA 4AYBL 2E2JK 1IE0A 4A93C 4KB2A 2VUMK 4LOWA 5IP7K 4C2MK 3GTPK 3S14K 1Y1VK 1YCLA 4A3DC 4A3BK 1GE9A 4C3JK 5IORA 2E2IK 4XCHA 4G7ZA 2JA7K 4G0WA 1WSRA 2JA8C 4C45A 1I6HK 4FZBA 3S17K 4A3EC 1C0AA 2R92K 4KDDA 2WB1D 4YG2A 3L4JA 3GTJA 2R7ZC 3AD7C 4FM9A 3BUEA 1K83K 4MEXA 2E2JC 4A3GK 4XLNA 4C3HK 5C4XK 2VUMC 5IP7C 4C2MC 3GTPC 1I50A 3S16K 1B4AA 2PPBA 2ZUEA 3S14C 1Y1VC 1TWAA 2V6SA 3N0CA 1XXAA 1INNA 2V6UA 1PJ6A 4A3BC 4C3JC 1EFWA 3GEHA 2E2IC 4A3LK 3CAGA 1I3QA 2JA7C 3GTQK 4MEYA 4BBRK 2ZUFA 1I6HC 2R93K 1V5VA 1WOPA 2JA6K 3HKZD 3TTGA 1TWFA 3S17C 3N0BA 2R92C 3S1MK 3GDZA 4Y7NK 3JSTA 5HL8A 4Q4ZA 1G51A 4G7OA 4A3GC 4C3HC 3I4NK 1AB4A 5C4XC 3G4CA 4GTDA 4A3MK 1ZQ1C 3S1QK 2NVYK 2GSNA 1PJ5A 4LK0A 4LLGA 4A3LC 5CHPA 3GTQC 4A3CK 2O5JA 2XCRB 4BBRC 2R93C 2JA6C 4BLAA 3S1MC 3AQOA 3HKZL 2Y3PA 5EGEA 4Y7NC 1TWCK 3FKIC 3I4NC 1XPPA 1UV7A 1JOEA 3AD9C 3I4MK 4A3JK 1EI6A 4DDQA 4BY7K 4BKWA 2PA8D 5IYDK 4KB4A 1YX2A 4A3MC 4LK1A 3S1QC 2NVYC 1TWGA 1F93A 3HXAA 2RH6A 4A3CC 5M5WK 3GTGA 4QIWD 3GTLA 5TJ3A 1DCOA 5IOSA 3HOXK 1J6VA 5C4JK 2GSOA 1TWCC 4KM9A 5EGHA 2A68A 4OIOA 3S1RK 3GIRA 5L46A 3SZYA 4LQYA 4BY7C 3GTKK 5IYDC 5JFEA 3NUHA 5C3EK 4G0UA 3CQZK 4ILDA 3G4AA 3S2DK 1J6WA 3Q3QA 4Y52K 3N3YA 3GTOC 4QIWL 2GSUA 1DD5A 3HOXC 1XZPA 5C4JC 3RZOK 5JVOA 4NOIA 1WQGA 1JVIA 1O24A 3IPJA 3S1RC 4X6AK 2GAHC 3H0GA 1Y1WA 4GZYA 1USOA 3GTKC 5IOTA 2RGRA 3M4OK 3GTJK 4QJVB 5C3EC 4GTEA 1TWHA 3LAPA 3CQZC 1B4BA 3S2DC
chains in the Genus database with same CATH topology
4GFQA 4C3HC 1AB4A 4G0VA 2E2HA 3G4CA 4BLBA 1BGWA 4GTDA 2E2IA 1F9NA 4P5BA 4KMHA 4KASA 1WCMA 2GSNA 1XXBA 3ERED 1BJTA 3OPFA 2R92A 4GTCA 5CHPA 1O26A 4KATA 2R7ZA 5CJ9A 2XCRB 3FOEA 1KQ4A 4GT9A 4BLAA 2CFAB 4KM8A 3AQOA 1K83A 2Y3PA 5EGEA 3GTOA 2VUMA 1O2BA 4KMDA 3GTPA 4C3IC 1Y1VA 3VA7A 1ZXOA 3LPXA 1IS1A 2JH3A 3AH5A 4DDQA 2NVXA 1WIHA 4BKWA 2JA7A 4KB4A 1WQHA 1R9TA 2B63A 1O25A 3GTKA 4P5AA 2CFAA 2P5MA 1TWGA 2ZFZA 3V4GA 1O2AA 1SFOA 4GTAA 2RH6A 3OREA 4GTBA 4KARA 3CQZA 3GTGA 4KB2A 3GTLA 3LAJA 3L4KA 5TJ3A 5IOSA 4GTLA 2YU9A 3GTMA 2PHCB 2GSOA 1WQFA 1ZVUA 1O28A 4KM9A 5EGHA 1GE9A 5IORA 2KWAA 2NVYA 4G0WA 2XCQA 4LQYA 4FZBA 3GTQA 4KAWX 5JFEA 3NUHA 2R93A 2JA5A 1O29A 4KDDA 2JA6A 1EH1A 3L4JA 4G0UA 3GTJA 1XXCA 4FM9A 3BUEA 4ILDA 3G4AA 2XCOA 3Q3QA 4KC6A 1TWCA 3N3YA 4M1XA 5IOQA 2GSUA 3FKIA 1ZBSA 1DD5A 3OEPA 4C2MC 4LR2A 1I50A 1B4AA 4GTFA 5JVOA 4J3NA 1TWAA 1XXAA 1WQGA 3N0CA 3QX3A 4C3JC 1O24A 3MMLB 3CAGA 3H0GA 3FOFA 1O27A 1I3QA 1Y1WA 3S0XA 3FHZA 3AQPA 4KMAA 5IOTA 2RGRA 1TWFA 3N0BA 1EK8A 4GTEA 1TWHA 3LAPA 1B4BA 1ISEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTL A;  1O2B A;  3N3Y A;  5IOQ A;  1O28 A;  4GTF A;  3G4C A;  4GTD A;  5IOR A;  3N0C A;  3AH5 A;  4P5B A;  1O24 A;  4KAS A;  1O27 A;  1O25 A;  4FZB A;  4P5A A;  2CFA A;  4GTC A;  5JFE A;  5CHP A;  1O26 A;  4KAT A;  5IOT A;  1O29 A;  1O2A A;  3N0B A;  4GTA A;  1KQ4 A;  4GTB A;  4KAR A;  4GT9 A;  4GTE A;  3G4A A;  2CFA B;  5IOS A; 
#chains in the Genus database with same CATH topology
 1I50 K;  4Y52 C;  3AD8 C;  3PO3 K;  1IW7 A;  1TWA K;  2E2I A;  4P5B A;  4OIP A;  3RZO C;  4JK1 A;  1WCM A;  1I3Q K;  3TFI A;  3ERE D;  4G7H A;  4X6A C;  1BJT A;  2R92 A;  2Y0S D;  4KAT A;  3M4O C;  3GTJ C;  3HOV K;  4KM8 A;  4RMF A;  1K83 A;  3K7A K;  2WB1 L;  2BE5 A;  3GEI A;  1X31 C;  1O2B A;  1EQR A;  5TMC A;  3FKI K;  1ZXO A;  1I50 C;  2JH3 A;  3AH5 A;  3PO3 C;  1TWA C;  2D6F C;  4BXX K;  1YNJ A;  4BY1 K;  2PMZ D;  5IYC K;  1R9T A;  2B63 A;  1O25 A;  3T02 A;  4P5A A;  1I3Q C;  4MQ9 A;  1SFO A;  4GTA A;  4GTB A;  4KAR A;  1F7V A;  4YFX A;  3ADA C;  1L0W A;  3HOV C;  3A8J A;  4ZH4 A;  2YU9 A;  3K7A C;  1BS2 A;  3GTM A;  5E68 A;  2FQT A;  1WQF A;  1ZVU A;  4A3I K;  2E2H K;  1VH2 A;  1IL2 A;  1F7U A;  4YFK A;  2NVY A;  2XCQ A;  4BXX C;  4BY1 C;  5IYC C;  3M3Y K;  1TWG K;  2PMZ L;  2JA5 A;  1EH1 A;  1PJ7 A;  2W7V A;  1XXC A;  3GTG K;  5M5X K;  4LJZ A;  3GTL K;  2XCO A;  1YNN A;  3GTO K;  4KC6 A;  1TWC A;  4M1X A;  3OEP A;  1J98 A;  4LR2 A;  4AH6 A;  3A8I A;  4GTF A;  4J3N A;  2NVQ K;  4A3I C;  3BP8 C;  2NVX K;  2E2H C;  3FOF A;  3FHZ A;  3AQP A;  2PA8 L;  4OIQ A;  3M3Y C;  1TWG C;  4WJ3 M;  1EK8 A;  4XSX A;  5IYB K;  1WOS A;  3GTG C;  1SMY A;  3GTL C;  3SZZ A;  4GFQ A;  5FLM K;  1XZQ A;  1IBA A;  4KMH A;  2NVQ C;  4KAS A;  1IQ0 A;  1Y1W K;  1XXB A;  2NVX C;  3OPF A;  4XSZ A;  4GTC A;  1HI9 A;  5C44 C;  1O26 A;  2R7Z A;  3FOE A;  1I6V A;  4GT9 A;  1TWH K;  3HOY K;  3S2H K;  5IYB C;  2VUM A;  4O2D A;  4KMD A;  3GTP A;  1Y1V A;  3VA7 A;  4KMU A;  3T00 A;  5FLM C;  3GEE A;  1WCM K;  2JA7 A;  3S15 K;  1WQH A;  2A69 A;  4A3K K;  3HOZ K;  3H0G C;  2CFA A;  1Y1W C;  4OIR A;  4BBS K;  1TWF K;  5M5Y K;  1O2F B;  3DXJ A;  2A6E A;  1TWH C;  3LAJ A;  3L4K A;  1WOR A;  3HOY C;  4GTL A;  3S2H C;  2PHC B;  4WIL A;  3BP3 A;  1O28 A;  1RU0 A;  4KN4 A;  2KWA A;  3GSI A;  4OIN A;  1VLO A;  4P9S A;  1R9T K;  4XLP A;  2B63 K;  1WCM C;  3S15 C;  3TFH A;  3GTQ A;  4KAW X;  3H3V D;  2R93 A;  2FQO A;  4A3K C;  1O29 A;  1SFO K;  3HOZ C;  3S1N K;  2JA6 A;  4BBS C;  4A3F K;  1TWF C;  2Y0S L;  2WAQ D;  1JQW A;  3HOU K;  1K83 C;  3HOW K;  2YU9 K;  3GTM K;  5IOQ A;  3FKI A;  1ZBS A;  4PAB A;  4YFN A;  3S16 C;  5M3F K;  1HQM A;  3QX3 A;  2O5I A;  2V6T A;  3PO2 K;  3A8K A;  3MML B;  1WSV A;  4QJV A;  3RZD K;  1XZQ B;  1XZP B;  1O27 A;  3S0X A;  3EQL A;  1R9T C;  2B63 C;  4KMA A;  2JA5 K;  1J6X A;  2NVT K;  3S1N C;  3H3V L;  1SFO C;  1DCH A;  4A3F C;  1BDF A;  1ISE A;  4C3I K;  4PAA A;  3HOU C;  2WAQ L;  3WOD A;  3HOW C;  2YU9 C;  3GTM C;  2EBB A;  5IP9 K;  4G0V A;  1ZYR A;  2E2H A;  4BLB A;  1BGW A;  2CW0 A;  1F9N A;  5D4D A;  5FJ8 K;  3PO2 C;  4KN7 A;  5C44 K;  4WJ4 A;  4AYB D;  3RZD C;  5M3M K;  5CJ9 A;  5TMF A;  1KQ4 A;  2JA5 C;  4A93 K;  2CFA B;  2NVT C;  2P8T A;  3GTO A;  4A3D K;  2A6H A;  4C3I C;  3TFJ A;  2GAG C;  3LPX A;  4Q5S A;  1IS1 A;  1DCP A;  5IP9 C;  3T01 A;  2JA8 K;  3I4M C;  2NVX A;  4A3J C;  1WIH A;  1USM A;  4A3E K;  1WOO A;  3H0G K;  1VRQ C;  3GTK A;  1VJE A;  1VGX A;  2R7Z K;  2P5M A;  2ZFZ A;  3V4G A;  1O2A A;  3ORE A;  3CQZ A;  4AYB L;  2E2J K;  1IE0 A;  4A93 C;  4KB2 A;  2VUM K;  4LOW A;  5IP7 K;  4C2M K;  3GTP K;  3S14 K;  1Y1V K;  1YCL A;  4A3D C;  4A3B K;  1GE9 A;  4C3J K;  5IOR A;  2E2I K;  4XCH A;  4G7Z A;  2JA7 K;  4G0W A;  1WSR A;  2JA8 C;  4C45 A;  1I6H K;  4FZB A;  3S17 K;  4A3E C;  1C0A A;  2R92 K;  4KDD A;  2WB1 D;  4YG2 A;  3L4J A;  3GTJ A;  2R7Z C;  3AD7 C;  4FM9 A;  3BUE A;  1K83 K;  4MEX A;  2E2J C;  4A3G K;  4XLN A;  4C3H K;  5C4X K;  2VUM C;  5IP7 C;  4C2M C;  3GTP C;  1I50 A;  3S16 K;  1B4A A;  2PPB A;  2ZUE A;  3S14 C;  1Y1V C;  1TWA A;  2V6S A;  3N0C A;  1XXA A;  1INN A;  2V6U A;  1PJ6 A;  4A3B C;  4C3J C;  1EFW A;  3GEH A;  2E2I C;  4A3L K;  3CAG A;  1I3Q A;  2JA7 C;  3GTQ K;  4MEY A;  4BBR K;  2ZUF A;  1I6H C;  2R93 K;  1V5V A;  1WOP A;  2JA6 K;  3HKZ D;  3TTG A;  1TWF A;  3S17 C;  3N0B A;  2R92 C;  3S1M K;  3GDZ A;  4Y7N K;  3JST A;  5HL8 A;  4Q4Z A;  1G51 A;  4G7O A;  4A3G C;  4C3H C;  3I4N K;  1AB4 A;  5C4X C;  3G4C A;  4GTD A;  4A3M K;  1ZQ1 C;  3S1Q K;  2NVY K;  2GSN A;  1PJ5 A;  4LK0 A;  4LLG A;  4A3L C;  5CHP A;  3GTQ C;  4A3C K;  2O5J A;  2XCR B;  4BBR C;  2R93 C;  2JA6 C;  4BLA A;  3S1M C;  3AQO A;  3HKZ L;  2Y3P A;  5EGE A;  4Y7N C;  1TWC K;  3FKI C;  3I4N C;  1XPP A;  1UV7 A;  1JOE A;  3AD9 C;  3I4M K;  4A3J K;  1EI6 A;  4DDQ A;  4BY7 K;  4BKW A;  2PA8 D;  5IYD K;  4KB4 A;  1YX2 A;  4A3M C;  4LK1 A;  3S1Q C;  2NVY C;  1TWG A;  1F93 A;  3HXA A;  2RH6 A;  4A3C C;  5M5W K;  3GTG A;  4QIW D;  3GTL A;  5TJ3 A;  1DCO A;  5IOS A;  3HOX K;  1J6V A;  5C4J K;  2GSO A;  1TWC C;  4KM9 A;  5EGH A;  2A68 A;  4OIO A;  3S1R K;  3GIR A;  5L46 A;  3SZY A;  4LQY A;  4BY7 C;  3GTK K;  5IYD C;  5JFE A;  3NUH A;  5C3E K;  4G0U A;  3CQZ K;  4ILD A;  3G4A A;  3S2D K;  1J6W A;  3Q3Q A;  4Y52 K;  3N3Y A;  3GTO C;  4QIW L;  2GSU A;  1DD5 A;  3HOX C;  1XZP A;  5C4J C;  3RZO K;  5JVO A;  4NOI A;  1WQG A;  1JVI A;  1O24 A;  3IPJ A;  3S1R C;  4X6A K;  2GAH C;  3H0G A;  1Y1W A;  4GZY A;  1USO A;  3GTK C;  5IOT A;  2RGR A;  3M4O K;  3GTJ K;  4QJV B;  5C3E C;  4GTE A;  1TWH A;  3LAP A;  3CQZ C;  1B4B A;  3S2D C; 
#chains in the Genus database with same CATH homology
 4GFQ A;  4C3H C;  1AB4 A;  4G0V A;  2E2H A;  3G4C A;  4BLB A;  1BGW A;  4GTD A;  2E2I A;  1F9N A;  4P5B A;  4KMH A;  4KAS A;  1WCM A;  2GSN A;  1XXB A;  3ERE D;  1BJT A;  3OPF A;  2R92 A;  4GTC A;  5CHP A;  1O26 A;  4KAT A;  2R7Z A;  5CJ9 A;  2XCR B;  3FOE A;  1KQ4 A;  4GT9 A;  4BLA A;  2CFA B;  4KM8 A;  3AQO A;  1K83 A;  2Y3P A;  5EGE A;  3GTO A;  2VUM A;  1O2B A;  4KMD A;  3GTP A;  4C3I C;  1Y1V A;  3VA7 A;  1ZXO A;  3LPX A;  1IS1 A;  2JH3 A;  3AH5 A;  4DDQ A;  2NVX A;  1WIH A;  4BKW A;  2JA7 A;  4KB4 A;  1WQH A;  1R9T A;  2B63 A;  1O25 A;  3GTK A;  4P5A A;  2CFA A;  2P5M A;  1TWG A;  2ZFZ A;  3V4G A;  1O2A A;  1SFO A;  4GTA A;  2RH6 A;  3ORE A;  4GTB A;  4KAR A;  3CQZ A;  3GTG A;  4KB2 A;  3GTL A;  3LAJ A;  3L4K A;  5TJ3 A;  5IOS A;  4GTL A;  2YU9 A;  3GTM A;  2PHC B;  2GSO A;  1WQF A;  1ZVU A;  1O28 A;  4KM9 A;  5EGH A;  1GE9 A;  5IOR A;  2KWA A;  2NVY A;  4G0W A;  2XCQ A;  4LQY A;  4FZB A;  3GTQ A;  4KAW X;  5JFE A;  3NUH A;  2R93 A;  2JA5 A;  1O29 A;  4KDD A;  2JA6 A;  1EH1 A;  3L4J A;  4G0U A;  3GTJ A;  1XXC A;  4FM9 A;  3BUE A;  4ILD A;  3G4A A;  2XCO A;  3Q3Q A;  4KC6 A;  1TWC A;  3N3Y A;  4M1X A;  5IOQ A;  2GSU A;  3FKI A;  1ZBS A;  1DD5 A;  3OEP A;  4C2M C;  4LR2 A;  1I50 A;  1B4A A;  4GTF A;  5JVO A;  4J3N A;  1TWA A;  1XXA A;  1WQG A;  3N0C A;  3QX3 A;  4C3J C;  1O24 A;  3MML B;  3CAG A;  3H0G A;  3FOF A;  1O27 A;  1I3Q A;  1Y1W A;  3S0X A;  3FHZ A;  3AQP A;  4KMA A;  5IOT A;  2RGR A;  1TWF A;  3N0B A;  1EK8 A;  4GTE A;  1TWH A;  3LAP A;  1B4B A;  1ISE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...