1VRQC

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
total genus 50
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1vrqC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1vrqC01
1WOSA 3TTGA 1VRQC 1WOPA 3GEEA 3AD8C 3ADAC 1XZQB 3A8JA 1XZPB 1VLOA 3A8KA 1XZPA 3GEIA 5L46A 2GAHC 1WORA 1WSRA 1X31C 2GAGC 3TFHA 3GEHA 1WOOA 1PJ6A 4PABA 3TFIA 3AD7C 4P9SA 1PJ7A 3GIRA 1V5VA 4PAAA 3TFJA 1YX2A 3GSIA 1XZQA 1PJ5A 3A8IA 3AD9C 1WSVA
chains in the Genus database with same CATH superfamily
1G6BA 3N79A 3MCNA 1HPZB 2H54B 5J2PB 5H1SV 4DDQA 3W60A 4GZYA 4JI0F 4DHVA 2GZOA 2V2VA 3M8QB 4MIBA 4J9SA 3U1LA 3AD9C 3JXOA 1TWHC 4NEYA 3CDAA 2CPIA 4KO0B 2CQDA 2XTJP 1SBRA 2Z2ZA 2IA0A 4DL7A 2G13A 3RRHA 3RGIA 3UCGA 4A8MP 3HSJA 3R5JB 5JUMA 1UVLA 1URNA 2GHPA 1M5HA 4KV8A 5LSOA 3GV7B 2HRYA 4EEYA 1S9EB 4OIOA 1K44A 3QYYA 2UXBF 2CQ2A 2HGNA 3AQPA 3QZ7A 5EUHA 5IT0A 4IKAA 3PVXA 2I2YA 2J0SD 1HYSA 2D7SA 4FVCA 3DLHA 4CLTA 1LQ9A 4L75A 4ED4A 2FTRA 2UUTA 1BUXA 4H4KA 5AJ3F 1IM6A 2Y1JA 5L9XA 1RXOB 3P96A 1M5KC 3UNYA 3NS7B 1SC3B 3FK4A 1QSLA 3OPFA 5C7PA 4B9MA 2ZD1A 2VG5A 4DV5F 4F02A 1ELOA 4WFAQ 4CTAA 2E2HC 4ZVGA 3PX0A 3EUNA 1SC1B 4I7FB 5F8GA 2IC3A 3MUMP 2NXCA 2YNHB 1RT7A 6FDRA 4NCGB 4CLYA 3CMAS 4RUAA 5IYCC 2FGCA 2GSNA 4AL6A 5KAKA 2E1MC 3OR1B 2BE2B 1RGVA 1GMVA 2W2QP 1S9EA 2VH7A 4OHVA 3EICA 3CE8A 4WP9A 3IAS9 4OMFG 1ZH5A 3BBBA 1Q8IA 1R6YA 3DU5A 3G8SA 1RT6B 2HWHA 1O2AA 1U1QA 5DZ7A 1YRUA 3PW7A 3FKIC 1KBRA 2XO6A 1AT1B 3BGUA 2RIJA 2AEMA 1Y3KA 2V67A 1HBOB 4U96A 4XPEA 1Y3JA 2ATCB 1HI8A 1U4BA 1PSDA 2VUMK 4MK8A 4PXBA 3TUPA 1ZA2B 2AIRB 3D5MA 4C8YA 2AEFA 1HBMB 5D0EA 2DITA 4OI1A 5CCMA 5F9NA 1RTDB 3OFEA 4GO5X 1E6YA 5A8RA 3NGSA 4N56A 2JJ4D 4TNOA 3JQJA 2CWKA 4DV2F 3POTA 2N3OA 4C9DA 2XMAA 5J2MB 4G1IA 3HHLA 2H65B 2N4DA 1XIQA 4DV6J 4CO5A 1LWCB 1UVNA 2MKYA 4ILMA 3MF5A 1Q7YT 3KNAA 4WP8A 2B63A 4CO2A 2AJ2A 4R5PB 2BEFA 1KOHA 2JA5C 1O5JA 2Q66A 5DLFA 2PPBA 2YWHA 3BKFA 3HVAA 5MLCV 1N32J 3GG1A 3DRRB 4X64J 4TLQA 4AUKA 4WWSA 2QGFB 4JI3J 3TAQA 1KC8T 3GZ7A 4JI1F 4LSLB 2HHHJ 5KFJA 2A1BA 3MUVP 2Z57B 3T01A 1M90T 3JTNA 1HPZA 4I68A 2FYXA 1SIZA 4DX6A 2EC2A 3CMES 4DSKA 2CQ1A 2RT3A 1ZPVA 2ZJPQ 1U7LA 5C4JK 4OL8A 1OQ3A 1D3WA 3BKTA 5AJ3J 1EAYC 2RILA 1BJTA 2GJIA 1MU2A 1LOUA 2E1AA 1U09A 4BXXC 3PX4A 2W25A 3NKYA 4DR2J 4ED3A 3GTLC 3QT6A 3QWUA 1NZAA 2M52A 1R7IA 2JLGA 4H4MA 5D4DA 2F4VJ 1RTHA 2FHKA 2W9BA 3HOUK 5K8NA 2W24A 2IFXA 3KNGA 2QSWA 3PW0A 1FKAF 4QIEA 5I3PA 2RF2B 3KHHA 5TJ3A 2JX2A 3UNGC 2A6HA 5GAEI 1O29A 4HTIA 4DI6A 3SDEB 3R2CJ 4NA1A 3RR7A 5DS7A 3W65A 3L7OA 2KWAA 5HLFA 1CBKA 1TUGB 1EETB 4QBUA 4DR1J 4P2SA 2BX6A 4UQTA 1IL2A 1TL7B 2HHQA 1NSPA 3GFZA 5F8NA 4P75A 4Q43A 2VDHA 3IPJA 5KFWA 3I5CA 3C2PA 4WK1A 3UD3P 3AXKA 3H7HB 3HP6A 2OD6A 2MKKA 3S1MC 3HJVA 1TWHK 2RQMA 2ZOGA 2YQ0A 1DY3A 4O2DA 4BLAA 1S0NA 2OSRA 5C24A 3IS9B 2Z2MA 3AA8A 3M2RA 1GX5A 4WFNQ 5M5WK 3H40A 2FC8A 3QJJA 2CUYA 3AFGA 3NNCA 3BYPA 3W7BA 4K4TA 2NVQC 3GTOA 3T6JA 3SCLE 4LSNA 3DRPB 3HLUA 5F3TA 4DL4A 3GJQB 2NVYA 3WX8A 1S6PB 3EWGA 1DQAA 2RKIB 3ZZ0A 2PMZD 1TL1B 3M4XA 3RZDC 3RRKA 2WONA 3B4DA 1EP4B 3PACA 1JX4A 2QTWA 1HNWJ 1RWMB 5KFGA 3AY0A 3ITHA 1R43A 3RBDA 4QIWL 4IRDA 4FBTA 2A2CA 4CO0A 2YTCA 5E33A 4ZIVA 4USMA 3T19A 1DURA 4Q8FA 4FDFA 4WZQA 1X5OA 4HDGA 3M8SA 3PCOB 1CVJA 3TFIA 1T3OA 2WAQD 3KLGA 2A6EA 3I4HX 3TO8A 3DGPB 3AH5A 1HQ2A 2V34A 1RDRA 3IMQJ 2I6WA 4KPYA 5SUHA 4RUCA 1USMA 3MEGA 1JLGB 4MQ9A 3M9MB 3SQOP 3JSTA 5LMUF 1CJTA 1PKUA 4LF8J 4C3HK 2B9XA 4ENOA 2FHMA 5IZHA 3W3SA 4O3PA 4C8LA 3AOBA 4X84A 2VICA 3VAKA 2UUBF 1WWHA 1RLDA 3UN2A 4ZJQA 2WSEC 1B3TA 2W7OA 4I6YA 2MGZA 4YY3J 2JEFA 4LF1A 1X9WA 1SJ3P 2MQLA 2JVOA 4C8OA 1VRTB 3GFHA 3NCQA 5HQLA 1PIEA 1YJVA 4Q7AA 4P72A 5DDPC 4KHMA 4DSIA 2BKNA 2OMLA 2BRKA 3ZTRA 2JFKA 4P2MA 1JJ2R 2E9RX 3L3CA 3TA0A 4MT1A 4JI7J 4DPYA 1S6QB 5E41A 5FIIA 2ALYB 2F8HA 2KVIA 3WDOA 2XCQA 4RMFA 2W7PA 1J5EJ 2IRXA 1EHWA 3Q8PB 5M5YK 7AT1B 5IS2A 2R8KA 4KM8A 4OZ2A 4R25A 2DT9A 4OZJA 1IN0A 1IBMF 2HAFA 4OHYA 2YNIB 4ZLLA 4CH7A 1RHJB 4B02A 1XZQA 2HVHA 3CCSS 4I56A 1S77D 3DRSB 4DLEA 4TY9A 1ZBSA 4W98A 5BYRA 4OI6A 5C5JA 3FFIB 3GDZA 2EFQA 3LP0B 1WHWA 5IQ6A 4ZCMA 4PRFA 3ISNC 2RRNA 3KG1A 1U24A 5DQIA 3O1LA 4PG8A 1INNA 4BBSC 3I9ZA 2DJWA 3HPOA 1TKDA 3O2IA 3UD4P 2PEBA 3DOLB 2HG4A 3MURP 1F7UA 1FKOA 1VFJA 3OFFA 4ETZA 4X4OA 3E8OA 2Z2LA 2PMHA 3GTLA 3CGIA 3LGNA 4U95A 3H5UA 4M1XA 2GVDA 4NL5A 2X1AA 2YXLA 4LIRA 3FCHA 4OFZA 2YWGA 2Q43A 1WJ9A 2WVFA 2IVYA 5E3RA 3N0BA 4KY3A 4IR1A 2RQKA 4FXVA 5M5XK 4J9NA 4BBYA 4ERDA 1J2VA 4ZS6A 4USUA 4DPWA 2R92C 2E5JA 4HYKA 2HNZB 2KG0A 1IJEB 2MHNA 3OTEA 3TAMB 2WW8A 4X4PA 3SCJE 3ZZZA 3NGDA 1Y7PA 2DH7A 4L73A 2HVZA 2NXNA 1DLOA 2XI3A 5EX3A 2XLIA 4Y7NC 3I31A 2J9DE 1NM2A 3NNHA 5KFDA 1FVSA 3C66A 2QL9B 3UDVA 1T8EA 1HNVA 1P9QC 4JYAF 2R92K 1M5VC 3N6LA 3KXDA 3VQTA 1VQ4S 4KMHA 3I32A 3WQPA 2MXYA 3HZEA 3H4BA 4USHA 4CIOA 2R7XA 4NYZA 2JLFA 2GHWA 2UVRA 2VBXA 5F0WA 4LF5J 4K5SA 1K8AT 2NPFA 4CLUA 4LF9J 2VQFJ 5HMWA 4LF7J 4OYOA 4TKTA 4OYMA 5KT2A 1RA7A 2X7IA 4NZ7A 2BV3A 2DYAA 2DNNA 3V5RA 4C8NA 3BP3A 1IKVA 1DRZA 3S2HK 4QWEA 3ZO7A 4DV4F 2B8PA 3MXHP 5CAAA 2C2OB 3GTGK 4GTEA 3C3LA 1JJ4A 3W8PA 5KFOA 4CYUA 4X2BA 1RHQB 3N3YA 1S57A 3ILJA 4LFCF 4USWA 1VI7A 3NGUA 3RZOK 4X4QA 3JS9A 4DFKA 5ETPA 4BLGA 4CH1A 4NA2A 1FFSB 4R8UB 1IBKJ 4ZP7A 1FT8A 2V4JA 5A0YA 2X1GA 2IIHA 2HFUA 4B17A 1N33J 4CT9A 2AJ1A 4PG6A 4C3IC 4GFQA 1IXKA 3MPYA 1RABB 3FQKA 4LQ9A 3S1MK 5J2MA 2KXHA 2JA6K 2AF6A 5GVQA 2EC0A 1S1UB 4ECXA 5B08A 1TWAK 2RQ4A 4PR6A 4DV5J 2E9TA 2CFAA 1DZ5A 5HROB 2DR6A 2HGMA 3JSBA 2JA5A 4N76A 3OV7A 2IYIA 4HTJA 4CO1A 3QATA 2YNGA 1AROP 4DUYJ 4N47A 1CS4A 3RBXA 4FYXB 1NMEB 3K5PA 4WJ4A 1GMWD 1YVFA 4HH0A 2VG6B 2FLPA 3GIKA 3ILLA 2GAHC 4HLBA 2HHXA 2RH6A 3CCES 2YKPA 1N34J 1HI0P 3TRGA 3GIRA 5B0DA 3HJFA 1HWUA 4DPUA 2CQ4A 2YNHA 5IT4A 2VKZG 5DM7Q 1Q53A 4NLPA 4XLPA 4DR5F 2DGXA 5A2QY 3NMRA 4CYUB 2CG4A 5K5MA 3BGFA 5CYQB 3DOMA 2UU9J 2B9WA 4WYWA 3M8PA 1G7CB 3ZZOA 3UR0A 3MM9A 1LXJA 3PW4A 1NDKA 2DIVA 3ENWA 1VC6A 2CPDA 4B9TA 2RS2A 1JLBB 2EK1A 2YU9C 4ECTA 4UY8T 2FD2A 4C7QA 3DGPA 4D3GA 4N8NA 2IMWP 1FDAA 3PFOA 1SL1A 1RKIA 3PRDA 1WKJA 4KIAA 1RT1B 2KKHA 2RSQA 1VBZA 5J2NA 3DM2B 4ZVTB 2IM0A 1Y9OA 1ZPWX 4DX8H 3NWGA 3QAUA 2ZHBA 4HVZA 1XR6A 3PNIA 4O0IA 1HNXJ 3QZ8A 2YY3A 2JZ5A 4USTA 2XSJA 5KT5A 1OS5A 4Y52K 1V5VA 2XMJA 4ED1A 1L3UA 3QAEA 4ZVOB 4X6AC 2DGOA 2FJXA 1S10A 4GTAA 1IWGA 4YP3A 1FDBA 2PDAA 1Y5IB 4KGKA 5JFEA 3RAXA 2YPYA 2BE5A 3KMSA 2GJ2A 1YZ7A 1RJJA 4KB2A 4WFZA 1N36J 5CYJA 2ZWOA 4F8RA 3ENQA 3SBMA 3E2EA 5DQGA 4TYAA 4JK1A 4X64F 5IM0B 1BY9A 4JI3F 4YHHJ 2OKQA 2HLUA 2VG6A 4WZMA 1Q79A 3I4NK 2J0QD 4C11B 1RQ0A 1DQ9A 3D6FB 4KC5A 3BQ1A 2L9DA 2ZBCA 2B5JB 2VBYA 4OYAA 2Z30B 9RUBA 3AA9A 4DSLA 4ED6A 3H0GK 2N7CA 5ETOA 2GQ2A 4ZPVR 3OHBA 1WC6A 3EYZA 1J5OA 3HVTB 4LQYA 1VMBA 2APOA 1MWZA 3ENVA 3FBBA 3A8JA 4A3FC 2MZTA 3J7YI 4NI2A 2M70A 2Q3PA 1N52B 2DGTA 1C0AA 4I2QB 1SKUB 2NVTK 1KQFB 4DCOB 2OH2A 3I56S 4CP5A 4DUYF 1YITS 4ICLA 3H0GC 3KLHB 4YFNA 2YX7A 4ES1A 2KHCA 1H3DA 2GO8A 4B3OA 2ZDOA 5G0RB 2OTJS 2BJEA 1TWAA 2DK2A 2LQJA 2COLA 3KDOA 5GADI 3QO9A 2W8LA 4Q45A 3GPAA 2JHEA 3D68A 5GMKa 3NCPA 4H4MB 2NQPA 3A3OB 1S1XA 1B70B 2IVFB 2ROEA 3W2VA 4DPXA 1LWXA 3AQOA 3MUTP 2ROPA 4NCAA 2ZJRQ 4C0HA 4LRDA 4DR5J 4F2SA 1JQWA 4J9VA 4J5OA 3S1NC 4FKXA 3R5CA 1FX2A 1HR0J 1Y0HA 3N5BA 1RWWB 1L3TA 2FY1A 3KLIB 1NK5A 3ZFVA 3G8QA 3UD5A 5D77A 3W66A 1X4HA 4U8YA 1HQMA 3Q22A 1GTHA 4C8ZA 2BZ2A 3QIPA 1RACB 3HXMA 3UPFA 5KG1A 2PI4A 4NZ6A 4ID5B 3C6TB 1LK7A 1XWLA 5HL7Q 5KFIA 1YZ6A 3GIMA 5CYMA 1PG5B 2CFAB 3VGVA 3PZPA 2OGUA 1Q7LB 4EZ6A 2YH1A 2AZ1A 3HOUC 1X5PA 3DRXA 1S48A 5CD4A 3MCMA 2MZSA 3BGOP 4RW9B 4M95A 1VLOA 4M5HA 2AU0A 2ZUFA 2FLOA 3OXFA 4UTGA 3CPWR 4B3MJ 3KFWX 1NDCA 3RAMA 3N28A 2NS1B 2NSBA 1O6XA 2KB2A 3CCRS 3LH2S 1RHMB 5KT7A 4FKYA 1NKEA 5KG6A 4K4VA 2CIMA 4QJVA 5H9EK 1XNRF 3D9BA 3MR3A 3HOZK 5LSLA 3TX0A 2POKA 5CCLA 1XK8A 1RU0A 1M5OC 1F9FA 3D54A 1NBEB 4MH8A 2LDYA 3CCLS 1G1XA 2X3GA 3CEDA 2MQQA 2CQBA 2Y0BB 4MEXA 3DU6A 4W4MA 4GRSA 1RTDA 2L3MA 1SH3A 1KKHA 3X3UA 5HBMA 2CJQA 2BMBA 1KVKA 1EETA 3P5BP 2NXJA 1FTRA 4DV2J 3HOZC 2G1DA 2GVZB 3FRYA 2ASJA 3M6VA 3VV2B 2E66A 4G1PA 5EWEA 2XY7A 2KZMA 2FC9A 3BEGB 2WVBA 7FDRA 4LREA 3P6YC 2VOOA 4DBQA 5A76A 4DU8A 4ECVA 1EQ0A 5K9FA 1H6KX 4K4YA 4URGA 4A3KK 3FQLA 1F3VA 1R0CB 2KRRA 2HS3A 4K4ZA 1TAUA 4EO8A 2JLEA 1CJKB 3NAIA 4ZCLA 1TWGK 1NK7A 4DX5A 4WFYA 4ILDA 4C97A 3GTPK 4NCGA 3PKYA 1QTNB 5ETTA 3LP2A 3DRRA 3BF4A 2OJ3A 2HVIA 3BV8A 3TQ1A 1HMVA 4G1QB 4JI8F 2CG8A 4F3OA 1SJQA 3IBFB 2YWKA 3BGLA 5DJBA 3ZZRA 4ZVQB 5B09A 3NBPA 5A6WA 3LQVA 3BO3A 5GAGI 4IUFA 4Z37A 1R8CA 3PR4A 5I3QA 4Y52C 1U2FA 4X65J 2PFDA 4YDDB 4NRUA 2PI5A 3HT0A 4X6AK 1WELA 1HFEL 4KHRA 1KFDA 5FLXU 2CPHA 4M94A 2CZVC 1TMJA 3V4MA 4RW7A 1FO1A 2GAGC 1BMQB 2ILYA 2YKNA 1X0FA 3SSSA 1MN7A 1R89A 1PJ7A 1M5SA 4C8MA 4WXOA 4S0MA 1AZSB 3KG4A 1D8ZA 2V9KA 2HFOA 3MI7X 3FOEA 3PFEA 2W2MP 3DLKB 4DR3F 4RWWA 2J9DA 4Q2LA 3SCKE 4OLOA 1XXCA 3D3BJ 1SJFA 1OSDA 4MK7A 3ET6A 3LP2B 4FS1A 1NK0A 3D0IE 4YUDA 4C11A 2XSFA 3ITHB 4RW6A 3AB2B 3V6DA 5IOTA 2ZZTA 2P6SA 1XMOJ 3UQSA 1KEKA 2VPZB 4XPCA 5IQQA 4DG1A 5EHHA 2D69A 1VH2A 4K59A 3B6BA 3E51A 4EUVA 4J9UE 2V6AA 5K8MA 1O25A 1UTAA 4RPFA 1WSVA 5J1EA 4OYWA 4XO0A 5IYDC 1UETA 4KR0B 2P5VA 3AXMA 4DFMA 3KHGA 4Q8EA 2H9ZA 3CIZA 2K2PA 4PG4A 1Y11A 3FC9A 2CQ3A 1WHXA 4MAKA 1KFSA 4HI2A 4MKBA 3U1MA 2EFPA 2JA7K 1R0AB 3GTPA 1KWMA 1PCAA 1KRPA 4Y2MA 3D28A 2C3PA 5FJ8K 5K8OA 4DQIA 2IVMA 2AQ4A 4YR0A 2EBEA 4GTBA 2OP5A 2G4BA 1S1TB 3G6VA 5T41A 2FJVA 5CYQA 1XQIA 4KQZA 4DPOA 2OPSA 3OVSA 3TVZA 2WVEA 3GTQA 4U7UK 1FHTA 1AFJA 1RBAA 4UOFA 2ABYA 2XNQA 1YG0A 1ULRA 1RADB 4FM9A 1FI4A 1TUVA 4M5MA 1QSSA 3TJAA 2V50A 3Q0AA 4DV3F 4KASA 5IWAF 1G3OA 3CCZA 3NGKA 3ERED 1TWFK 2MY7A 1BLUA 4JI2F 2ZH2A 1WIHA 3MMJA 2ZH9A 3S7RA 2DGVA 2FGOA 1UP1A 3ZZYA 3DXBA 1WKLA 3KUEA 1SI9A 2JC1A 3PHTA 1VQSA 3GU0A 3OTCA 2VPYB 1KVJA 3J7Z5 2DEIA 1ZM2A 3K7AK 5KFEA 4KB4A 2Z8QA 1LXNA 4N77A 4WYLA 2Y3PA 3V6HA 4DR6F 4OZ5A 3DLLQ 4KHPJ 2KT2A 5D3GB 2WBMA 2FJEB 4A8FA 1YCLA 4Y2KA 2J9CA 3I5AA 3JAMU 2UVVA 4B3RJ 2RF2A 1LK5A 2AZ3A 1R3NA 2V4JB 2UUBJ 4ITSA 1OPIA 3K7AC 4ZCKA 1JK9B 3MM7B 3Q8SB 2G0JA 2UVUA 5FLMK 3FCWA 2CNKB 1FKPB 2WONB 3GMGA 3EE3A 1S97A 4TY8B 4ES2A 1S49A 5HP1B 3H3VD 4A3BC 1KTVA 3OVAA 1HNXF 2UUCJ 4M5IA 4NLVA 2HAIA 2I0XA 2W7VA 4LK0A 1N48A 2VG7A 4ZVRB 3TEGA 1H0HB 2OPSB 2HQCA 1KS2A 3DMJB 2ACYA 5HN0A 3FUYA 3RUBL 1TV6B 3OEPA 4O3RA 3BZQA 4FZVA 5KFFA 4IG3B 1QDUB 4DN9A 3T02A 3VCDA 1HWJA 2CQGA 3JSMB 2WSCC 1SV5B 4K2JA 2DXDA 2CVEA 4I69A 2LXFA 3DOLA 3CCMS 1WCMC 2KT5A 1Q4RA 2NVYK 2DVIA 1T0TV 3IM9A 2JOQA 3GONA 1HHTP 3OREA 2EBBA 1RA6A 2C3YA 3PO4A 2PO4A 1KOOA 1I6HK 3HSGA 5BR8F 1VQ9S 2A6OA 2XMKA 1ROFA 4C8KA 5LMNF 4RZRA 2RB7A 4ZH4A 1FKPA 1UPPA 2R42A 5E3PA 4QYZK 3HXAA 5DRKA 3W64A 4K4SA 3S8SA 2WB1L 4ZLJA 2GQQA 5HP1A 3JSYA 3G4CA 1PAUB 1F9NA 2OTLS 5A2QU 1HWLA 4ZJOA 2XSJB 1I6HC 3RBEA 3ZZTA 1U0HA 1YBTA 2JVRA 2MZQA 4MIAA 3PYEA 2CNOB 4QR1A 3GTJA 2GMLA 4UOHA 2ZH4A 2KFZA 4DSFA 3LW5C 3J81U 2VBWA 2FLNA 2WVDA 3G6XA 2EBGA 2B4OA 1XNQF 3HKZL 3HCXA 2MQPA 4NXNF 4BY7K 3GR0A 3HOYK 4P71A 2OEMA 1RT7B 3G4AA 2C2NA 1JJCB 1X31C 1SVDA 3M32B 1VRTA 3S1RC 3C15A 5CJ9A 1YJUA 3Q83A 4J9MA 4FXDA 1K1SA 4UW2A 2QMUB 4JV5F 1YBAA 2AYBA 4ZMMA 4RNFA 1LEOA 4A8WA 2WCXA 4A48A 1VYAA 3I96A 1TWFA 3QT8A 2F1FA 1UPMB 2D9OA 1E6VB 1SPBP 3IR6B 3FBFA 3MCSA 3K5OA 1N4LA 1HKAA 4KC6A 3C6UB 1VOMA 1U02A 3TA1A 4KGMA 5I42B 1HNZF 2O66A 3LWMA 3QFWA 3NL0A 3M9NB 3QRRA 1WDDA 2CDRB 3BGRB 2W4CA 3G71S 2PSZA 4GKKJ 4A3CC 1D09B 1JLFB 4XDCA 2VHGA 1HMVB 2OEJA 2E1RA 2B9EA 5BYSA 4WKRA 3W8GA 2MKJA 1RZMA 2AJQA 3VF0B 1A6LA 1NJXA 4LRAA 3G96A 2K8GA 2UUCF 4XAKA 1WC4A 1PYSB 4IO9Q 4D3HA 2B9YA 1JJHA 1JLFA 2XGPA 2U2FA 1RU2A 4O4GB 4A3CK 4RO0A 1HHQA 3HHLD 1RT6A 4JV1A 1NK4A 1MLAA 4MYUA 3TAPA 2JC0A 3T1YF 2XS2A 4V1Ak 4EI2A 2E2IC 3UCUP 2F40A 5FDLB 1LWFB 2BJ9A 1FJGJ 3VALA 8RUCA 1FERA 4J3NA 1NSAA 3HM9A 1Q86T 1B0PA 3K5LA 1YK9A 2H3EB 1IKWA 5B0FA 3GEIA 1GH8A 1CQMA 1PJ6A 2Q6CA 2ZKTA 4K50A 3K59A 2FB0A 2B43A 1T95A 1S1XB 2UP1A 2MMYA 3DOMB 3TA2A 2VB6A 3M6WA 3BPDA 2ADCA 4QR0A 2C2EA 1X0PA 4J9OA 3GYGA 1NSKL 1U2RA 4J37A 4ANEA 2W8KA 4EZ9A 2QV6A 3S14C 3T1AA 3P4UB 3T5LA 1R8AA 1R0BG 1X4BA 2JH3A 1PO6A 1XTZA 2IM3A 4A93C 5LT5A 1M5PC 3T6BA 1WHYA 4YFKA 2LQBA 1Y1VK 5SZTA 2B6AA 1AW0A 2J9EA 3TUIC 5K8PA 2LA6A 4K0KJ 2HK3A 1WQHA 5THWA 2R3VA 4MIWA 4USKA 2BM0A 3U1NA 3Q89A 1FCAA 4QWDA 2NVTC 4AQYF 3MPWA 4B3SJ 4LFAF 2P2CB 3BS9A 2ZBQA 3LPYA 4TU7A 3CCUS 3VZIA 2V6SA 1TWCK 3UDEA 1FXLA 3P3DA 2ZVSA 2QLJB 3MOJB 4ZOSA 4DQPA 3GIJA 2OPQB 1C0TA 1BWEA 3ELHA 4ID5A 1YRXA 2OMOA 2JWNA 1ZETA 1N88A 2A3JA 1N0UA 2VOPA 2CRLA 2DNMA 1P6TA 5KG7A 3GTKA 1SXLA 3MEDA 2ASYA 3DLGB 1U49A 3KLIA 3RU0A 4R8UA 2YKMA 4WCEQ 2UU9F 4DDFA 4PUOA 1TWCC 3KOAA 2ZE2B 3QJLA 3MMCA 4YY3F 3PHEA 2R8IA 1SH0A 4KPCA 3EX7B 2AT1B 2VONA 4AYBL 1C4AA 3GQCA 1U6FA 2CNNB 4OIXA 5LMUJ 3OL6A 3KJVB 2CW0A 3LALA 4AE5A 1DARA 1Q5VA 3IR5B 3FMWA 3ZTSA 1WORA 1S4FA 1ICEB 1UA1A 3OL9A 4IH5A 3CUNA 4TU8A 3T1HJ 1TKXA 1S1UA 1LWCA 1HW8A 3DM2A 2CAJA 4BLBA 2HNDA 2RD5C 3R8YA 3HHLB 1R9TA 1T9YA 1GT8A 4P6QA 3GTJC 1ISEA 3EPGA 4EMDA 3CJ3A 3PIOQ 5F41A 1RYRA 1S5ZA 2V68A 1UW4A 3W9IA 1GAOA 4ZP9A 1E6VA 4GKJF 1P9YA 4RNMA 4C3MA 1VDHA 2KRBA 3VA7A 4RR5A 3KK2A 4JB8B 3NP5A 1Z4UA 1OWXA 4W90B 3DXSX 4CO4A 2PD1A 4CLFA 2F63A 3NS6A 4DFJA 3TI0A 1Y4ZB 3AOCA 5KFNA 4WKYA 2FQQB 3W2VB 4I2PB 1VQOS 4ZPWR 3GV5B 3B54A 3JTPA 4RW4A 3MMCB 2DR7A 3DLBA 2AYGA 3PR5B 1ACMB 3FZ2A 1NJZA 1OY6A 3GSDA 4KGVB 3SSQA 2BKOA 1H38A 3GIIA 3SDEA 3W5YA 3ZXWA 1V9OA 4A3IK 3SFGA 3BR9A 1X4EA 4LF2A 3M1VB 3EQLA 2RU9A 3J80Y 4GTFA 4LF6J 4DUZJ 1CLFA 1RT1A 1B7YB 4G7ZA 5EN1A 4J9RA 3CO9A 4ZKAA 1X7VA 4P7TA 3T5JA 2V8GA 4Y2CA 4PWWA 5D4LA 2W2OP 1RTIB 1I50A 2FHJA 2M9KA 3A8EA 3KK2B 4N8OA 3WC0A 1FNOA 3SFUA 2ZDPA 3RAQA 1K83C 3PV8A 1ZAWA 1NDLA 1TUWA 4O3SA 1R9TK 4CM2A 2UXCJ 1DHMA 2PMWA 1X4GA 2HQFA 1IKWB 1NK9A 1LW2A 1FX4A 1S59A 4L72B 4CM0A 1NU4A 1X9SA 4DU7A 1SKRA 1B0TA 1Y1WC 4DEZA 3CTRA 4QCLA 4I67A 4UT4A 4FS2A 1NH7A 4ALZA 1GEHA 1HIYA 2C22A 3VAFA 3CF5Q 1TVRA 1FWPA 1WC0A 2MGZB 1LKZA 4TN2A 2WAQL 1K83K 2D3O1 1NJWA 1GQEA 1J5OB 3QRPA 3FSIA 1O26A 4F3MA 3IXQA 4RJVA 2IJFA 2DNOA 4B3TJ 4NI2B 3OSPA 3MAHA 4F4XA 2C2DA 4DWIA 1X4DA 1YIJS 2DNKA 4PWDA 2YQ3A 3MFHA 5KFHA 2A6MA 4DFPA 3M30A 4IDKB 1U47A 3R5DA 3J81j 3IG1B 2R7ZA 4X4NA 4AXJA 3SZYA 1RWNB 2XZWA 4LBPA 6FD1A 4MTPA 5HMXA 3DRSA 5E3CA 2V2ZA 5CZXA 3JSRA 1GMUA 5A8KA 4ELTA 2RMLA 3VGUA 1HNIA 2Q1LA 1WC5A 4BS2A 5CXTA 4A3JK 2XZDB 2CJYB 1HBMA 4OIPA 4NPOA 2E2HA 2R93A 3SQGB 3BDPA 4RW8B 2L41A 5IV4A 1YNNA 2E7WA 4JI6J 3RB4A 1Q82T 4NZ0A 2G2ZA 2NXEA 3R5BA 1HBOA 4WBFA 4BBSK 3R7NB 1YDLA 2C3UA 2K06A 2BJ1A 3KJQB 2I5JA 1FRMA 2AEJA 4OZ0A 1UVKA 3C14B 5LJ5Y 3QBCA 4B3OB 1GXLA 1F93A 1MWYA 1U0SA 2IDEA 1PYTA 2EFNA 3NBPB 3UVJB 4ZLPA 3RZAA 4C4WA 5GADU 2R7ZC 4BBRC 1SC6A 4YS2A 2XS5A 4WK3A 3SMZA 1ZBTA 4DL5A 4QPTA 4ER8A 4BWMA 4F4ZA 2LP4A 1C0UB 4M5DA 3J7A1 1IJFB 4PXEA 1YTYA 5MAOA 4FN5A 1U1NA 4XIUA 5E68A 1B4AA 4QYRA 4NCBA 3MEGB 4X62J 1TFWA 3HSDA 2DRDA 5KFSA 2B4UA 4DR2F 1EIYB 5KFVA 4TYBA 3OPKA 5F8IA 2V69A 2HMIA 4MYTA 2R7VA 2M7SA 1L3VA 1N34F 2C3OA 2KI2A 2VC0A 4OYXA 4CTAB 2ZOFA 3M8RA 1EARA 3CC2S 2R7ZK 2M8HA 5C4JC 2GMJA 1LWFA 1VGYA 1Q81T 1FD8A 3HHEA 2IDLA 4ZPTR 4PG7A 3ZZPA 3DKDA 4CRJA 2P9CA 3MPDA 4ZITA 1EI6A 5J1NA 2NCKL 5AE1A 5RUBA 1F5CA 5AXKA 4YR2A 1DJ0A 3EGZA 1GXTA 1QUPA 3V81A 1T9VA 3C46A 2WRMA 4HR2A 2B63K 4KAIA 2QN6B 2XMMA 4FXWA 1K83A 3GTJK 1S1WB 3CWJA 4DQRA 1S0MA 3OFGA 5B0AA 1YGYA 1KQGB 1I94J 2HW3A 1UCNA 4F04B 4ZVPB 3H2LA 4FYYB 5HBMB 3R3TA 4LMZA 4HI1A 3MOZA 4X4TA 2Y9HA 3CCQS 2HKEA 1RBLA 3IRXB 4JOUA 3EMTA 3DOKA 2AYMA 1W7WA 2A2DA 3Q8QB 2GC8A 1YBUA 5IP7C 3TP2A 1PBUA 1SKWA 2VUMA 4A3DC 1REGX 3TZXA 1V3RA 2DH9A 4PYAA 2XNRA 3QT7A 3GTGC 4HHJA 4ZA1A 1S72S 1DD5A 4DZ6A 2R92A 3M3YC 1HI1A 2J7WA 1W2IA 4A8SA 1NHVA 3P49B 4ZVEA 4ZCIA 1UVIA 2U1AA 5DG8A 2VPXB 1M1KT 1DCOA 3M32A 2GQCA 2K1RA 3FEYB 1HNWF 3SSRA 1FKOB 5L8RC 3A3PB 4G0UA 3KJVA 1HBUB 4ETXA 5C2GA 2QA1A 1XZQB 1KQKA 3J7ZT 2EFVA 5DQHA 3J7YU 4GC6A 4G65A 2VJUA 2XYHB 3KLGB 2D1CA 4F7VA 2XLJA 2VA3A 1WOSA 1S76D 3R5AA 3L95X 4NYOA 3H25A 1X9MA 1R9TC 4YB6A 2CJKA 1ZM3A 2BM1A 4FNHA 2XY6A 2AJ0A 3K5MA 4O3NA 2NUHA 4NMLA 1SKSA 1HQEA 1IR2A 1IVZA 1C1BA 4O3QA 1S6UA 4ZLNA 1NDPA 4FF3A 1UJ5A 2UUAJ 2OFHX 4YB7A 3P8BB 2F9DA 4G0VA 1K47A 1XMQJ 4QIFA 1U6ZA 4K7QA 1FE4A 3IGNA 1XXAA 3MR5A 3RW6A 4BY7C 4JI2J 1J6WA 1FK9B 3BM7A 2IHR1 1Y10A 4CH0S 1WI6A 1XPPA 1ITPA 2HVEA 1I1GA 4L6V3 4ZDNA 3Q24A 3UVJA 2B51A 5H9FK 2LLZA 1DTTA 4ZN1A 2PA8D 2PA8L 2MZ1A 5EGEA 3VAMA 1Y5NB 4DG1B 4M5LA 3H20A 3V4GA 5EGHA 4C0OC 3WHIA 1PGZA 4DV0F 4LF4J 5I4MA 3HFZB 4F4WA 2ZBPA 1USOA 4Q4ZA 2B4PA 1O28A 2MQOA 1IBLJ 4DR4J 2HHPA 3HF5A 1Q8KA 3PRBA 3Q8VA 2FUG9 1NK6A 4B3RF 2R2RA 2B4VA 2WTFA 2R2UA 3J7AN 4HDHA 2MJUA 5C2CA 4IFYA 1IUJA 2MZJA 3T1HF 3CJ2A 2DEJA 1ZZFA 2ZVIA 3BYRA 2CJBA 5J2NB 2GS8A 5L46A 1YJRA 4DL2A 4ZVHA 4QPXA 3H0GA 4B3MF 1H2UX 3GP9A 4MKAA 5KT6A 4Q44A 2XLKA 3BSAA 2J7KA 1N5TA 3HI9A 4KSEB 1UZDA 1NHKL 2AMCB 3IM8A 2DHHA 2OPRB 4ATNA 2NYIA 2HFSA 1S6QA 1F9EB 1JLCA 2VL1A 1N54B 4DV6F 1FRKA 2CZ9A 3AJ2A 2KJVA 5D4PA 4CLLA 3MEKA 3ILIA 1V6HA 2E2IK 2DBBA 5L9NA 3DRPA 4UOGA 2AX1A 3TEHB 1O24A 2FVRA 4Y2AA 2MKIA 4EYIB 2M2BA 4YDXA 4OHXA 5KFMA 5DG7A 2JA7C 3UDCA 2W1BA 1IQTA 4XK8C 2BVZA 4LRCA 1EQRA 4NLRA 2GIRA 3KLEA 3T5HA 3D0GE 1FD2A 4BDPA 3LAPA 4ZK7M 1LW0A 1D9FA 1X4CA 4M5NA 1N6QA 5BYQA 4CLPA 3CD0A 1GTEA 5FJ4A 3MM5A 4P9SA 2R93C 1RAJA 1BQXA 4R5PA 2DNRA 3BH7B 3IP0A 2G2OA 2QT7A 2YBVA 1CJTB 4QOTA 3KJFB 1BE4A 3H8YA 1VISA 1WG1A 5LXRA 3CQZA 1T7PA 5C25A 1HYSB 4A4JA 3I0RA 1GK8A 2NXUA 4U8VA 3NRBA 1RT5A 4LR2A 3FRZA 4FZBA 3FEXB 4F26A 1ZVUA 4KKOB 1NJYA 1NKCA 2ALZA 2QFJA 4LF7F 3ZNJ1 2HZVA 4LRBA 4OI2A 3S16K 4U9RA 2KG1A 3WC2A 3TWZA 2EFGA 2XMVA 1UZHA 5IP7K 4B9NA 2RH3A 3BH6B 3T00A 2C2MB 2HPUA 1T9XA 4DF4A 4ILLA 2VFRA 3HKZD 4NLTA 4DR1F 4XSXA 1UFLA 4W92B 4Y65A 2ATLA 3IS9A 4P74A 3ZC4A 2NVXC 1D9AA 1L3SA 2R7UA 1QD1A 1S79A 2MB0B 1CC8A 3RB3A 5L1KA 2IYGA 3QGHA 2OUGA 2Y1LB 4M8LA 2F4FA 1NUEA 2CJAA 3S1TA 2KYXA 3GLJA 4IOCQ 3CCWA 3W5XA 1VC0A 2HBYB 5ETMA 3POTB 4URSA 4Z2XA 4DV7F 4YQWA 2PC6A 2PFFB 3RZOC 1RTIA 1RWOB 3FEZA 4I6WA 4LBHA 2NVXK 2VQEF 5CA5A 1YNJA 4DR3J 2WK4A 1WKKA 2E5HA 1NLKL 1REVB 2V8PA 2QFIA 1WCMK 4R0EA 4RUHA 4PXCA 1GMWA 3K5NA 2KFYA 1KHWA 2FVPA 1JNZB 2LVWA 2QLWA 5HVHA 2ZH6A 3B82A 1RT3B 3V81B 2XO7A 4OJ3A 1IBAA 5KFAA 4KJIA 4RL1A 3GEHA 1ZS6A 1KTQA 3EJMA 1NJIT 1PC5A 2GX8A 4TQRA 1VQ5S 1XEZA 2CA9A 3BBFA 5DDOC 1BS2A 2F3JA 5KOXA 2V8HA 4PPDA 4LBIA 4LSZB 2XMUA 1VLYA 2NUUG 4K8RA 2EPIA 3QNWB 3CD5A 2J6UA 4OYPA 1D8YA 4TQSA 3IBCB 4ECWA 4KAWX 1NH8A 1PC4A 4B9VA 1A9NB 4A3KC 4KO0A 2NPIA 3TAMA 3D67A 1VQ6S 3K8VA 3IC1A 3M8QA 2E5IA 3TR5A 3PJWA 1RISA 1OY9A 3MD3A 3I87A 2ZZMA 3GV8B 2J0WA 3CQZK 4K0KF 3DI6A 3SV4A 5HQ8A 1SL0A 4Y00A 2HIYA 3GTKK 4OX8A 2GO9A 3S1RK 4LOWA 4F4AA 3IRWP 1TMMA 5E0OA 4IRKA 3GTQK 1JXLA 2ZUGA 3Q86A 4ICLB 2CYYA 4JI1J 1UKUA 3C14A 5F8JA 1WACA 3JAMY 2MEWA 3LPXA 1RTZA 3FNNA 2ZUEA 1Q95G 3V2UC 1RLCL 1AA1B 3CQZC 4X4VA 3KTQA 4XDDA 1J6XA 5HAOA 2VG5B 4IQMA 2YNIA 3C8YA 3VAHA 4NLGA 2D3OR 1U8SA 4OQJA 1N0VC 4YR3A 3OLAA 1TKTA 2D3ZA 4PXDA 1GXUA 2BJDA 4RNOA 1IR1A 1VRQC 1AFIA 1S1TA 4RU9A 1H72C 2I38A 4C6AA 1TQLA 2PT0A 2NR0A 3OR2B 3TARA 4MFBB 2EG2A 5J1EB 2PA3A 2UV8A 1VRUB 2G2YA 4J91A 3H0PA 3WODA 2HWTA 1A7GE 3L09A 1IW7A 1RWXB 5A0YB 4PABA 1HNVB 2NZ4A 2CPZA 1QLNA 1EQMA 1V3SA 3BPSP 3HVWA 1SH2A 4IH6A 1VBKA 2HFNA 1R8BA 1Q16B 4ILRA 1WUUA 1WEXA 4F67A 4ZHRA 5GMDA 2XMTA 2DNLA 4GKJJ 2V94A 1Z1ZA 3G6YA 5IV3A 4AYBD 3OL7A 4NLXA 1VK8A 2QC3A 2R7QA 1NZ8A 4NLWA 5G0RA 2QLBB 1RBOB 2YKOA 1T11A 4L76A 4JV2A 2W2NP 4DCJB 3RR8A 3TZZA 4ZVSB 3M9OB 5C3EC 5GAEU 2EXUA 4A3LC 4OX9F 1QM9A 3KK3A 1RT5B 2WOMA 1HARA 2M0GB 1U1RA 4KMUA 2MPUA 5KFCA 1TKZA 4OI0A 2O5IA 3K58A 1XERA 3M05A 4OIQA 3I5BA 4EBCA 1I5OB 5HVFA 2DGQA 2HZAA 3PX6A 1IE0A 3EXCX 3B4MA 2A68A 4KT0C 3D6HB 2XEXA 1WF2A 2QIFA 1JOEA 5DDRC 4LFBF 4DMZA 1U8WA 3FZBA 3TFJA 3LGHA 3C15B 4ECQA 2FJBB 1I94F 3NWRA 1NEEA 1NXIA 3LAMA 4LT6A 3QX3A 4RNHA 4BBRK 2C42A 3BN7A 1FJEB 2ZUAA 4AL5A 4G1QA 1CJVB 5D8HB 4ED2A 2P8IA 4OX6A 4O4RA 2HYIB 5LJ3Y 2VF3A 1XN9A 4QIVA 1EK8A 3G6ES 2XWXA 2H1YA 4N5SA 1RHRB 4NMXA 1TU0B 3QFHA 4ZPCA 3TJ8A 4E8UA 5ETRA 4KMDA 2DISA 3GR1A 2ERRA 3HO1A 1UEKA 4X66J 3BJYA 4YOEA 1VIOA 2MTLA 1WEYA 2V8VA 2JA8C 4U7CA 2RVJA 1HNZJ 2BDPA 3O44A 2N3LA 4KFBA 1ZOTA 1TL4A 2G0IA 4ZP6A 1X5TA 2J8AA 2GIQA 1KLMA 2Q6BA 1RAHB 4F0KA 3S16C 3JTOA 4IYQA 2QA4G 2V2QA 5K14B 5H9FJ 1X60A 1U1PA 2AHOB 3GSIA 5EGYA 1T9WA 3H90A 4OI3A 2PMZL 1BQNA 2E7VA 2P6TA 2B56A 2V8DA 1RCXB 4ID8A 3V4IB 3SZZA 2GMHA 1N5YA 4J90A 5D78A 3G2XA 3F0NA 2FZKB 1HLWA 2DNHA 2ZM6F 1RKJA 5IYCK 4C3JK 3TYTA 1SV5A 2CQPA 3MAAA 3EDQB 5CQGA 5DLGA 4P52A 3LA0A 1C2PA 2WHOA 4OYZA 5M2RA 2DHGA 3M7VA 1YLXA 5CD4H 4Q5VA 3PTWA 2DR9A 1RHKB 2MQNA 1YJ9S 1SUQB 2KDOA 2N7YA 4WE1A 1G2EA 2NVYC 2D3UA 1X4FA 3TANA 4C3IK 1OYEA 2X1FA 2HBZB 3M3YK 2HBRB 4KARA 3O3LA 2YNFA 4V19X 2JA6C 3FKIK 4MKVA 1EZZB 2G1HA 4NOHA 1I50K 1K0TA 3QO9B 5HATA 5BXIA 2MY8A 1TWAC 1JQGA 2AWZA 5KFRA 3OQ2A 2PN6A 1WQGA 3DLJA 1J5EF 4FF2A 2UV8G 2GHVC 2AJ4A 3IA0A 4KE5A 1NB2A 4I2QA 4G7HA 3MDFA 4NWBA 3GTKC 4OX9J 1ZA1B 3P45B 1FRJA 3N9UC 3TUZC 1H2TZ 2KM8B 2AP6A 3W9JA 1UMJA 3PO2C 4DL0C 1S6PA 2BXJA 1C0TB 2X1BA 3HOXC 2WW4A 3DLEB 4DR4F 4DOZA 1S12A 3EM1A 1BHNA 1S9FA 2MSSA 3N01A 3D4JA 1HHSA 2OLWA 3D6MB 3M6XA 1Q1KA 4CCHA 2F7VA 3H2VE 1HI9A 2R4FA 3CJ4A 2I8EA 1T05A 4DV3J 1NK8A 2BR0A 4C45A 5B0GA 2HVDA 1FESA 3MAAB 3DMJA 4TVAB 4OV6A 4LF8F 2K3KA 2HK2A 1YKWA 4C3KA 3QQCD 1KR4A 3U02A 1U1KA 1SUQA 3SXLA 2DO4A 5CABA 1Q5YA 2A69A 2BANB 1GNKA 5CHCB 3I4MC 1H73A 4GO7X 4KV8B 4IOBA 1O8BA 3CJ5A 5AE3A 5CYMB 1XMOF 4OYIA 4DSEA 4ZHRB 4EWTA 3C6TA 2E5GA 4Y3CA 4ED5A 3SQGA 2VC1A 3KLFA 2B5JA 2XZTB 3QIPB 3BB5A 2Z56B 5C42B 1UFWA 6AT1B 1MW7A 1SC4B 1S4EA 3OUYA 2C28A 1NAQA 3DI6B 4PEOA 3R97A 2L9WA 4BXXK 1JLQB 3LAJA 3J81Y 2RHQB 3W62A 2W9CB 3FJ2A 4HT5A 3FFIA 2OEKA 1M0SA 2DKOB 3RG6A 3DLEA 2YX1A 2Y1RI 4FP9A 2LEPA 4LR7A 1JWWA 2LU2A 3A4TA 5G4DA 5H9EJ 3CJRA 2CQHA 3R7BB 3WIUA 3DFEA 3K89A 1G51A 3L9ZA 5GAHU 2F65A 5D0RA 4RLEA 2E9ZA 1J98A 1XXBA 3M4OK 2H5EA 4A3JC 5L39A 3QPIA 4CNYA 4Q0BB 4DV1J 3KHLA 1NSQA 2CZ4A 2V4RA 3TVKA 5I3UA 1I6VA 1BGWA 4LF9F 2KXFA 1XZPA 1KHVA 3OVBA 2KU7A 4QW9A 1NPKA 4C98A 4C2MC 3T41A 3UWTA 4LFCJ 1RAOA 5CZVA 5A6PA 2XBPA 3VHQA 2RAQA 4PQAA 4DS4A 4YG2A 1FRIA 2L48A 4Y34A 2VBZA 5KG5A 1OIAA 5KG0A 4PZVA 2AKWB 3A8KA 5BR8J 1VBXA 1IBKF 2FLLA 3ENAA 4X66F 2QZ8A 3C6UA 4AQYJ 2OD4A 3NG8A 5T14A 1HQUA 2YKAA 2MLXA 2ZZNA 3RW7A 3UN5A 3Q8RB 3QSIA 1WTBA 1O0PA 1HBNA 1S1VB 5C4XK 2FJDB 1TWFC 4ZVFA 3CD7A 4YB1P 4DUZF 2AJFE 4LR9A 2IMOA 4KTQA 2G9OA 3I6PA 3HDSA 4F25A 5LSRA 3QJPA 4IR9A 2P5MA 1BQNB 3TW0A 3JQMA 1F2GA 4OZLA 2LQ5A 5HMYA 1OJ4A 3I4PA 5K14A 4J9KA 1XJWB 1FRHA 2YKQA 1WQFA 3MM8B 1TK0A 2MYFA 3SZ2A 2LEAA 1TR0A 4BKWA 1B0VA 3D66A 2XULA 3T9NA 1Y1WA 3IG1A 1O2FB 3G87A 2CVIA 2HHWA 3MECA 3OBIA 4KMAA 5DM6Q 5KG3A 4ED8A 4PYDA 3A8IA 2XG8A 1RAGB 3GTOK 3CNQP 3KUHA 1F60B 5AE2A 3VAJA 5AXMA 2VUGA 4ECYA 2JRSA 2V4QA 4R0JA 1FVQA 1C4CA 5KG4A 4F3QA 2OPRA 5KFUA 1KLNA 3GTMK 4DV4J 4IO1A 3MTKA 4FBUA 2BACA 4QW8A 4YEAA 1CJUB 1TZ0A 5DDQC 2H4WB 4KGZB 1T9UA 4RX6A 5HLFB 3HT3A 2VFTA 1VGXA 1VJWA 1IQ0A 5A8KB 2ROGA 4A3BK 4IFVA 2K7JA 4F4KA 2ZFHA 1YJ7A 2XHCA 4MKYA 2IAJB 2E5LJ 2DR8A 2QYGA 4HHUA 1P27B 1URRA 5E5NA 3UE2A 1B99A 2FJWA 1I50C 1ZM4A 1PYOB 1F6TA 4YFUA 2V6TA 3ISND 2KH9A 2DGWA 2FDNA 1RWKB 5GAHI 1U48A 1S9GB 2HSEB 1AYEA 4RW9A 4EK2A 3HHNB 2OIHA 3BP8C 4J9LA 3GTYX 3QSYB 4A3EK 1VQ7S 3FOFA 4BCAA 4GVLA 3R1HA 3MMLB 3QIDA 2AYEA 1NPPA 1R27B 3PO2K 3D0HE 4C3JC 2BE7D 1VQLS 1DTTB 1QTMA 2GJFA 2MKSA 4DZDA 5T7LB 2ADBA 4DN0A 1FDNA 5JJBA 3THTA 3UCZP 1BGXT 2JEIA 4ZPDA 1QAYA 3F73A 3PW2A 1TL3B 3DDNA 3N5FA 1IBMJ 8AT1B 1PJ5A 3K7RA 4DSJA 3B78A 3QMQA 3BQ0A 3H2UB 4A8OA 2D9PA 4C3LA 5IP9K 2GVDB 2ZHAA 4JI6F 3HOWK 2ZOMA 1WDTA 3M8YA 3PIPQ 1N36F 1MG7A 4UZCA 1YX2A 4DQSA 4P7VA 5U47A 3A3NB 4IG0A 3U7JA 2R7SA 5KFKA 4NLDA 3KMQA 2V5HG 4Z7CA 1VRUA 2WB1D 2QEXS 1REVA 3QGPA 2H48B 4KDDA 4WJBA 4X62F 1TWCA 4U6PA 2JA5K 3FSXA 4OINA 2HNZA 2LYVA 2DHSA 2RUGA 4IFYB 3CCJS 5IP9C 2YPZA 3ETMA 1WOPA 3PW5A 1HWIA 3HOXK 2EI5A 2MHEA 3PXGa 1OSCA 3DCAA 1IWAA 4UQGA 2J8SA 4UZBA 2KO1A 3JB9k 2J6SA 4M63A 3WIVA 4NASA 2EKNA 2JDJA 3HKWA 2O01C 5LXYA 2FZCB 1IKYB 5E3AA 3OW2R 3IGVA 3GTQC 3MM7A 3I9V9 3S1QC 4UUXA 3BR8A 1WG5A 3Q23A 4NRTA 1JIHA 3QWPA 4XCHA 2R2TA 2ZC3A 3N6MA 4P5BA 4P5AA 4Y28C 4DXLA 4KHPF 5JVOA 3MEDB 5LOQA 2CQ0A 3JQKA 3LGMA 4OLPA 3CSKA 2RS8A 1OYDA 2NLWA 3ICLA 3I4MK 4WTOB 3RTVA 3IFEA 2NVXA 1CJVA 1FWKA 4KN4A 2J7UA 2ASDA 3MMBB 1H74A 1FXRA 5D3GA 1T03A 3BREA 3LP1A 1HBNB 2ZM6J 3ET6B 3CDBA 4OZ1A 3CW2C 3K17A 4I7FA 3DN9A 3S15K 4ZN3A 4JBCA 8ATCB 3HVRA 3V6DB 1HR0F 2C1EB 1H7XA 3AHPA 4LK1A 4O0NA 2LFVA 2GV1A 2QJ3A 2OPPB 1X8DA 3NAHA 2LQ9A 4YHHF 1N6QB 1SQEA 2YKNB 3L4BC 4FYDA 4LF5F 1XMBA 4HKQA 1W2BR 2FZGB 1RB0A 3TZYA 2VKRA 3S2HC 2DCLA 5C4XC 4TLRA 3OTDA 3N6NA 2BQ3A 2HHSA 5BJRA 3M2UB 4JUZA 3S15C 2LDIA 3SV3A 2VA2A 4E0DA 1RWUA 4CLWA 2ZFZA 1OY8A 2R8HA 4NX9A 2CPEA 2M4MA 1U2CA 2DR5A 4AL7A 4P73A 1EP4A 3E3XA 3T9ZA 2NYHA 4A46A 3R2DJ 1QE1A 3LP1B 2GSOA 2RNEA 1IS1A 4KFBB 3QRQA 5EWFA 5D15A 1U6BA 1UV7A 4NEZA 1R0AA 2GGPB 1K1QA 4X4UA 3N0CA 4G3IA 2W9CA 3GTOC 5L1JA 1CJKA 3O8WA 2ZH8A 3MECB 2IJRA 3L7UA 3LWLA 2O5JA 5KFZA 1N56A 4BWJA 2AGQA 1EKSA 3DOKB 2XCRB 2FVCA 2CFXA 2Z0GA 2GFFA 1BQMB 1JKHA 2JFDA 1DCPA 4MK9A 2XCPA 1KDNA 4WF9Q 4O4GA 4J9QA 4GC7A 4H4OB 4RU2A 4WU2A 1C1CB 1FE0A 3PKMA 3HHKA 1XNQJ 3NGRA 2ILZA 5KTQA 5D6GA 2IM1A 4M1KA 1RT2A 2CDQA 4PPZA 1YJWS 2IPOB 1BQMA 4L74A 4GTCA 3CB4A 5FLMC 2LCWA 5AXNA 5F8HA 1QAXA 4DV0J 2KL8A 3PRVA 1ZTWA 2B7CB 2PGCA 2UZAA 1GX6A 4P2XA 5KFXA 1YJNS 2RUSA 2FQTA 4PQUB 3FVYA 2QL7B 3CMQA 1JLBA 2E2IA 1FJ7A 4A3EC 2AGOA 2BE9B 4OJGA 4DS5A 1U1OA 3VAGA 1NKBA 3GTMC 4QWCA 3I55S 3AOAA 2VPWB 5TMFA 1YI2S 3JSMA 1RHUB 2V2KA 3FDSA 1T05B 3ONQA 4A8XA 2HNDB 4YFXA 5D0HA 2ZD1B 1FNXH 1TV6A 3S6EA 4EFAC 2JEJA 1KVIA 2DNGA 3H5XA 3TZWA 1TL7A 2AGPA 1MU2B 3K57A 4V19J 3ILOA 1SQFA 3DDKA 2DPIA 2KHDA 1I3QA 1Y00A 5D4NA 2XMWA 1N33F 1Z2ZA 4KYZA 3HOWC 3B8HA 3BKUA 5KFYA 3CJKB 2QLXA 2B3TB 2V6UA 5M2PA 2ZEJA 3DHWC 4KH1B 4F0HA 2LA4A 5HK4A 4LIWA 1WOOA 1U0HB 3QLHA 5M3MK 2RQCA 2VUMC 3MMAA 2QMXA 3I0SB 1CULA 3HULA 4EBDA 3Q8YA 2DRBA 4HH1A 4IG0B 1NNDA 5C42A 1HWKA 1RTHB 2LMIA 3KLFB 4I2PA 3HFVA 1FWLA 5IT9U 1RAFB 4Z7YA 1FJGF 4M5KA 3W63A 5J1PA 5DGAA 1VC5A 5F8MA 3DHXA 3LUYA 5DO2A 1JXEA 3CDEA 4A3IC 4XSZA 2DGUA 2UXCF 2HMIB 3MR2A 2BW2A 1UA0A 4P2FA 5GAGU 1HD0A 2DHAA 4G0WA 2FIUA 1CULB 5J2QA 4HACB 2V63A 3S2DC 2QRRA 1T9TA 1N5YB 2R7RA 3HHLC 1OPZA 3KK1B 2W01A 2ZITA 1SL2A 3VAIA 1Q8BA 2UXDF 3TJ9A 3BO2A 5HJYA 4Q2MA 4FF4A 3M8ZA 4A3FK 3MFIA 2HNYB 2XYPB 2FY8A 2ZNZA 2MLYA 4IH7A 1K0VA 3UR3C 5IWAJ 5IFMA 1IBLF 4E2FB 2VFSA 1A0OB 1S99A 1CQNA 1U1LA 3G9CA 1MROA 3Q2SC 3US5A 1ZAVA 1F7VA 1U1MA 2RRAA 2KJWA 2BRLA 2RE1A 4DR7F 1JXVA 3ZTQA 4KGXB 3R9LA 3HFKA 2KM8C 3FKIA 3OT9A 2KN4A 2XYGB 3KDNA 2KVQE 1LV5A 4NXMF 5HANA 3LOUA 2YWFA 3VTIA 3V4IA 1TL3A 3D1QA 2DY1A 3VR1A 5ETNA 1UVMA 3QLHB 4GTLA 1CC7A 3K0JA 1B4BA 3H4DA 2HHVA 3L7PA 3HX9A 1WC1A 4N7TA 3VWSA 5HMZA 1L0WA 3T1YJ 3CCTA 4BY1K 3N4WA 4DQQA 4X4RA 3M2VB 3F56A 1IKXA 1F5BA 2CPYA 4O44B 2WSFC 1R31A 5F8LA 5KFBA 1B7FA 1KNZA 3ZTPA 2XWYA 3FHZA 2R8GA 3SCIE 2VFVA 4K4WA 4J7CA 4N41A 5KFLA 2VASA 1WF0A 1VJEA 2GA7A 4B9LA 2YWEA 1UWBB 4JP8A 2M88A 1Q78A 2Y8WA 4ZPAA 1KN6A 1S1VA 4DX7A 2WOMB 5AT1B 2Y0SL 2KTQA 3Q3QA 4JI5J 4BY1C 4H4KC 2VQEJ 3KUGA 3AAWB 1S7IA 4OX7A 3GB0A 3OFHA 2CNLB 4RUBA 4RW7B 1ZQ1C 3THPA 3VGTA 1VBYA 5JXSA 1MMLA 4RBTA 1IR0A 5LM7E 3C16A 3PO5A 4ZVUB 4O3OA 3X1LB 5C25B 4PWUA 1LWEB 4DV7J 4AH6A 3LF0A 3I82A 3KLEB 3THVA 1F3FA 2YU9A 3D7SB 1D9DA 3D3CJ 1RYSA 2VD3A 4A3LK 1FFWB 3VGSA 4DUTA 1DBDA 3KYLA 2MKHA 3PM9A 3WZ0A 3IBWA 3NOCA 4WU3A 4A8YA 3RZDK 3DYAB 5ETSA 2HHHF 1WI8A 3UO0A 2R9LA 5D4OA 3W9HA 3M2VA 4KB7A 4CO3A 1V5IB 2KXNB 3IRXA 1KLMB 1J6VA 2X51A 3UFCX 2HQ3A 1RT2B 3OD2A 2P9GA 2ACMA 1YQHA 3P5TL 2OPPA 2YNGB 4FVMA 4UUWA 1HL6A 1T02A 3CJTA 4DR6J 2BJ7A 4I1TA 4YMEA 4GT9A 3O5TB 2ZC4A 4YB5A 5A8WA 3DNCA 2YH0A 4LR8A 4G7OA 3U27A 4K4UA 4LLGA 4A3MC 2DRAA 4KN7A 5HQMA 2GVZA 1HQUB 3EPIA 1TWGC 4DL3A 3I0SA 2DXFA 2LXIA 2RDIA 1VQ8S 1T94A 2F4VF 1JLEA 2MJNA 2XY5A 4JV5J 2RKIA 2WBRA 4K5RA 2BQUA 2IRUA 4C2MA 5ITHA 4F36A 2FJAB 1JKHB 3CJKA 3Q2TC 3FCVA 3OR2A 3GILA 2JA7A 5M2UA 1EJ7L 1P1LA 2JNJA 4L3NA 1WD6A 3NY0A 5FLXY 4USJC 3M30B 4IDKA 4FYVB 3IR7B 1SB6A 3CULA 3O6QA 2YU9K 2MQ8A 4RNNA 1DTQA 3MM9B 3DXJA 2EEYA 1K9MT 2ZH7A 2B0GA 3TTGA 1RWVB 4GKKF 1I51B 1UL3A 2QX0A 1KONA 2O5DA 4YN3B 4I64A 2BJ3A 3VQSA 2HZCA 4ES3A 1L5UA 3IWXA 1KP6A 3GJRB 3GYXB 1QVGR 2DIUA 2B7BB 1QY7A 3TQEA 2EVZA 2NSCA 1FXDA 3D2WA 3AT1B 5HSPA 4QWBA 3R1LA 5L1LA 4UF4A 1WG4A 1BC6A 1VQYA 5AXLA 1FEHA 2XM3A 1KQ4A 3H5SA 2KZZA 5IOSA 3S2DK 4WTYA 1RT3A 2G0CA 3CJSA 3G82A 3H59A 5B0CA 1MWQA 2X3DA 1JVIA 2HURA 4GVBA 5A8WB 3FBEA 4HL9A 4NXNJ 3TUJC 3BO4A 3EGNA 2K1RB 1MNEA 4DF8A 3LANA 1XMQF 1RK8A 2OAUA 4I6AA 1B64A 4HT7A 1C1CA 1ZAXA 5IXUA 1P1TA 3DRYA 4ZPBA 2WB4A 1W25A 4ANDA 4MMOA 2WZ1A 1P8GA 5F0UA 4QU7A 4UOCA 3Q8UA 1LFWA 3GG0A 1SJRA 3PEHA 3OXGA 3MM6A 1MMDA 1NPRA 3ULHA 2CQIA 5IYBK 3KG0A 3RBZA 1SQGA 4F0MA 2FVSA 3JYTB 2PHCB 4B9SA 3MTJA 2MZRA 1QSYA 3DDIA 1EB0A 4DPTA 5L38A 2HHTA 4WJ3M 3GYNA 2HEKA 2BOAA 2GW8A 4JI8J 3H98A 1MROB 2YWWA 2BKPA 1OMSA 4G6VB 5JVGQ 4IFVB 3KLVA 2EG1A 3R6LB 3NEKA 5HVGA 3CCVS 1Y1WK 5B0EA 1S9GA 4FPRA 2R7TA 2E44A 2LXUA 3OTBA 2UVWA 3PG9A 4OV1A 4EGLA 4OYBA 3GCWP 4B9UA 2LKZA 5IYBC 4F50A 1LWEA 4B3TF 1S0OA 1RU1A 1Q0NA 2BABA 2IBOA 1HA1A 3M2UA 3GTMA 1UJ4A 1KQSR 1FK9A 2DB1A 4IQXA 4JI5F 3W2WA 3BUEA 3FMBA 2O67A 1DCHA 2ZKUA 5FDLA 4A3GK 3S1NK 4FF1A 2ZE2A 2YQ1A 3UDLA 4I4BA 4H54A 3S1QK 3FBCA 1WEZA 2OFGX 1DFDA 3EGVA 4JI7F 1TKXB 3DYAA 4CLZA 3OXLA 2HHUA 2HLTA 1H98A 3SIPB 4OJ1A 3QGIA 5ETLA 4NLYA 2DGSA 1T03B 1VR6A 2H4YB 3NNAA 2DTJA 4TY8A 4ECSA 2XQCA 2RDDA 3GE9A 1FJCA 1DLOB 4A3GC 3LTOA 2E7XA 4AD6A 2Y0SD 2IRYA 4CDIA 4F4YA 2BA9A 4CZCA 2M3DA 5EX0A 3CJ0A 2KFNA 1YRTA 5LL6d 1MMNA 3CC4S 2IJNA 2GNKA 2RDJA 4NLUA 1HBUA 2XGQA 2VQFF 3CO0P 2KT3A 4CLSA 2DCUB 4LUBA 5IORA 3M4OC 3PJXA 2Q79A 4WILA 3HD2A 1TWGA 2LECA 3NOGA 1DTQB 3EZ5A 4A8QA 4TXSA 2D74B 3G8TA 3OR1A 1D1UA 3MEEB 3CJQA 4JI4F 1DAXA 2DNZA 2EWHA 3T5KA 3PEJA 2VU5A 1TELA 3S0XA 2XS7A 2FQOA 5F3ZA 4ECUA 2IC3B 2OO4A 5C3EK 1AXQA 1PBAA 1C0UA 4M5DB 4FPIA 1UWAA 3GEEA 4ZIWA 2DD8S 3NLCA 1JLGA 3TNVA 3QT5A 1RCOB 2Z4PA 1QVFR 1TP7A 2OSQA 1DQ8A 4DL6A 2HNYA 3EXYA 5CH7B 1AUDA 1GFWB 3EZUA 2DHXA 4E98A 3AD7C 4PAAA 3F41A 2Y8YA 4WP3A 1JLEB 2RU3A 1LNQA 2Z2YB 3IO1A 1G4CA 5ETVA 3HMJG 3MM8A 3E01A 3IAM9 3W61A 4Y0FA 4DLGA 2YX4A 1BXNA 2M5YA 3LP0A 3MHYA 1JNRB 1N32F 2N4CA 1IM4A 3OSNA 2NZCA 4LJZA 1EFWA 3PJ9A 4IRCA 2ZHOA 3TX8A 2J76E 3A13A 1Q8LA 2MSTA 2O1PA 3V6JA 5IOQA 3OJUA 4K2XA 5IC4B 2DNPA 4JV0A 2AD9A 3CD6S 4FYWB 1FRXA 3RJMB 3RB0A 5C44C 1TL1A 2PIIA 4KH0B 3MMBA 3PO3C 5HROA 1RI7A 1TKTB 2B8QA 2VIHA 4KM9A 1AB4A 3DLGA 2YVSA 4LSNB 1WTFA 1NRKA 4MEYA 5ADZA 2QA4S 3RB6A 1WC3A 1JLQA 3MPUB 2P9EA 4C3HC 3I0RB 3NMAA 1SIWB 2JA8K 3D1HA 5J2PA 1IQZA 1QJHA 1AB8A 4MFBA 4WIIA 3ZNUA 2CQCA 4DJBA 3LAKA 1RSCA 4NLSA 5C24B 1LW2B 1RWPB 1F1BB 2XC9A 4JYAJ 4XTTA 4A3MK 2HS0A 2XCAA 2CWXA 4CQ1A 1QAIA 1UFKA 4ED7A 1NHUA 4ELUA 1O51A 1S0VA 3MM6B 3CIMA 1B4SA 2SXLA 1UWBA 2FVQA 4NLQA 4PWDB 5IC6B 2QL5B 4B08A 4ECRA 4A3DK 3HOVK 3C16B 2HRTA 4HACA 3ZTOA 1QE1B 3MCOA 4NYPA 4LF4F 2CJ9A 2MQMA 2E29A 2V0NA 1XR7A 3VVTA 1RAEB 1Z2LA 4EBEA 3BGRA 2DH8A 1S1WA 1TVRB 2LQ8A 4CNZA 2LU1A 2QLFB 3MZIA 4QIWD 1HQEB 2YKMB 1U45A 1SMYA 3RRGA 1QUVA 1WSRA 1WCMA 2W4DA 3MMAB 4AFFA 2RJZA 2R2SA 2AW0A 2BW7A 2H5IB 2XHWA 2EK6A 3AJ1A 3K8WA 4IOAQ 3GJTB 2QMWA 3LPEA 2J0XA 1K73T 1F9HA 4LF6F 4ELVA 4RBVA 3M8PB 2ZH3A 3MGJA 3KWMA 1VQMS 1TWHA 3TVYA 2W9BB 3I4NC 4OJHA 5IYDK 2GIFA 1X5SA 4AT1B 2A10A 4JI4J 5IOLA 4OZNA 1ZYQA 3SI8A 1FDDA 4ZP8A 1N5VA 5KG2A 1CG2A 1VQKS 3KHRA 2OI2A 3ZZUA 3FSYA 2M8DB 2PEHA 5KT4A 4XLNA 3BDEA 2RHSB 4WIQA 4U67Q 2PE8A 4PKDB 1RT4A 3EVOA 3GWCA 4RW6B 1VJQA 4RWXA 2C2RA 2CPFA 5TMCA 4M5GA 1VHFA 3S14K 4CI0B 3KLHA 1TL5A 4C48A 2DO0A 1WF1A 3WX4A 2AV5A 3EZOA 2C3MA 4A93K 2XI2A 1F0XA 1R8PA 4P10A 1Y1VC 1CJUA 4O23A 3PY8A 1O27A 2BJ8A 1VQPS 4LQ3A 2QSFA 2VODA 2BBEA 2JL9A 2IY5B 5KFTA 1NB7A 1T3NA 2I1RA 2C2ZB 2UXBJ 2OHDA 2A0FB 2IA6A 1HW9A 2BQRA 4L3KA 1EX8A 2WVCA 1Y1VA 4Y7NK 1JLAA 3CDWA 1U26A 2JEGA 3HHDA 4X65F 2BYCA 4NLOA 3BSNA 4BC9A 2FHJD 5E2QA 5I3UB 3S17K 4QU6A 3R5GA 4M5JA 3KK1A 3AODA 3DGVA 3AD8C 3AH6A 2DNYA 4LJMA 1I3QC 4KATA 1RTJA 1VK3A 1NO8A 5EWGA 3R6GB 4DCPB 5IT9Y 2E1CA 2R8JA 2LEBA 4CLKA 2MLZA 1I3OB 1O2BA 2GGPA 1QAJA 2E2JC 4LRFA 1WNEA 1MSWD 4OIRA 2W4PA 3IWNC 3NGTA 4BC7A 2RRBA 3S17C 4GVBB 4C0BA 4DV1F 2K3IA 3CDUA 3MAQA 3WBZA 3R27A 3CT9A 1R6VA 3ETOA 2I9SA 2YNFB 1D0EA 3CJ8A 1M1HA 1PAEX 2IAJA 1FA0A 4QZVB 3D1OA 3NS5A 2ASLA 4WE1B 2GSUA 1FTCA 1LW0B 2VZ9A 4LSLA 2BE2A 2HFZA 9ATCB 2QO3A 2VJVA 4USVA 2NREA 1H7WA 2N82B 3G4SS 2D41A 2AX0A 2HFVA 1YWXA 3BSCA 1APSA 2VFUA 5CHPA 2BANA 2E1PA 3N0VA 1VHIA 2CADA 2ZH5A 2CPXA 4MJKA 3AB4B 3ADAC 1UVJA 4C2MK 2QA2A 5DG9A 1RUSA 3MM5B 3PYDA 2GCFA 7FD1A 2R7WA 5L1IA 1H2VZ 5DGBA 1YJTA 4HHHA 1SFOC 2OELA 4H4OA 3S01A 2ZJQQ 2R7OA 2MDAA 3CAGA 1TFYA 1IKXB 1FRLA 4RW8A 2O3DA 2R93K 3IWLA 4QYZJ 3OTOF 3MR6A 2IBKA 4OHWA 2Z58B 2CPJA 2HGLA 5IM0A 3LO3A 5K20B 1VCTA 3SYZA 3R7SB 2Y3YA 4LFAJ 4B3SF 3QGGA 1UJ6A 3L4KA 2VDIA 3FKBA 1RP5A 3EVMA 1JB0C 2CKWA 4LVOP 4Y6IA 1TAQA 4PCQA 3OUYB 3TOQA 2OPQA 4I0WA 4ZJLA 4RW4B 1CS4B 5DETA 2UXDJ 5LMNJ 4GTDA 4KBIA 5B0BA 1M1GA 1ZM9A 3MPVA 4QWAA 3CC7S 5KOWA 3G82B 3NCRA 3KJNB 4Y2IA 3HOYC 3GTPC 1JMTA 3PDNA 2W2PP 2DNQA 1SCJB 4QR2A 1EH1A 2FHOB 2E5LF 1PILA 4DR7J 1FFGB 2QG9B 4F2RA 5C44K 1L3KA 2HWIA 1F2HA 3E01B 2HBQB 3W5ZA 3PO3K 1UAWA 3V6KA 2ZWPA 3OHAA 4CT8A 4TU9A 1TK8A 4NXMJ 2XCOA 1N5SA 2V9WA 2DPJA 5I42A 3W1YC 4U7UD 2ZBRA 1VS3A 2VV5A 3VZHA 1SJ4P 2EFOA 3HD1A 1AZSA 4QIGA 3L4JA 1BDFA 4A47A 3K2YA 5D0GA 5M3FK 4X4SA 3OL8A 4USIA 3MEEA 3DC2A 3RYLA 1OO0B 3BSOA 2DY9A 3KK3B 3EVWA 4RKUC 2HIQA 1HNIB 2C2KB 4UY85 3EDRB 3F44A 3HOVC 4ECZA 3M8WA 3NUHA 2E2HK 3H42A 3MWBA 1J27A 4NE9C 2BUNA 2HQDA 1YSJA 1VIXA 3PYGA 5EDWA 2KYZA 2L9NA 1XR5A 4NOIA 1TTHB 2IM2A 3ISZA 3EGWB 1U25A 1RE1B 1XNRJ 1N5QA 2A18A 3UW1A 4ANCA 5HI7A 5HO4A 2UUAF 2F8MA 2EKYA 1BD6A 5KFQA 1R8HA 3PYFA 3GFYA 5ETQA 3NXZA 1Y5LB 4WFBQ 2DXEA 1ZZNA 1RAIB 3HSZA 4PG5A 3OLBA 4JI0J 1RTJB 4LVNP 4OI4A 1FF2A 3JYTA 4HEA9 3J80U 2ZH1A 2QE5A 3W2WB 3CXCR 1SFOA 2B6AB 3OJSA 2F5GA 2Y1IA 2K7KA 4QJVB 3G86A 1TK5A 4OZ3A 1KD1T 2BOPA 1LFPA 3DLKA 4PQUA 1XC9A 2JA6A 2EW9A 1IKYA 1BWVA 2QYCA 1IKVB 1FNMA 2ZNYA 3HZGA 1C1BB 1CEZA 2UUWA 1S6OA 5HL8A 1SJ1A 2F8EX 4WFXA 2HQIA 2HRUA 3KKFA 2H51B 2W7AA 1MN9A 1F5AA 1CPZA 1ZXOA 3H5YA 1V3ZA 2J6TA 3M1VA 1UEVA 1HD1A 3M2RB 4Q0BA 5KT3A 1ZYRA 4EU0A 2MKCA 3BQ2A 3GTGA 5JMNA 1RAAB 3FGVA 4A8KA 2L08A 1W26A 4Q5SA 3GCXP 1E6YB 5A8RB 2D6FC 1EKRA 2W9AA 5J2QB 1S7HA 4WXWA 4O44A 4ED0A 1UEUA 4FNIA 3M6UA 2XB2D 3D6TB 1VQNS 3CVKA 2HS4A 3H3VL 5F9LA 5FD1A 5T7LA 1ZTTA 2JSXA 2B63C 4KRWA 1FEEA 3HK2A 5E7OB 1I3QK 3A1YG 4QQBA 2J5AA 3SEOA 5ETKA 4KKOA 2F9JA 1CSJA 1IBCB 2H5JB 1JLAB 5HJXA 5KFPA 3AJDA 3BBCA 1I6JA 3T3FA 1SFOK 3OTOJ 3VVUA 1AUSL 1WHVA 5GMEA 2E2JK 2CXEA 3TFHA 2I5JB 3BN4A 2HQGA 4EO6A 1XBWA 3GTLK 4WPAA 4RBUA 4BHQA 3GFXA 3A12A 5DZ6A 2FPHX 4AXIA 4J9PA 1XZPB 1KSPA 3MR7A 3C19A 1NCLA 2ZBIA 1GE9A 2P8TA 3UN3A 4CWBA 4NA3A 3MD1A 1N8RT 2VG7B 2CJXB 3GJSB 2NVQK 4GMKA 3IN5A 5E3QA 4OHZA 2RGRA 1TKZB 4K4XA 3UI3A 1RT4B 5JVHQ 4LFBJ 4EYHB 1YHQS 1UW9A 1X4AA 1JLCB 3HVTA 5B7WA 4PUOB 1OQ6A 4IG3A 4URQU
chains in the Genus database with same CATH topology
1WOSA 3TTGA 1VRQC 1WOPA 3GEEA 3AD8C 3ADAC 1XZQB 3A8JA 1XZPB 1VLOA 3A8KA 1XZPA 3GEIA 5L46A 2GAHC 1WORA 1WSRA 1X31C 2GAGC 3TFHA 3GEHA 1WOOA 1PJ6A 4PABA 3TFIA 3AD7C 4P9SA 1PJ7A 3GIRA 1V5VA 4PAAA 3TFJA 1YX2A 3GSIA 1XZQA 1PJ5A 3A8IA 3AD9C 1WSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOS A;  3TTG A;  1VRQ C;  1WOP A;  3GEE A;  3AD8 C;  3ADA C;  1XZQ B;  3A8J A;  1XZP B;  1VLO A;  3A8K A;  1XZP A;  3GEI A;  5L46 A;  2GAH C;  1WOR A;  1WSR A;  1X31 C;  2GAG C;  3TFH A;  3GEH A;  1WOO A;  1PJ6 A;  4PAB A;  3TFI A;  3AD7 C;  4P9S A;  1PJ7 A;  3GIR A;  1V5V A;  4PAA A;  3TFJ A;  1YX2 A;  3GSI A;  1XZQ A;  1PJ5 A;  3A8I A;  3AD9 C;  1WSV A; 
#chains in the Genus database with same CATH topology
 1G6B A;  3N79 A;  3MCN A;  1HPZ B;  2H54 B;  5J2P B;  5H1S V;  4DDQ A;  3W60 A;  4GZY A;  4JI0 F;  4DHV A;  2GZO A;  2V2V A;  3M8Q B;  4MIB A;  4J9S A;  3U1L A;  3AD9 C;  3JXO A;  1TWH C;  4NEY A;  3CDA A;  2CPI A;  4KO0 B;  2CQD A;  2XTJ P;  1SBR A;  2Z2Z A;  2IA0 A;  4DL7 A;  2G13 A;  3RRH A;  3RGI A;  3UCG A;  4A8M P;  3HSJ A;  3R5J B;  5JUM A;  1UVL A;  1URN A;  2GHP A;  1M5H A;  4KV8 A;  5LSO A;  3GV7 B;  2HRY A;  4EEY A;  1S9E B;  4OIO A;  1K44 A;  3QYY A;  2UXB F;  2CQ2 A;  2HGN A;  3AQP A;  3QZ7 A;  5EUH A;  5IT0 A;  4IKA A;  3PVX A;  2I2Y A;  2J0S D;  1HYS A;  2D7S A;  4FVC A;  3DLH A;  4CLT A;  1LQ9 A;  4L75 A;  4ED4 A;  2FTR A;  2UUT A;  1BUX A;  4H4K A;  5AJ3 F;  1IM6 A;  2Y1J A;  5L9X A;  1RXO B;  3P96 A;  1M5K C;  3UNY A;  3NS7 B;  1SC3 B;  3FK4 A;  1QSL A;  3OPF A;  5C7P A;  4B9M A;  2ZD1 A;  2VG5 A;  4DV5 F;  4F02 A;  1ELO A;  4WFA Q;  4CTA A;  2E2H C;  4ZVG A;  3PX0 A;  3EUN A;  1SC1 B;  4I7F B;  5F8G A;  2IC3 A;  3MUM P;  2NXC A;  2YNH B;  1RT7 A;  6FDR A;  4NCG B;  4CLY A;  3CMA S;  4RUA A;  5IYC C;  2FGC A;  2GSN A;  4AL6 A;  5KAK A;  2E1M C;  3OR1 B;  2BE2 B;  1RGV A;  1GMV A;  2W2Q P;  1S9E A;  2VH7 A;  4OHV A;  3EIC A;  3CE8 A;  4WP9 A;  3IAS 9;  4OMF G;  1ZH5 A;  3BBB A;  1Q8I A;  1R6Y A;  3DU5 A;  3G8S A;  1RT6 B;  2HWH A;  1O2A A;  1U1Q A;  5DZ7 A;  1YRU A;  3PW7 A;  3FKI C;  1KBR A;  2XO6 A;  1AT1 B;  3BGU A;  2RIJ A;  2AEM A;  1Y3K A;  2V67 A;  1HBO B;  4U96 A;  4XPE A;  1Y3J A;  2ATC B;  1HI8 A;  1U4B A;  1PSD A;  2VUM K;  4MK8 A;  4PXB A;  3TUP A;  1ZA2 B;  2AIR B;  3D5M A;  4C8Y A;  2AEF A;  1HBM B;  5D0E A;  2DIT A;  4OI1 A;  5CCM A;  5F9N A;  1RTD B;  3OFE A;  4GO5 X;  1E6Y A;  5A8R A;  3NGS A;  4N56 A;  2JJ4 D;  4TNO A;  3JQJ A;  2CWK A;  4DV2 F;  3POT A;  2N3O A;  4C9D A;  2XMA A;  5J2M B;  4G1I A;  3HHL A;  2H65 B;  2N4D A;  1XIQ A;  4DV6 J;  4CO5 A;  1LWC B;  1UVN A;  2MKY A;  4ILM A;  3MF5 A;  1Q7Y T;  3KNA A;  4WP8 A;  2B63 A;  4CO2 A;  2AJ2 A;  4R5P B;  2BEF A;  1KOH A;  2JA5 C;  1O5J A;  2Q66 A;  5DLF A;  2PPB A;  2YWH A;  3BKF A;  3HVA A;  5MLC V;  1N32 J;  3GG1 A;  3DRR B;  4X64 J;  4TLQ A;  4AUK A;  4WWS A;  2QGF B;  4JI3 J;  3TAQ A;  1KC8 T;  3GZ7 A;  4JI1 F;  4LSL B;  2HHH J;  5KFJ A;  2A1B A;  3MUV P;  2Z57 B;  3T01 A;  1M90 T;  3JTN A;  1HPZ A;  4I68 A;  2FYX A;  1SIZ A;  4DX6 A;  2EC2 A;  3CME S;  4DSK A;  2CQ1 A;  2RT3 A;  1ZPV A;  2ZJP Q;  1U7L A;  5C4J K;  4OL8 A;  1OQ3 A;  1D3W A;  3BKT A;  5AJ3 J;  1EAY C;  2RIL A;  1BJT A;  2GJI A;  1MU2 A;  1LOU A;  2E1A A;  1U09 A;  4BXX C;  3PX4 A;  2W25 A;  3NKY A;  4DR2 J;  4ED3 A;  3GTL C;  3QT6 A;  3QWU A;  1NZA A;  2M52 A;  1R7I A;  2JLG A;  4H4M A;  5D4D A;  2F4V J;  1RTH A;  2FHK A;  2W9B A;  3HOU K;  5K8N A;  2W24 A;  2IFX A;  3KNG A;  2QSW A;  3PW0 A;  1FKA F;  4QIE A;  5I3P A;  2RF2 B;  3KHH A;  5TJ3 A;  2JX2 A;  3UNG C;  2A6H A;  5GAE I;  1O29 A;  4HTI A;  4DI6 A;  3SDE B;  3R2C J;  4NA1 A;  3RR7 A;  5DS7 A;  3W65 A;  3L7O A;  2KWA A;  5HLF A;  1CBK A;  1TUG B;  1EET B;  4QBU A;  4DR1 J;  4P2S A;  2BX6 A;  4UQT A;  1IL2 A;  1TL7 B;  2HHQ A;  1NSP A;  3GFZ A;  5F8N A;  4P75 A;  4Q43 A;  2VDH A;  3IPJ A;  5KFW A;  3I5C A;  3C2P A;  4WK1 A;  3UD3 P;  3AXK A;  3H7H B;  3HP6 A;  2OD6 A;  2MKK A;  3S1M C;  3HJV A;  1TWH K;  2RQM A;  2ZOG A;  2YQ0 A;  1DY3 A;  4O2D A;  4BLA A;  1S0N A;  2OSR A;  5C24 A;  3IS9 B;  2Z2M A;  3AA8 A;  3M2R A;  1GX5 A;  4WFN Q;  5M5W K;  3H40 A;  2FC8 A;  3QJJ A;  2CUY A;  3AFG A;  3NNC A;  3BYP A;  3W7B A;  4K4T A;  2NVQ C;  3GTO A;  3T6J A;  3SCL E;  4LSN A;  3DRP B;  3HLU A;  5F3T A;  4DL4 A;  3GJQ B;  2NVY A;  3WX8 A;  1S6P B;  3EWG A;  1DQA A;  2RKI B;  3ZZ0 A;  2PMZ D;  1TL1 B;  3M4X A;  3RZD C;  3RRK A;  2WON A;  3B4D A;  1EP4 B;  3PAC A;  1JX4 A;  2QTW A;  1HNW J;  1RWM B;  5KFG A;  3AY0 A;  3ITH A;  1R43 A;  3RBD A;  4QIW L;  4IRD A;  4FBT A;  2A2C A;  4CO0 A;  2YTC A;  5E33 A;  4ZIV A;  4USM A;  3T19 A;  1DUR A;  4Q8F A;  4FDF A;  4WZQ A;  1X5O A;  4HDG A;  3M8S A;  3PCO B;  1CVJ A;  3TFI A;  1T3O A;  2WAQ D;  3KLG A;  2A6E A;  3I4H X;  3TO8 A;  3DGP B;  3AH5 A;  1HQ2 A;  2V34 A;  1RDR A;  3IMQ J;  2I6W A;  4KPY A;  5SUH A;  4RUC A;  1USM A;  3MEG A;  1JLG B;  4MQ9 A;  3M9M B;  3SQO P;  3JST A;  5LMU F;  1CJT A;  1PKU A;  4LF8 J;  4C3H K;  2B9X A;  4ENO A;  2FHM A;  5IZH A;  3W3S A;  4O3P A;  4C8L A;  3AOB A;  4X84 A;  2VIC A;  3VAK A;  2UUB F;  1WWH A;  1RLD A;  3UN2 A;  4ZJQ A;  2WSE C;  1B3T A;  2W7O A;  4I6Y A;  2MGZ A;  4YY3 J;  2JEF A;  4LF1 A;  1X9W A;  1SJ3 P;  2MQL A;  2JVO A;  4C8O A;  1VRT B;  3GFH A;  3NCQ A;  5HQL A;  1PIE A;  1YJV A;  4Q7A A;  4P72 A;  5DDP C;  4KHM A;  4DSI A;  2BKN A;  2OML A;  2BRK A;  3ZTR A;  2JFK A;  4P2M A;  1JJ2 R;  2E9R X;  3L3C A;  3TA0 A;  4MT1 A;  4JI7 J;  4DPY A;  1S6Q B;  5E41 A;  5FII A;  2ALY B;  2F8H A;  2KVI A;  3WDO A;  2XCQ A;  4RMF A;  2W7P A;  1J5E J;  2IRX A;  1EHW A;  3Q8P B;  5M5Y K;  7AT1 B;  5IS2 A;  2R8K A;  4KM8 A;  4OZ2 A;  4R25 A;  2DT9 A;  4OZJ A;  1IN0 A;  1IBM F;  2HAF A;  4OHY A;  2YNI B;  4ZLL A;  4CH7 A;  1RHJ B;  4B02 A;  1XZQ A;  2HVH A;  3CCS S;  4I56 A;  1S77 D;  3DRS B;  4DLE A;  4TY9 A;  1ZBS A;  4W98 A;  5BYR A;  4OI6 A;  5C5J A;  3FFI B;  3GDZ A;  2EFQ A;  3LP0 B;  1WHW A;  5IQ6 A;  4ZCM A;  4PRF A;  3ISN C;  2RRN A;  3KG1 A;  1U24 A;  5DQI A;  3O1L A;  4PG8 A;  1INN A;  4BBS C;  3I9Z A;  2DJW A;  3HPO A;  1TKD A;  3O2I A;  3UD4 P;  2PEB A;  3DOL B;  2HG4 A;  3MUR P;  1F7U A;  1FKO A;  1VFJ A;  3OFF A;  4ETZ A;  4X4O A;  3E8O A;  2Z2L A;  2PMH A;  3GTL A;  3CGI A;  3LGN A;  4U95 A;  3H5U A;  4M1X A;  2GVD A;  4NL5 A;  2X1A A;  2YXL A;  4LIR A;  3FCH A;  4OFZ A;  2YWG A;  2Q43 A;  1WJ9 A;  2WVF A;  2IVY A;  5E3R A;  3N0B A;  4KY3 A;  4IR1 A;  2RQK A;  4FXV A;  5M5X K;  4J9N A;  4BBY A;  4ERD A;  1J2V A;  4ZS6 A;  4USU A;  4DPW A;  2R92 C;  2E5J A;  4HYK A;  2HNZ B;  2KG0 A;  1IJE B;  2MHN A;  3OTE A;  3TAM B;  2WW8 A;  4X4P A;  3SCJ E;  3ZZZ A;  3NGD A;  1Y7P A;  2DH7 A;  4L73 A;  2HVZ A;  2NXN A;  1DLO A;  2XI3 A;  5EX3 A;  2XLI A;  4Y7N C;  3I31 A;  2J9D E;  1NM2 A;  3NNH A;  5KFD A;  1FVS A;  3C66 A;  2QL9 B;  3UDV A;  1T8E A;  1HNV A;  1P9Q C;  4JYA F;  2R92 K;  1M5V C;  3N6L A;  3KXD A;  3VQT A;  1VQ4 S;  4KMH A;  3I32 A;  3WQP A;  2MXY A;  3HZE A;  3H4B A;  4USH A;  4CIO A;  2R7X A;  4NYZ A;  2JLF A;  2GHW A;  2UVR A;  2VBX A;  5F0W A;  4LF5 J;  4K5S A;  1K8A T;  2NPF A;  4CLU A;  4LF9 J;  2VQF J;  5HMW A;  4LF7 J;  4OYO A;  4TKT A;  4OYM A;  5KT2 A;  1RA7 A;  2X7I A;  4NZ7 A;  2BV3 A;  2DYA A;  2DNN A;  3V5R A;  4C8N A;  3BP3 A;  1IKV A;  1DRZ A;  3S2H K;  4QWE A;  3ZO7 A;  4DV4 F;  2B8P A;  3MXH P;  5CAA A;  2C2O B;  3GTG K;  4GTE A;  3C3L A;  1JJ4 A;  3W8P A;  5KFO A;  4CYU A;  4X2B A;  1RHQ B;  3N3Y A;  1S57 A;  3ILJ A;  4LFC F;  4USW A;  1VI7 A;  3NGU A;  3RZO K;  4X4Q A;  3JS9 A;  4DFK A;  5ETP A;  4BLG A;  4CH1 A;  4NA2 A;  1FFS B;  4R8U B;  1IBK J;  4ZP7 A;  1FT8 A;  2V4J A;  5A0Y A;  2X1G A;  2IIH A;  2HFU A;  4B17 A;  1N33 J;  4CT9 A;  2AJ1 A;  4PG6 A;  4C3I C;  4GFQ A;  1IXK A;  3MPY A;  1RAB B;  3FQK A;  4LQ9 A;  3S1M K;  5J2M A;  2KXH A;  2JA6 K;  2AF6 A;  5GVQ A;  2EC0 A;  1S1U B;  4ECX A;  5B08 A;  1TWA K;  2RQ4 A;  4PR6 A;  4DV5 J;  2E9T A;  2CFA A;  1DZ5 A;  5HRO B;  2DR6 A;  2HGM A;  3JSB A;  2JA5 A;  4N76 A;  3OV7 A;  2IYI A;  4HTJ A;  4CO1 A;  3QAT A;  2YNG A;  1ARO P;  4DUY J;  4N47 A;  1CS4 A;  3RBX A;  4FYX B;  1NME B;  3K5P A;  4WJ4 A;  1GMW D;  1YVF A;  4HH0 A;  2VG6 B;  2FLP A;  3GIK A;  3ILL A;  2GAH C;  4HLB A;  2HHX A;  2RH6 A;  3CCE S;  2YKP A;  1N34 J;  1HI0 P;  3TRG A;  3GIR A;  5B0D A;  3HJF A;  1HWU A;  4DPU A;  2CQ4 A;  2YNH A;  5IT4 A;  2VKZ G;  5DM7 Q;  1Q53 A;  4NLP A;  4XLP A;  4DR5 F;  2DGX A;  5A2Q Y;  3NMR A;  4CYU B;  2CG4 A;  5K5M A;  3BGF A;  5CYQ B;  3DOM A;  2UU9 J;  2B9W A;  4WYW A;  3M8P A;  1G7C B;  3ZZO A;  3UR0 A;  3MM9 A;  1LXJ A;  3PW4 A;  1NDK A;  2DIV A;  3ENW A;  1VC6 A;  2CPD A;  4B9T A;  2RS2 A;  1JLB B;  2EK1 A;  2YU9 C;  4ECT A;  4UY8 T;  2FD2 A;  4C7Q A;  3DGP A;  4D3G A;  4N8N A;  2IMW P;  1FDA A;  3PFO A;  1SL1 A;  1RKI A;  3PRD A;  1WKJ A;  4KIA A;  1RT1 B;  2KKH A;  2RSQ A;  1VBZ A;  5J2N A;  3DM2 B;  4ZVT B;  2IM0 A;  1Y9O A;  1ZPW X;  4DX8 H;  3NWG A;  3QAU A;  2ZHB A;  4HVZ A;  1XR6 A;  3PNI A;  4O0I A;  1HNX J;  3QZ8 A;  2YY3 A;  2JZ5 A;  4UST A;  2XSJ A;  5KT5 A;  1OS5 A;  4Y52 K;  1V5V A;  2XMJ A;  4ED1 A;  1L3U A;  3QAE A;  4ZVO B;  4X6A C;  2DGO A;  2FJX A;  1S10 A;  4GTA A;  1IWG A;  4YP3 A;  1FDB A;  2PDA A;  1Y5I B;  4KGK A;  5JFE A;  3RAX A;  2YPY A;  2BE5 A;  3KMS A;  2GJ2 A;  1YZ7 A;  1RJJ A;  4KB2 A;  4WFZ A;  1N36 J;  5CYJ A;  2ZWO A;  4F8R A;  3ENQ A;  3SBM A;  3E2E A;  5DQG A;  4TYA A;  4JK1 A;  4X64 F;  5IM0 B;  1BY9 A;  4JI3 F;  4YHH J;  2OKQ A;  2HLU A;  2VG6 A;  4WZM A;  1Q79 A;  3I4N K;  2J0Q D;  4C11 B;  1RQ0 A;  1DQ9 A;  3D6F B;  4KC5 A;  3BQ1 A;  2L9D A;  2ZBC A;  2B5J B;  2VBY A;  4OYA A;  2Z30 B;  9RUB A;  3AA9 A;  4DSL A;  4ED6 A;  3H0G K;  2N7C A;  5ETO A;  2GQ2 A;  4ZPV R;  3OHB A;  1WC6 A;  3EYZ A;  1J5O A;  3HVT B;  4LQY A;  1VMB A;  2APO A;  1MWZ A;  3ENV A;  3FBB A;  3A8J A;  4A3F C;  2MZT A;  3J7Y I;  4NI2 A;  2M70 A;  2Q3P A;  1N52 B;  2DGT A;  1C0A A;  4I2Q B;  1SKU B;  2NVT K;  1KQF B;  4DCO B;  2OH2 A;  3I56 S;  4CP5 A;  4DUY F;  1YIT S;  4ICL A;  3H0G C;  3KLH B;  4YFN A;  2YX7 A;  4ES1 A;  2KHC A;  1H3D A;  2GO8 A;  4B3O A;  2ZDO A;  5G0R B;  2OTJ S;  2BJE A;  1TWA A;  2DK2 A;  2LQJ A;  2COL A;  3KDO A;  5GAD I;  3QO9 A;  2W8L A;  4Q45 A;  3GPA A;  2JHE A;  3D68 A;  5GMK a;  3NCP A;  4H4M B;  2NQP A;  3A3O B;  1S1X A;  1B70 B;  2IVF B;  2ROE A;  3W2V A;  4DPX A;  1LWX A;  3AQO A;  3MUT P;  2ROP A;  4NCA A;  2ZJR Q;  4C0H A;  4LRD A;  4DR5 J;  4F2S A;  1JQW A;  4J9V A;  4J5O A;  3S1N C;  4FKX A;  3R5C A;  1FX2 A;  1HR0 J;  1Y0H A;  3N5B A;  1RWW B;  1L3T A;  2FY1 A;  3KLI B;  1NK5 A;  3ZFV A;  3G8Q A;  3UD5 A;  5D77 A;  3W66 A;  1X4H A;  4U8Y A;  1HQM A;  3Q22 A;  1GTH A;  4C8Z A;  2BZ2 A;  3QIP A;  1RAC B;  3HXM A;  3UPF A;  5KG1 A;  2PI4 A;  4NZ6 A;  4ID5 B;  3C6T B;  1LK7 A;  1XWL A;  5HL7 Q;  5KFI A;  1YZ6 A;  3GIM A;  5CYM A;  1PG5 B;  2CFA B;  3VGV A;  3PZP A;  2OGU A;  1Q7L B;  4EZ6 A;  2YH1 A;  2AZ1 A;  3HOU C;  1X5P A;  3DRX A;  1S48 A;  5CD4 A;  3MCM A;  2MZS A;  3BGO P;  4RW9 B;  4M95 A;  1VLO A;  4M5H A;  2AU0 A;  2ZUF A;  2FLO A;  3OXF A;  4UTG A;  3CPW R;  4B3M J;  3KFW X;  1NDC A;  3RAM A;  3N28 A;  2NS1 B;  2NSB A;  1O6X A;  2KB2 A;  3CCR S;  3LH2 S;  1RHM B;  5KT7 A;  4FKY A;  1NKE A;  5KG6 A;  4K4V A;  2CIM A;  4QJV A;  5H9E K;  1XNR F;  3D9B A;  3MR3 A;  3HOZ K;  5LSL A;  3TX0 A;  2POK A;  5CCL A;  1XK8 A;  1RU0 A;  1M5O C;  1F9F A;  3D54 A;  1NBE B;  4MH8 A;  2LDY A;  3CCL S;  1G1X A;  2X3G A;  3CED A;  2MQQ A;  2CQB A;  2Y0B B;  4MEX A;  3DU6 A;  4W4M A;  4GRS A;  1RTD A;  2L3M A;  1SH3 A;  1KKH A;  3X3U A;  5HBM A;  2CJQ A;  2BMB A;  1KVK A;  1EET A;  3P5B P;  2NXJ A;  1FTR A;  4DV2 J;  3HOZ C;  2G1D A;  2GVZ B;  3FRY A;  2ASJ A;  3M6V A;  3VV2 B;  2E66 A;  4G1P A;  5EWE A;  2XY7 A;  2KZM A;  2FC9 A;  3BEG B;  2WVB A;  7FDR A;  4LRE A;  3P6Y C;  2VOO A;  4DBQ A;  5A76 A;  4DU8 A;  4ECV A;  1EQ0 A;  5K9F A;  1H6K X;  4K4Y A;  4URG A;  4A3K K;  3FQL A;  1F3V A;  1R0C B;  2KRR A;  2HS3 A;  4K4Z A;  1TAU A;  4EO8 A;  2JLE A;  1CJK B;  3NAI A;  4ZCL A;  1TWG K;  1NK7 A;  4DX5 A;  4WFY A;  4ILD A;  4C97 A;  3GTP K;  4NCG A;  3PKY A;  1QTN B;  5ETT A;  3LP2 A;  3DRR A;  3BF4 A;  2OJ3 A;  2HVI A;  3BV8 A;  3TQ1 A;  1HMV A;  4G1Q B;  4JI8 F;  2CG8 A;  4F3O A;  1SJQ A;  3IBF B;  2YWK A;  3BGL A;  5DJB A;  3ZZR A;  4ZVQ B;  5B09 A;  3NBP A;  5A6W A;  3LQV A;  3BO3 A;  5GAG I;  4IUF A;  4Z37 A;  1R8C A;  3PR4 A;  5I3Q A;  4Y52 C;  1U2F A;  4X65 J;  2PFD A;  4YDD B;  4NRU A;  2PI5 A;  3HT0 A;  4X6A K;  1WEL A;  1HFE L;  4KHR A;  1KFD A;  5FLX U;  2CPH A;  4M94 A;  2CZV C;  1TMJ A;  3V4M A;  4RW7 A;  1FO1 A;  2GAG C;  1BMQ B;  2ILY A;  2YKN A;  1X0F A;  3SSS A;  1MN7 A;  1R89 A;  1PJ7 A;  1M5S A;  4C8M A;  4WXO A;  4S0M A;  1AZS B;  3KG4 A;  1D8Z A;  2V9K A;  2HFO A;  3MI7 X;  3FOE A;  3PFE A;  2W2M P;  3DLK B;  4DR3 F;  4RWW A;  2J9D A;  4Q2L A;  3SCK E;  4OLO A;  1XXC A;  3D3B J;  1SJF A;  1OSD A;  4MK7 A;  3ET6 A;  3LP2 B;  4FS1 A;  1NK0 A;  3D0I E;  4YUD A;  4C11 A;  2XSF A;  3ITH B;  4RW6 A;  3AB2 B;  3V6D A;  5IOT A;  2ZZT A;  2P6S A;  1XMO J;  3UQS A;  1KEK A;  2VPZ B;  4XPC A;  5IQQ A;  4DG1 A;  5EHH A;  2D69 A;  1VH2 A;  4K59 A;  3B6B A;  3E51 A;  4EUV A;  4J9U E;  2V6A A;  5K8M A;  1O25 A;  1UTA A;  4RPF A;  1WSV A;  5J1E A;  4OYW A;  4XO0 A;  5IYD C;  1UET A;  4KR0 B;  2P5V A;  3AXM A;  4DFM A;  3KHG A;  4Q8E A;  2H9Z A;  3CIZ A;  2K2P A;  4PG4 A;  1Y11 A;  3FC9 A;  2CQ3 A;  1WHX A;  4MAK A;  1KFS A;  4HI2 A;  4MKB A;  3U1M A;  2EFP A;  2JA7 K;  1R0A B;  3GTP A;  1KWM A;  1PCA A;  1KRP A;  4Y2M A;  3D28 A;  2C3P A;  5FJ8 K;  5K8O A;  4DQI A;  2IVM A;  2AQ4 A;  4YR0 A;  2EBE A;  4GTB A;  2OP5 A;  2G4B A;  1S1T B;  3G6V A;  5T41 A;  2FJV A;  5CYQ A;  1XQI A;  4KQZ A;  4DPO A;  2OPS A;  3OVS A;  3TVZ A;  2WVE A;  3GTQ A;  4U7U K;  1FHT A;  1AFJ A;  1RBA A;  4UOF A;  2ABY A;  2XNQ A;  1YG0 A;  1ULR A;  1RAD B;  4FM9 A;  1FI4 A;  1TUV A;  4M5M A;  1QSS A;  3TJA A;  2V50 A;  3Q0A A;  4DV3 F;  4KAS A;  5IWA F;  1G3O A;  3CCZ A;  3NGK A;  3ERE D;  1TWF K;  2MY7 A;  1BLU A;  4JI2 F;  2ZH2 A;  1WIH A;  3MMJ A;  2ZH9 A;  3S7R A;  2DGV A;  2FGO A;  1UP1 A;  3ZZY A;  3DXB A;  1WKL A;  3KUE A;  1SI9 A;  2JC1 A;  3PHT A;  1VQS A;  3GU0 A;  3OTC A;  2VPY B;  1KVJ A;  3J7Z 5;  2DEI A;  1ZM2 A;  3K7A K;  5KFE A;  4KB4 A;  2Z8Q A;  1LXN A;  4N77 A;  4WYL A;  2Y3P A;  3V6H A;  4DR6 F;  4OZ5 A;  3DLL Q;  4KHP J;  2KT2 A;  5D3G B;  2WBM A;  2FJE B;  4A8F A;  1YCL A;  4Y2K A;  2J9C A;  3I5A A;  3JAM U;  2UVV A;  4B3R J;  2RF2 A;  1LK5 A;  2AZ3 A;  1R3N A;  2V4J B;  2UUB J;  4ITS A;  1OPI A;  3K7A C;  4ZCK A;  1JK9 B;  3MM7 B;  3Q8S B;  2G0J A;  2UVU A;  5FLM K;  3FCW A;  2CNK B;  1FKP B;  2WON B;  3GMG A;  3EE3 A;  1S97 A;  4TY8 B;  4ES2 A;  1S49 A;  5HP1 B;  3H3V D;  4A3B C;  1KTV A;  3OVA A;  1HNX F;  2UUC J;  4M5I A;  4NLV A;  2HAI A;  2I0X A;  2W7V A;  4LK0 A;  1N48 A;  2VG7 A;  4ZVR B;  3TEG A;  1H0H B;  2OPS B;  2HQC A;  1KS2 A;  3DMJ B;  2ACY A;  5HN0 A;  3FUY A;  3RUB L;  1TV6 B;  3OEP A;  4O3R A;  3BZQ A;  4FZV A;  5KFF A;  4IG3 B;  1QDU B;  4DN9 A;  3T02 A;  3VCD A;  1HWJ A;  2CQG A;  3JSM B;  2WSC C;  1SV5 B;  4K2J A;  2DXD A;  2CVE A;  4I69 A;  2LXF A;  3DOL A;  3CCM S;  1WCM C;  2KT5 A;  1Q4R A;  2NVY K;  2DVI A;  1T0T V;  3IM9 A;  2JOQ A;  3GON A;  1HHT P;  3ORE A;  2EBB A;  1RA6 A;  2C3Y A;  3PO4 A;  2PO4 A;  1KOO A;  1I6H K;  3HSG A;  5BR8 F;  1VQ9 S;  2A6O A;  2XMK A;  1ROF A;  4C8K A;  5LMN F;  4RZR A;  2RB7 A;  4ZH4 A;  1FKP A;  1UPP A;  2R42 A;  5E3P A;  4QYZ K;  3HXA A;  5DRK A;  3W64 A;  4K4S A;  3S8S A;  2WB1 L;  4ZLJ A;  2GQQ A;  5HP1 A;  3JSY A;  3G4C A;  1PAU B;  1F9N A;  2OTL S;  5A2Q U;  1HWL A;  4ZJO A;  2XSJ B;  1I6H C;  3RBE A;  3ZZT A;  1U0H A;  1YBT A;  2JVR A;  2MZQ A;  4MIA A;  3PYE A;  2CNO B;  4QR1 A;  3GTJ A;  2GML A;  4UOH A;  2ZH4 A;  2KFZ A;  4DSF A;  3LW5 C;  3J81 U;  2VBW A;  2FLN A;  2WVD A;  3G6X A;  2EBG A;  2B4O A;  1XNQ F;  3HKZ L;  3HCX A;  2MQP A;  4NXN F;  4BY7 K;  3GR0 A;  3HOY K;  4P71 A;  2OEM A;  1RT7 B;  3G4A A;  2C2N A;  1JJC B;  1X31 C;  1SVD A;  3M32 B;  1VRT A;  3S1R C;  3C15 A;  5CJ9 A;  1YJU A;  3Q83 A;  4J9M A;  4FXD A;  1K1S A;  4UW2 A;  2QMU B;  4JV5 F;  1YBA A;  2AYB A;  4ZMM A;  4RNF A;  1LEO A;  4A8W A;  2WCX A;  4A48 A;  1VYA A;  3I96 A;  1TWF A;  3QT8 A;  2F1F A;  1UPM B;  2D9O A;  1E6V B;  1SPB P;  3IR6 B;  3FBF A;  3MCS A;  3K5O A;  1N4L A;  1HKA A;  4KC6 A;  3C6U B;  1VOM A;  1U02 A;  3TA1 A;  4KGM A;  5I42 B;  1HNZ F;  2O66 A;  3LWM A;  3QFW A;  3NL0 A;  3M9N B;  3QRR A;  1WDD A;  2CDR B;  3BGR B;  2W4C A;  3G71 S;  2PSZ A;  4GKK J;  4A3C C;  1D09 B;  1JLF B;  4XDC A;  2VHG A;  1HMV B;  2OEJ A;  2E1R A;  2B9E A;  5BYS A;  4WKR A;  3W8G A;  2MKJ A;  1RZM A;  2AJQ A;  3VF0 B;  1A6L A;  1NJX A;  4LRA A;  3G96 A;  2K8G A;  2UUC F;  4XAK A;  1WC4 A;  1PYS B;  4IO9 Q;  4D3H A;  2B9Y A;  1JJH A;  1JLF A;  2XGP A;  2U2F A;  1RU2 A;  4O4G B;  4A3C K;  4RO0 A;  1HHQ A;  3HHL D;  1RT6 A;  4JV1 A;  1NK4 A;  1MLA A;  4MYU A;  3TAP A;  2JC0 A;  3T1Y F;  2XS2 A;  4V1A k;  4EI2 A;  2E2I C;  3UCU P;  2F40 A;  5FDL B;  1LWF B;  2BJ9 A;  1FJG J;  3VAL A;  8RUC A;  1FER A;  4J3N A;  1NSA A;  3HM9 A;  1Q86 T;  1B0P A;  3K5L A;  1YK9 A;  2H3E B;  1IKW A;  5B0F A;  3GEI A;  1GH8 A;  1CQM A;  1PJ6 A;  2Q6C A;  2ZKT A;  4K50 A;  3K59 A;  2FB0 A;  2B43 A;  1T95 A;  1S1X B;  2UP1 A;  2MMY A;  3DOM B;  3TA2 A;  2VB6 A;  3M6W A;  3BPD A;  2ADC A;  4QR0 A;  2C2E A;  1X0P A;  4J9O A;  3GYG A;  1NSK L;  1U2R A;  4J37 A;  4ANE A;  2W8K A;  4EZ9 A;  2QV6 A;  3S14 C;  3T1A A;  3P4U B;  3T5L A;  1R8A A;  1R0B G;  1X4B A;  2JH3 A;  1PO6 A;  1XTZ A;  2IM3 A;  4A93 C;  5LT5 A;  1M5P C;  3T6B A;  1WHY A;  4YFK A;  2LQB A;  1Y1V K;  5SZT A;  2B6A A;  1AW0 A;  2J9E A;  3TUI C;  5K8P A;  2LA6 A;  4K0K J;  2HK3 A;  1WQH A;  5THW A;  2R3V A;  4MIW A;  4USK A;  2BM0 A;  3U1N A;  3Q89 A;  1FCA A;  4QWD A;  2NVT C;  4AQY F;  3MPW A;  4B3S J;  4LFA F;  2P2C B;  3BS9 A;  2ZBQ A;  3LPY A;  4TU7 A;  3CCU S;  3VZI A;  2V6S A;  1TWC K;  3UDE A;  1FXL A;  3P3D A;  2ZVS A;  2QLJ B;  3MOJ B;  4ZOS A;  4DQP A;  3GIJ A;  2OPQ B;  1C0T A;  1BWE A;  3ELH A;  4ID5 A;  1YRX A;  2OMO A;  2JWN A;  1ZET A;  1N88 A;  2A3J A;  1N0U A;  2VOP A;  2CRL A;  2DNM A;  1P6T A;  5KG7 A;  3GTK A;  1SXL A;  3MED A;  2ASY A;  3DLG B;  1U49 A;  3KLI A;  3RU0 A;  4R8U A;  2YKM A;  4WCE Q;  2UU9 F;  4DDF A;  4PUO A;  1TWC C;  3KOA A;  2ZE2 B;  3QJL A;  3MMC A;  4YY3 F;  3PHE A;  2R8I A;  1SH0 A;  4KPC A;  3EX7 B;  2AT1 B;  2VON A;  4AYB L;  1C4A A;  3GQC A;  1U6F A;  2CNN B;  4OIX A;  5LMU J;  3OL6 A;  3KJV B;  2CW0 A;  3LAL A;  4AE5 A;  1DAR A;  1Q5V A;  3IR5 B;  3FMW A;  3ZTS A;  1WOR A;  1S4F A;  1ICE B;  1UA1 A;  3OL9 A;  4IH5 A;  3CUN A;  4TU8 A;  3T1H J;  1TKX A;  1S1U A;  1LWC A;  1HW8 A;  3DM2 A;  2CAJ A;  4BLB A;  2HND A;  2RD5 C;  3R8Y A;  3HHL B;  1R9T A;  1T9Y A;  1GT8 A;  4P6Q A;  3GTJ C;  1ISE A;  3EPG A;  4EMD A;  3CJ3 A;  3PIO Q;  5F41 A;  1RYR A;  1S5Z A;  2V68 A;  1UW4 A;  3W9I A;  1GAO A;  4ZP9 A;  1E6V A;  4GKJ F;  1P9Y A;  4RNM A;  4C3M A;  1VDH A;  2KRB A;  3VA7 A;  4RR5 A;  3KK2 A;  4JB8 B;  3NP5 A;  1Z4U A;  1OWX A;  4W90 B;  3DXS X;  4CO4 A;  2PD1 A;  4CLF A;  2F63 A;  3NS6 A;  4DFJ A;  3TI0 A;  1Y4Z B;  3AOC A;  5KFN A;  4WKY A;  2FQQ B;  3W2V B;  4I2P B;  1VQO S;  4ZPW R;  3GV5 B;  3B54 A;  3JTP A;  4RW4 A;  3MMC B;  2DR7 A;  3DLB A;  2AYG A;  3PR5 B;  1ACM B;  3FZ2 A;  1NJZ A;  1OY6 A;  3GSD A;  4KGV B;  3SSQ A;  2BKO A;  1H38 A;  3GII A;  3SDE A;  3W5Y A;  3ZXW A;  1V9O A;  4A3I K;  3SFG A;  3BR9 A;  1X4E A;  4LF2 A;  3M1V B;  3EQL A;  2RU9 A;  3J80 Y;  4GTF A;  4LF6 J;  4DUZ J;  1CLF A;  1RT1 A;  1B7Y B;  4G7Z A;  5EN1 A;  4J9R A;  3CO9 A;  4ZKA A;  1X7V A;  4P7T A;  3T5J A;  2V8G A;  4Y2C A;  4PWW A;  5D4L A;  2W2O P;  1RTI B;  1I50 A;  2FHJ A;  2M9K A;  3A8E A;  3KK2 B;  4N8O A;  3WC0 A;  1FNO A;  3SFU A;  2ZDP A;  3RAQ A;  1K83 C;  3PV8 A;  1ZAW A;  1NDL A;  1TUW A;  4O3S A;  1R9T K;  4CM2 A;  2UXC J;  1DHM A;  2PMW A;  1X4G A;  2HQF A;  1IKW B;  1NK9 A;  1LW2 A;  1FX4 A;  1S59 A;  4L72 B;  4CM0 A;  1NU4 A;  1X9S A;  4DU7 A;  1SKR A;  1B0T A;  1Y1W C;  4DEZ A;  3CTR A;  4QCL A;  4I67 A;  4UT4 A;  4FS2 A;  1NH7 A;  4ALZ A;  1GEH A;  1HIY A;  2C22 A;  3VAF A;  3CF5 Q;  1TVR A;  1FWP A;  1WC0 A;  2MGZ B;  1LKZ A;  4TN2 A;  2WAQ L;  1K83 K;  2D3O 1;  1NJW A;  1GQE A;  1J5O B;  3QRP A;  3FSI A;  1O26 A;  4F3M A;  3IXQ A;  4RJV A;  2IJF A;  2DNO A;  4B3T J;  4NI2 B;  3OSP A;  3MAH A;  4F4X A;  2C2D A;  4DWI A;  1X4D A;  1YIJ S;  2DNK A;  4PWD A;  2YQ3 A;  3MFH A;  5KFH A;  2A6M A;  4DFP A;  3M30 A;  4IDK B;  1U47 A;  3R5D A;  3J81 j;  3IG1 B;  2R7Z A;  4X4N A;  4AXJ A;  3SZY A;  1RWN B;  2XZW A;  4LBP A;  6FD1 A;  4MTP A;  5HMX A;  3DRS A;  5E3C A;  2V2Z A;  5CZX A;  3JSR A;  1GMU A;  5A8K A;  4ELT A;  2RML A;  3VGU A;  1HNI A;  2Q1L A;  1WC5 A;  4BS2 A;  5CXT A;  4A3J K;  2XZD B;  2CJY B;  1HBM A;  4OIP A;  4NPO A;  2E2H A;  2R93 A;  3SQG B;  3BDP A;  4RW8 B;  2L41 A;  5IV4 A;  1YNN A;  2E7W A;  4JI6 J;  3RB4 A;  1Q82 T;  4NZ0 A;  2G2Z A;  2NXE A;  3R5B A;  1HBO A;  4WBF A;  4BBS K;  3R7N B;  1YDL A;  2C3U A;  2K06 A;  2BJ1 A;  3KJQ B;  2I5J A;  1FRM A;  2AEJ A;  4OZ0 A;  1UVK A;  3C14 B;  5LJ5 Y;  3QBC A;  4B3O B;  1GXL A;  1F93 A;  1MWY A;  1U0S A;  2IDE A;  1PYT A;  2EFN A;  3NBP B;  3UVJ B;  4ZLP A;  3RZA A;  4C4W A;  5GAD U;  2R7Z C;  4BBR C;  1SC6 A;  4YS2 A;  2XS5 A;  4WK3 A;  3SMZ A;  1ZBT A;  4DL5 A;  4QPT A;  4ER8 A;  4BWM A;  4F4Z A;  2LP4 A;  1C0U B;  4M5D A;  3J7A 1;  1IJF B;  4PXE A;  1YTY A;  5MAO A;  4FN5 A;  1U1N A;  4XIU A;  5E68 A;  1B4A A;  4QYR A;  4NCB A;  3MEG B;  4X62 J;  1TFW A;  3HSD A;  2DRD A;  5KFS A;  2B4U A;  4DR2 F;  1EIY B;  5KFV A;  4TYB A;  3OPK A;  5F8I A;  2V69 A;  2HMI A;  4MYT A;  2R7V A;  2M7S A;  1L3V A;  1N34 F;  2C3O A;  2KI2 A;  2VC0 A;  4OYX A;  4CTA B;  2ZOF A;  3M8R A;  1EAR A;  3CC2 S;  2R7Z K;  2M8H A;  5C4J C;  2GMJ A;  1LWF A;  1VGY A;  1Q81 T;  1FD8 A;  3HHE A;  2IDL A;  4ZPT R;  4PG7 A;  3ZZP A;  3DKD A;  4CRJ A;  2P9C A;  3MPD A;  4ZIT A;  1EI6 A;  5J1N A;  2NCK L;  5AE1 A;  5RUB A;  1F5C A;  5AXK A;  4YR2 A;  1DJ0 A;  3EGZ A;  1GXT A;  1QUP A;  3V81 A;  1T9V A;  3C46 A;  2WRM A;  4HR2 A;  2B63 K;  4KAI A;  2QN6 B;  2XMM A;  4FXW A;  1K83 A;  3GTJ K;  1S1W B;  3CWJ A;  4DQR A;  1S0M A;  3OFG A;  5B0A A;  1YGY A;  1KQG B;  1I94 J;  2HW3 A;  1UCN A;  4F04 B;  4ZVP B;  3H2L A;  4FYY B;  5HBM B;  3R3T A;  4LMZ A;  4HI1 A;  3MOZ A;  4X4T A;  2Y9H A;  3CCQ S;  2HKE A;  1RBL A;  3IRX B;  4JOU A;  3EMT A;  3DOK A;  2AYM A;  1W7W A;  2A2D A;  3Q8Q B;  2GC8 A;  1YBU A;  5IP7 C;  3TP2 A;  1PBU A;  1SKW A;  2VUM A;  4A3D C;  1REG X;  3TZX A;  1V3R A;  2DH9 A;  4PYA A;  2XNR A;  3QT7 A;  3GTG C;  4HHJ A;  4ZA1 A;  1S72 S;  1DD5 A;  4DZ6 A;  2R92 A;  3M3Y C;  1HI1 A;  2J7W A;  1W2I A;  4A8S A;  1NHV A;  3P49 B;  4ZVE A;  4ZCI A;  1UVI A;  2U1A A;  5DG8 A;  2VPX B;  1M1K T;  1DCO A;  3M32 A;  2GQC A;  2K1R A;  3FEY B;  1HNW F;  3SSR A;  1FKO B;  5L8R C;  3A3P B;  4G0U A;  3KJV A;  1HBU B;  4ETX A;  5C2G A;  2QA1 A;  1XZQ B;  1KQK A;  3J7Z T;  2EFV A;  5DQH A;  3J7Y U;  4GC6 A;  4G65 A;  2VJU A;  2XYH B;  3KLG B;  2D1C A;  4F7V A;  2XLJ A;  2VA3 A;  1WOS A;  1S76 D;  3R5A A;  3L95 X;  4NYO A;  3H25 A;  1X9M A;  1R9T C;  4YB6 A;  2CJK A;  1ZM3 A;  2BM1 A;  4FNH A;  2XY6 A;  2AJ0 A;  3K5M A;  4O3N A;  2NUH A;  4NML A;  1SKS A;  1HQE A;  1IR2 A;  1IVZ A;  1C1B A;  4O3Q A;  1S6U A;  4ZLN A;  1NDP A;  4FF3 A;  1UJ5 A;  2UUA J;  2OFH X;  4YB7 A;  3P8B B;  2F9D A;  4G0V A;  1K47 A;  1XMQ J;  4QIF A;  1U6Z A;  4K7Q A;  1FE4 A;  3IGN A;  1XXA A;  3MR5 A;  3RW6 A;  4BY7 C;  4JI2 J;  1J6W A;  1FK9 B;  3BM7 A;  2IHR 1;  1Y10 A;  4CH0 S;  1WI6 A;  1XPP A;  1ITP A;  2HVE A;  1I1G A;  4L6V 3;  4ZDN A;  3Q24 A;  3UVJ A;  2B51 A;  5H9F K;  2LLZ A;  1DTT A;  4ZN1 A;  2PA8 D;  2PA8 L;  2MZ1 A;  5EGE A;  3VAM A;  1Y5N B;  4DG1 B;  4M5L A;  3H20 A;  3V4G A;  5EGH A;  4C0O C;  3WHI A;  1PGZ A;  4DV0 F;  4LF4 J;  5I4M A;  3HFZ B;  4F4W A;  2ZBP A;  1USO A;  4Q4Z A;  2B4P A;  1O28 A;  2MQO A;  1IBL J;  4DR4 J;  2HHP A;  3HF5 A;  1Q8K A;  3PRB A;  3Q8V A;  2FUG 9;  1NK6 A;  4B3R F;  2R2R A;  2B4V A;  2WTF A;  2R2U A;  3J7A N;  4HDH A;  2MJU A;  5C2C A;  4IFY A;  1IUJ A;  2MZJ A;  3T1H F;  3CJ2 A;  2DEJ A;  1ZZF A;  2ZVI A;  3BYR A;  2CJB A;  5J2N B;  2GS8 A;  5L46 A;  1YJR A;  4DL2 A;  4ZVH A;  4QPX A;  3H0G A;  4B3M F;  1H2U X;  3GP9 A;  4MKA A;  5KT6 A;  4Q44 A;  2XLK A;  3BSA A;  2J7K A;  1N5T A;  3HI9 A;  4KSE B;  1UZD A;  1NHK L;  2AMC B;  3IM8 A;  2DHH A;  2OPR B;  4ATN A;  2NYI A;  2HFS A;  1S6Q A;  1F9E B;  1JLC A;  2VL1 A;  1N54 B;  4DV6 F;  1FRK A;  2CZ9 A;  3AJ2 A;  2KJV A;  5D4P A;  4CLL A;  3MEK A;  3ILI A;  1V6H A;  2E2I K;  2DBB A;  5L9N A;  3DRP A;  4UOG A;  2AX1 A;  3TEH B;  1O24 A;  2FVR A;  4Y2A A;  2MKI A;  4EYI B;  2M2B A;  4YDX A;  4OHX A;  5KFM A;  5DG7 A;  2JA7 C;  3UDC A;  2W1B A;  1IQT A;  4XK8 C;  2BVZ A;  4LRC A;  1EQR A;  4NLR A;  2GIR A;  3KLE A;  3T5H A;  3D0G E;  1FD2 A;  4BDP A;  3LAP A;  4ZK7 M;  1LW0 A;  1D9F A;  1X4C A;  4M5N A;  1N6Q A;  5BYQ A;  4CLP A;  3CD0 A;  1GTE A;  5FJ4 A;  3MM5 A;  4P9S A;  2R93 C;  1RAJ A;  1BQX A;  4R5P A;  2DNR A;  3BH7 B;  3IP0 A;  2G2O A;  2QT7 A;  2YBV A;  1CJT B;  4QOT A;  3KJF B;  1BE4 A;  3H8Y A;  1VIS A;  1WG1 A;  5LXR A;  3CQZ A;  1T7P A;  5C25 A;  1HYS B;  4A4J A;  3I0R A;  1GK8 A;  2NXU A;  4U8V A;  3NRB A;  1RT5 A;  4LR2 A;  3FRZ A;  4FZB A;  3FEX B;  4F26 A;  1ZVU A;  4KKO B;  1NJY A;  1NKC A;  2ALZ A;  2QFJ A;  4LF7 F;  3ZNJ 1;  2HZV A;  4LRB A;  4OI2 A;  3S16 K;  4U9R A;  2KG1 A;  3WC2 A;  3TWZ A;  2EFG A;  2XMV A;  1UZH A;  5IP7 K;  4B9N A;  2RH3 A;  3BH6 B;  3T00 A;  2C2M B;  2HPU A;  1T9X A;  4DF4 A;  4ILL A;  2VFR A;  3HKZ D;  4NLT A;  4DR1 F;  4XSX A;  1UFL A;  4W92 B;  4Y65 A;  2ATL A;  3IS9 A;  4P74 A;  3ZC4 A;  2NVX C;  1D9A A;  1L3S A;  2R7U A;  1QD1 A;  1S79 A;  2MB0 B;  1CC8 A;  3RB3 A;  5L1K A;  2IYG A;  3QGH A;  2OUG A;  2Y1L B;  4M8L A;  2F4F A;  1NUE A;  2CJA A;  3S1T A;  2KYX A;  3GLJ A;  4IOC Q;  3CCW A;  3W5X A;  1VC0 A;  2HBY B;  5ETM A;  3POT B;  4URS A;  4Z2X A;  4DV7 F;  4YQW A;  2PC6 A;  2PFF B;  3RZO C;  1RTI A;  1RWO B;  3FEZ A;  4I6W A;  4LBH A;  2NVX K;  2VQE F;  5CA5 A;  1YNJ A;  4DR3 J;  2WK4 A;  1WKK A;  2E5H A;  1NLK L;  1REV B;  2V8P A;  2QFI A;  1WCM K;  4R0E A;  4RUH A;  4PXC A;  1GMW A;  3K5N A;  2KFY A;  1KHW A;  2FVP A;  1JNZ B;  2LVW A;  2QLW A;  5HVH A;  2ZH6 A;  3B82 A;  1RT3 B;  3V81 B;  2XO7 A;  4OJ3 A;  1IBA A;  5KFA A;  4KJI A;  4RL1 A;  3GEH A;  1ZS6 A;  1KTQ A;  3EJM A;  1NJI T;  1PC5 A;  2GX8 A;  4TQR A;  1VQ5 S;  1XEZ A;  2CA9 A;  3BBF A;  5DDO C;  1BS2 A;  2F3J A;  5KOX A;  2V8H A;  4PPD A;  4LBI A;  4LSZ B;  2XMU A;  1VLY A;  2NUU G;  4K8R A;  2EPI A;  3QNW B;  3CD5 A;  2J6U A;  4OYP A;  1D8Y A;  4TQS A;  3IBC B;  4ECW A;  4KAW X;  1NH8 A;  1PC4 A;  4B9V A;  1A9N B;  4A3K C;  4KO0 A;  2NPI A;  3TAM A;  3D67 A;  1VQ6 S;  3K8V A;  3IC1 A;  3M8Q A;  2E5I A;  3TR5 A;  3PJW A;  1RIS A;  1OY9 A;  3MD3 A;  3I87 A;  2ZZM A;  3GV8 B;  2J0W A;  3CQZ K;  4K0K F;  3DI6 A;  3SV4 A;  5HQ8 A;  1SL0 A;  4Y00 A;  2HIY A;  3GTK K;  4OX8 A;  2GO9 A;  3S1R K;  4LOW A;  4F4A A;  3IRW P;  1TMM A;  5E0O A;  4IRK A;  3GTQ K;  1JXL A;  2ZUG A;  3Q86 A;  4ICL B;  2CYY A;  4JI1 J;  1UKU A;  3C14 A;  5F8J A;  1WAC A;  3JAM Y;  2MEW A;  3LPX A;  1RTZ A;  3FNN A;  2ZUE A;  1Q95 G;  3V2U C;  1RLC L;  1AA1 B;  3CQZ C;  4X4V A;  3KTQ A;  4XDD A;  1J6X A;  5HAO A;  2VG5 B;  4IQM A;  2YNI A;  3C8Y A;  3VAH A;  4NLG A;  2D3O R;  1U8S A;  4OQJ A;  1N0V C;  4YR3 A;  3OLA A;  1TKT A;  2D3Z A;  4PXD A;  1GXU A;  2BJD A;  4RNO A;  1IR1 A;  1VRQ C;  1AFI A;  1S1T A;  4RU9 A;  1H72 C;  2I38 A;  4C6A A;  1TQL A;  2PT0 A;  2NR0 A;  3OR2 B;  3TAR A;  4MFB B;  2EG2 A;  5J1E B;  2PA3 A;  2UV8 A;  1VRU B;  2G2Y A;  4J91 A;  3H0P A;  3WOD A;  2HWT A;  1A7G E;  3L09 A;  1IW7 A;  1RWX B;  5A0Y B;  4PAB A;  1HNV B;  2NZ4 A;  2CPZ A;  1QLN A;  1EQM A;  1V3S A;  3BPS P;  3HVW A;  1SH2 A;  4IH6 A;  1VBK A;  2HFN A;  1R8B A;  1Q16 B;  4ILR A;  1WUU A;  1WEX A;  4F67 A;  4ZHR A;  5GMD A;  2XMT A;  2DNL A;  4GKJ J;  2V94 A;  1Z1Z A;  3G6Y A;  5IV3 A;  4AYB D;  3OL7 A;  4NLX A;  1VK8 A;  2QC3 A;  2R7Q A;  1NZ8 A;  4NLW A;  5G0R A;  2QLB B;  1RBO B;  2YKO A;  1T11 A;  4L76 A;  4JV2 A;  2W2N P;  4DCJ B;  3RR8 A;  3TZZ A;  4ZVS B;  3M9O B;  5C3E C;  5GAE U;  2EXU A;  4A3L C;  4OX9 F;  1QM9 A;  3KK3 A;  1RT5 B;  2WOM A;  1HAR A;  2M0G B;  1U1R A;  4KMU A;  2MPU A;  5KFC A;  1TKZ A;  4OI0 A;  2O5I A;  3K58 A;  1XER A;  3M05 A;  4OIQ A;  3I5B A;  4EBC A;  1I5O B;  5HVF A;  2DGQ A;  2HZA A;  3PX6 A;  1IE0 A;  3EXC X;  3B4M A;  2A68 A;  4KT0 C;  3D6H B;  2XEX A;  1WF2 A;  2QIF A;  1JOE A;  5DDR C;  4LFB F;  4DMZ A;  1U8W A;  3FZB A;  3TFJ A;  3LGH A;  3C15 B;  4ECQ A;  2FJB B;  1I94 F;  3NWR A;  1NEE A;  1NXI A;  3LAM A;  4LT6 A;  3QX3 A;  4RNH A;  4BBR K;  2C42 A;  3BN7 A;  1FJE B;  2ZUA A;  4AL5 A;  4G1Q A;  1CJV B;  5D8H B;  4ED2 A;  2P8I A;  4OX6 A;  4O4R A;  2HYI B;  5LJ3 Y;  2VF3 A;  1XN9 A;  4QIV A;  1EK8 A;  3G6E S;  2XWX A;  2H1Y A;  4N5S A;  1RHR B;  4NMX A;  1TU0 B;  3QFH A;  4ZPC A;  3TJ8 A;  4E8U A;  5ETR A;  4KMD A;  2DIS A;  3GR1 A;  2ERR A;  3HO1 A;  1UEK A;  4X66 J;  3BJY A;  4YOE A;  1VIO A;  2MTL A;  1WEY A;  2V8V A;  2JA8 C;  4U7C A;  2RVJ A;  1HNZ J;  2BDP A;  3O44 A;  2N3L A;  4KFB A;  1ZOT A;  1TL4 A;  2G0I A;  4ZP6 A;  1X5T A;  2J8A A;  2GIQ A;  1KLM A;  2Q6B A;  1RAH B;  4F0K A;  3S16 C;  3JTO A;  4IYQ A;  2QA4 G;  2V2Q A;  5K14 B;  5H9F J;  1X60 A;  1U1P A;  2AHO B;  3GSI A;  5EGY A;  1T9W A;  3H90 A;  4OI3 A;  2PMZ L;  1BQN A;  2E7V A;  2P6T A;  2B56 A;  2V8D A;  1RCX B;  4ID8 A;  3V4I B;  3SZZ A;  2GMH A;  1N5Y A;  4J90 A;  5D78 A;  3G2X A;  3F0N A;  2FZK B;  1HLW A;  2DNH A;  2ZM6 F;  1RKJ A;  5IYC K;  4C3J K;  3TYT A;  1SV5 A;  2CQP A;  3MAA A;  3EDQ B;  5CQG A;  5DLG A;  4P52 A;  3LA0 A;  1C2P A;  2WHO A;  4OYZ A;  5M2R A;  2DHG A;  3M7V A;  1YLX A;  5CD4 H;  4Q5V A;  3PTW A;  2DR9 A;  1RHK B;  2MQN A;  1YJ9 S;  1SUQ B;  2KDO A;  2N7Y A;  4WE1 A;  1G2E A;  2NVY C;  2D3U A;  1X4F A;  3TAN A;  4C3I K;  1OYE A;  2X1F A;  2HBZ B;  3M3Y K;  2HBR B;  4KAR A;  3O3L A;  2YNF A;  4V19 X;  2JA6 C;  3FKI K;  4MKV A;  1EZZ B;  2G1H A;  4NOH A;  1I50 K;  1K0T A;  3QO9 B;  5HAT A;  5BXI A;  2MY8 A;  1TWA C;  1JQG A;  2AWZ A;  5KFR A;  3OQ2 A;  2PN6 A;  1WQG A;  3DLJ A;  1J5E F;  4FF2 A;  2UV8 G;  2GHV C;  2AJ4 A;  3IA0 A;  4KE5 A;  1NB2 A;  4I2Q A;  4G7H A;  3MDF A;  4NWB A;  3GTK C;  4OX9 J;  1ZA1 B;  3P45 B;  1FRJ A;  3N9U C;  3TUZ C;  1H2T Z;  2KM8 B;  2AP6 A;  3W9J A;  1UMJ A;  3PO2 C;  4DL0 C;  1S6P A;  2BXJ A;  1C0T B;  2X1B A;  3HOX C;  2WW4 A;  3DLE B;  4DR4 F;  4DOZ A;  1S12 A;  3EM1 A;  1BHN A;  1S9F A;  2MSS A;  3N01 A;  3D4J A;  1HHS A;  2OLW A;  3D6M B;  3M6X A;  1Q1K A;  4CCH A;  2F7V A;  3H2V E;  1HI9 A;  2R4F A;  3CJ4 A;  2I8E A;  1T05 A;  4DV3 J;  1NK8 A;  2BR0 A;  4C45 A;  5B0G A;  2HVD A;  1FES A;  3MAA B;  3DMJ A;  4TVA B;  4OV6 A;  4LF8 F;  2K3K A;  2HK2 A;  1YKW A;  4C3K A;  3QQC D;  1KR4 A;  3U02 A;  1U1K A;  1SUQ A;  3SXL A;  2DO4 A;  5CAB A;  1Q5Y A;  2A69 A;  2BAN B;  1GNK A;  5CHC B;  3I4M C;  1H73 A;  4GO7 X;  4KV8 B;  4IOB A;  1O8B A;  3CJ5 A;  5AE3 A;  5CYM B;  1XMO F;  4OYI A;  4DSE A;  4ZHR B;  4EWT A;  3C6T A;  2E5G A;  4Y3C A;  4ED5 A;  3SQG A;  2VC1 A;  3KLF A;  2B5J A;  2XZT B;  3QIP B;  3BB5 A;  2Z56 B;  5C42 B;  1UFW A;  6AT1 B;  1MW7 A;  1SC4 B;  1S4E A;  3OUY A;  2C28 A;  1NAQ A;  3DI6 B;  4PEO A;  3R97 A;  2L9W A;  4BXX K;  1JLQ B;  3LAJ A;  3J81 Y;  2RHQ B;  3W62 A;  2W9C B;  3FJ2 A;  4HT5 A;  3FFI A;  2OEK A;  1M0S A;  2DKO B;  3RG6 A;  3DLE A;  2YX1 A;  2Y1R I;  4FP9 A;  2LEP A;  4LR7 A;  1JWW A;  2LU2 A;  3A4T A;  5G4D A;  5H9E J;  3CJR A;  2CQH A;  3R7B B;  3WIU A;  3DFE A;  3K89 A;  1G51 A;  3L9Z A;  5GAH U;  2F65 A;  5D0R A;  4RLE A;  2E9Z A;  1J98 A;  1XXB A;  3M4O K;  2H5E A;  4A3J C;  5L39 A;  3QPI A;  4CNY A;  4Q0B B;  4DV1 J;  3KHL A;  1NSQ A;  2CZ4 A;  2V4R A;  3TVK A;  5I3U A;  1I6V A;  1BGW A;  4LF9 F;  2KXF A;  1XZP A;  1KHV A;  3OVB A;  2KU7 A;  4QW9 A;  1NPK A;  4C98 A;  4C2M C;  3T41 A;  3UWT A;  4LFC J;  1RAO A;  5CZV A;  5A6P A;  2XBP A;  3VHQ A;  2RAQ A;  4PQA A;  4DS4 A;  4YG2 A;  1FRI A;  2L48 A;  4Y34 A;  2VBZ A;  5KG5 A;  1OIA A;  5KG0 A;  4PZV A;  2AKW B;  3A8K A;  5BR8 J;  1VBX A;  1IBK F;  2FLL A;  3ENA A;  4X66 F;  2QZ8 A;  3C6U A;  4AQY J;  2OD4 A;  3NG8 A;  5T14 A;  1HQU A;  2YKA A;  2MLX A;  2ZZN A;  3RW7 A;  3UN5 A;  3Q8R B;  3QSI A;  1WTB A;  1O0P A;  1HBN A;  1S1V B;  5C4X K;  2FJD B;  1TWF C;  4ZVF A;  3CD7 A;  4YB1 P;  4DUZ F;  2AJF E;  4LR9 A;  2IMO A;  4KTQ A;  2G9O A;  3I6P A;  3HDS A;  4F25 A;  5LSR A;  3QJP A;  4IR9 A;  2P5M A;  1BQN B;  3TW0 A;  3JQM A;  1F2G A;  4OZL A;  2LQ5 A;  5HMY A;  1OJ4 A;  3I4P A;  5K14 A;  4J9K A;  1XJW B;  1FRH A;  2YKQ A;  1WQF A;  3MM8 B;  1TK0 A;  2MYF A;  3SZ2 A;  2LEA A;  1TR0 A;  4BKW A;  1B0V A;  3D66 A;  2XUL A;  3T9N A;  1Y1W A;  3IG1 A;  1O2F B;  3G87 A;  2CVI A;  2HHW A;  3MEC A;  3OBI A;  4KMA A;  5DM6 Q;  5KG3 A;  4ED8 A;  4PYD A;  3A8I A;  2XG8 A;  1RAG B;  3GTO K;  3CNQ P;  3KUH A;  1F60 B;  5AE2 A;  3VAJ A;  5AXM A;  2VUG A;  4ECY A;  2JRS A;  2V4Q A;  4R0J A;  1FVQ A;  1C4C A;  5KG4 A;  4F3Q A;  2OPR A;  5KFU A;  1KLN A;  3GTM K;  4DV4 J;  4IO1 A;  3MTK A;  4FBU A;  2BAC A;  4QW8 A;  4YEA A;  1CJU B;  1TZ0 A;  5DDQ C;  2H4W B;  4KGZ B;  1T9U A;  4RX6 A;  5HLF B;  3HT3 A;  2VFT A;  1VGX A;  1VJW A;  1IQ0 A;  5A8K B;  2ROG A;  4A3B K;  4IFV A;  2K7J A;  4F4K A;  2ZFH A;  1YJ7 A;  2XHC A;  4MKY A;  2IAJ B;  2E5L J;  2DR8 A;  2QYG A;  4HHU A;  1P27 B;  1URR A;  5E5N A;  3UE2 A;  1B99 A;  2FJW A;  1I50 C;  1ZM4 A;  1PYO B;  1F6T A;  4YFU A;  2V6T A;  3ISN D;  2KH9 A;  2DGW A;  2FDN A;  1RWK B;  5GAH I;  1U48 A;  1S9G B;  2HSE B;  1AYE A;  4RW9 A;  4EK2 A;  3HHN B;  2OIH A;  3BP8 C;  4J9L A;  3GTY X;  3QSY B;  4A3E K;  1VQ7 S;  3FOF A;  4BCA A;  4GVL A;  3R1H A;  3MML B;  3QID A;  2AYE A;  1NPP A;  1R27 B;  3PO2 K;  3D0H E;  4C3J C;  2BE7 D;  1VQL S;  1DTT B;  1QTM A;  2GJF A;  2MKS A;  4DZD A;  5T7L B;  2ADB A;  4DN0 A;  1FDN A;  5JJB A;  3THT A;  3UCZ P;  1BGX T;  2JEI A;  4ZPD A;  1QAY A;  3F73 A;  3PW2 A;  1TL3 B;  3DDN A;  3N5F A;  1IBM J;  8AT1 B;  1PJ5 A;  3K7R A;  4DSJ A;  3B78 A;  3QMQ A;  3BQ0 A;  3H2U B;  4A8O A;  2D9P A;  4C3L A;  5IP9 K;  2GVD B;  2ZHA A;  4JI6 F;  3HOW K;  2ZOM A;  1WDT A;  3M8Y A;  3PIP Q;  1N36 F;  1MG7 A;  4UZC A;  1YX2 A;  4DQS A;  4P7V A;  5U47 A;  3A3N B;  4IG0 A;  3U7J A;  2R7S A;  5KFK A;  4NLD A;  3KMQ A;  2V5H G;  4Z7C A;  1VRU A;  2WB1 D;  2QEX S;  1REV A;  3QGP A;  2H48 B;  4KDD A;  4WJB A;  4X62 F;  1TWC A;  4U6P A;  2JA5 K;  3FSX A;  4OIN A;  2HNZ A;  2LYV A;  2DHS A;  2RUG A;  4IFY B;  3CCJ S;  5IP9 C;  2YPZ A;  3ETM A;  1WOP A;  3PW5 A;  1HWI A;  3HOX K;  2EI5 A;  2MHE A;  3PXG a;  1OSC A;  3DCA A;  1IWA A;  4UQG A;  2J8S A;  4UZB A;  2KO1 A;  3JB9 k;  2J6S A;  4M63 A;  3WIV A;  4NAS A;  2EKN A;  2JDJ A;  3HKW A;  2O01 C;  5LXY A;  2FZC B;  1IKY B;  5E3A A;  3OW2 R;  3IGV A;  3GTQ C;  3MM7 A;  3I9V 9;  3S1Q C;  4UUX A;  3BR8 A;  1WG5 A;  3Q23 A;  4NRT A;  1JIH A;  3QWP A;  4XCH A;  2R2T A;  2ZC3 A;  3N6M A;  4P5B A;  4P5A A;  4Y28 C;  4DXL A;  4KHP F;  5JVO A;  3MED B;  5LOQ A;  2CQ0 A;  3JQK A;  3LGM A;  4OLP A;  3CSK A;  2RS8 A;  1OYD A;  2NLW A;  3ICL A;  3I4M K;  4WTO B;  3RTV A;  3IFE A;  2NVX A;  1CJV A;  1FWK A;  4KN4 A;  2J7U A;  2ASD A;  3MMB B;  1H74 A;  1FXR A;  5D3G A;  1T03 A;  3BRE A;  3LP1 A;  1HBN B;  2ZM6 J;  3ET6 B;  3CDB A;  4OZ1 A;  3CW2 C;  3K17 A;  4I7F A;  3DN9 A;  3S15 K;  4ZN3 A;  4JBC A;  8ATC B;  3HVR A;  3V6D B;  1HR0 F;  2C1E B;  1H7X A;  3AHP A;  4LK1 A;  4O0N A;  2LFV A;  2GV1 A;  2QJ3 A;  2OPP B;  1X8D A;  3NAH A;  2LQ9 A;  4YHH F;  1N6Q B;  1SQE A;  2YKN B;  3L4B C;  4FYD A;  4LF5 F;  1XMB A;  4HKQ A;  1W2B R;  2FZG B;  1RB0 A;  3TZY A;  2VKR A;  3S2H C;  2DCL A;  5C4X C;  4TLR A;  3OTD A;  3N6N A;  2BQ3 A;  2HHS A;  5BJR A;  3M2U B;  4JUZ A;  3S15 C;  2LDI A;  3SV3 A;  2VA2 A;  4E0D A;  1RWU A;  4CLW A;  2ZFZ A;  1OY8 A;  2R8H A;  4NX9 A;  2CPE A;  2M4M A;  1U2C A;  2DR5 A;  4AL7 A;  4P73 A;  1EP4 A;  3E3X A;  3T9Z A;  2NYH A;  4A46 A;  3R2D J;  1QE1 A;  3LP1 B;  2GSO A;  2RNE A;  1IS1 A;  4KFB B;  3QRQ A;  5EWF A;  5D15 A;  1U6B A;  1UV7 A;  4NEZ A;  1R0A A;  2GGP B;  1K1Q A;  4X4U A;  3N0C A;  4G3I A;  2W9C A;  3GTO C;  5L1J A;  1CJK A;  3O8W A;  2ZH8 A;  3MEC B;  2IJR A;  3L7U A;  3LWL A;  2O5J A;  5KFZ A;  1N56 A;  4BWJ A;  2AGQ A;  1EKS A;  3DOK B;  2XCR B;  2FVC A;  2CFX A;  2Z0G A;  2GFF A;  1BQM B;  1JKH A;  2JFD A;  1DCP A;  4MK9 A;  2XCP A;  1KDN A;  4WF9 Q;  4O4G A;  4J9Q A;  4GC7 A;  4H4O B;  4RU2 A;  4WU2 A;  1C1C B;  1FE0 A;  3PKM A;  3HHK A;  1XNQ J;  3NGR A;  2ILZ A;  5KTQ A;  5D6G A;  2IM1 A;  4M1K A;  1RT2 A;  2CDQ A;  4PPZ A;  1YJW S;  2IPO B;  1BQM A;  4L74 A;  4GTC A;  3CB4 A;  5FLM C;  2LCW A;  5AXN A;  5F8H A;  1QAX A;  4DV0 J;  2KL8 A;  3PRV A;  1ZTW A;  2B7C B;  2PGC A;  2UZA A;  1GX6 A;  4P2X A;  5KFX A;  1YJN S;  2RUS A;  2FQT A;  4PQU B;  3FVY A;  2QL7 B;  3CMQ A;  1JLB A;  2E2I A;  1FJ7 A;  4A3E C;  2AGO A;  2BE9 B;  4OJG A;  4DS5 A;  1U1O A;  3VAG A;  1NKB A;  3GTM C;  4QWC A;  3I55 S;  3AOA A;  2VPW B;  5TMF A;  1YI2 S;  3JSM A;  1RHU B;  2V2K A;  3FDS A;  1T05 B;  3ONQ A;  4A8X A;  2HND B;  4YFX A;  5D0H A;  2ZD1 B;  1FNX H;  1TV6 A;  3S6E A;  4EFA C;  2JEJ A;  1KVI A;  2DNG A;  3H5X A;  3TZW A;  1TL7 A;  2AGP A;  1MU2 B;  3K57 A;  4V19 J;  3ILO A;  1SQF A;  3DDK A;  2DPI A;  2KHD A;  1I3Q A;  1Y00 A;  5D4N A;  2XMW A;  1N33 F;  1Z2Z A;  4KYZ A;  3HOW C;  3B8H A;  3BKU A;  5KFY A;  3CJK B;  2QLX A;  2B3T B;  2V6U A;  5M2P A;  2ZEJ A;  3DHW C;  4KH1 B;  4F0H A;  2LA4 A;  5HK4 A;  4LIW A;  1WOO A;  1U0H B;  3QLH A;  5M3M K;  2RQC A;  2VUM C;  3MMA A;  2QMX A;  3I0S B;  1CUL A;  3HUL A;  4EBD A;  3Q8Y A;  2DRB A;  4HH1 A;  4IG0 B;  1NND A;  5C42 A;  1HWK A;  1RTH B;  2LMI A;  3KLF B;  4I2P A;  3HFV A;  1FWL A;  5IT9 U;  1RAF B;  4Z7Y A;  1FJG F;  4M5K A;  3W63 A;  5J1P A;  5DGA A;  1VC5 A;  5F8M A;  3DHX A;  3LUY A;  5DO2 A;  1JXE A;  3CDE A;  4A3I C;  4XSZ A;  2DGU A;  2UXC F;  2HMI B;  3MR2 A;  2BW2 A;  1UA0 A;  4P2F A;  5GAG U;  1HD0 A;  2DHA A;  4G0W A;  2FIU A;  1CUL B;  5J2Q A;  4HAC B;  2V63 A;  3S2D C;  2QRR A;  1T9T A;  1N5Y B;  2R7R A;  3HHL C;  1OPZ A;  3KK1 B;  2W01 A;  2ZIT A;  1SL2 A;  3VAI A;  1Q8B A;  2UXD F;  3TJ9 A;  3BO2 A;  5HJY A;  4Q2M A;  4FF4 A;  3M8Z A;  4A3F K;  3MFI A;  2HNY B;  2XYP B;  2FY8 A;  2ZNZ A;  2MLY A;  4IH7 A;  1K0V A;  3UR3 C;  5IWA J;  5IFM A;  1IBL F;  4E2F B;  2VFS A;  1A0O B;  1S99 A;  1CQN A;  1U1L A;  3G9C A;  1MRO A;  3Q2S C;  3US5 A;  1ZAV A;  1F7V A;  1U1M A;  2RRA A;  2KJW A;  2BRL A;  2RE1 A;  4DR7 F;  1JXV A;  3ZTQ A;  4KGX B;  3R9L A;  3HFK A;  2KM8 C;  3FKI A;  3OT9 A;  2KN4 A;  2XYG B;  3KDN A;  2KVQ E;  1LV5 A;  4NXM F;  5HAN A;  3LOU A;  2YWF A;  3VTI A;  3V4I A;  1TL3 A;  3D1Q A;  2DY1 A;  3VR1 A;  5ETN A;  1UVM A;  3QLH B;  4GTL A;  1CC7 A;  3K0J A;  1B4B A;  3H4D A;  2HHV A;  3L7P A;  3HX9 A;  1WC1 A;  4N7T A;  3VWS A;  5HMZ A;  1L0W A;  3T1Y J;  3CCT A;  4BY1 K;  3N4W A;  4DQQ A;  4X4R A;  3M2V B;  3F56 A;  1IKX A;  1F5B A;  2CPY A;  4O44 B;  2WSF C;  1R31 A;  5F8L A;  5KFB A;  1B7F A;  1KNZ A;  3ZTP A;  2XWY A;  3FHZ A;  2R8G A;  3SCI E;  2VFV A;  4K4W A;  4J7C A;  4N41 A;  5KFL A;  2VAS A;  1WF0 A;  1VJE A;  2GA7 A;  4B9L A;  2YWE A;  1UWB B;  4JP8 A;  2M88 A;  1Q78 A;  2Y8W A;  4ZPA A;  1KN6 A;  1S1V A;  4DX7 A;  2WOM B;  5AT1 B;  2Y0S L;  2KTQ A;  3Q3Q A;  4JI5 J;  4BY1 C;  4H4K C;  2VQE J;  3KUG A;  3AAW B;  1S7I A;  4OX7 A;  3GB0 A;  3OFH A;  2CNL B;  4RUB A;  4RW7 B;  1ZQ1 C;  3THP A;  3VGT A;  1VBY A;  5JXS A;  1MML A;  4RBT A;  1IR0 A;  5LM7 E;  3C16 A;  3PO5 A;  4ZVU B;  4O3O A;  3X1L B;  5C25 B;  4PWU A;  1LWE B;  4DV7 J;  4AH6 A;  3LF0 A;  3I82 A;  3KLE B;  3THV A;  1F3F A;  2YU9 A;  3D7S B;  1D9D A;  3D3C J;  1RYS A;  2VD3 A;  4A3L K;  1FFW B;  3VGS A;  4DUT A;  1DBD A;  3KYL A;  2MKH A;  3PM9 A;  3WZ0 A;  3IBW A;  3NOC A;  4WU3 A;  4A8Y A;  3RZD K;  3DYA B;  5ETS A;  2HHH F;  1WI8 A;  3UO0 A;  2R9L A;  5D4O A;  3W9H A;  3M2V A;  4KB7 A;  4CO3 A;  1V5I B;  2KXN B;  3IRX A;  1KLM B;  1J6V A;  2X51 A;  3UFC X;  2HQ3 A;  1RT2 B;  3OD2 A;  2P9G A;  2ACM A;  1YQH A;  3P5T L;  2OPP A;  2YNG B;  4FVM A;  4UUW A;  1HL6 A;  1T02 A;  3CJT A;  4DR6 J;  2BJ7 A;  4I1T A;  4YME A;  4GT9 A;  3O5T B;  2ZC4 A;  4YB5 A;  5A8W A;  3DNC A;  2YH0 A;  4LR8 A;  4G7O A;  3U27 A;  4K4U A;  4LLG A;  4A3M C;  2DRA A;  4KN7 A;  5HQM A;  2GVZ A;  1HQU B;  3EPI A;  1TWG C;  4DL3 A;  3I0S A;  2DXF A;  2LXI A;  2RDI A;  1VQ8 S;  1T94 A;  2F4V F;  1JLE A;  2MJN A;  2XY5 A;  4JV5 J;  2RKI A;  2WBR A;  4K5R A;  2BQU A;  2IRU A;  4C2M A;  5ITH A;  4F36 A;  2FJA B;  1JKH B;  3CJK A;  3Q2T C;  3FCV A;  3OR2 A;  3GIL A;  2JA7 A;  5M2U A;  1EJ7 L;  1P1L A;  2JNJ A;  4L3N A;  1WD6 A;  3NY0 A;  5FLX Y;  4USJ C;  3M30 B;  4IDK A;  4FYV B;  3IR7 B;  1SB6 A;  3CUL A;  3O6Q A;  2YU9 K;  2MQ8 A;  4RNN A;  1DTQ A;  3MM9 B;  3DXJ A;  2EEY A;  1K9M T;  2ZH7 A;  2B0G A;  3TTG A;  1RWV B;  4GKK F;  1I51 B;  1UL3 A;  2QX0 A;  1KON A;  2O5D A;  4YN3 B;  4I64 A;  2BJ3 A;  3VQS A;  2HZC A;  4ES3 A;  1L5U A;  3IWX A;  1KP6 A;  3GJR B;  3GYX B;  1QVG R;  2DIU A;  2B7B B;  1QY7 A;  3TQE A;  2EVZ A;  2NSC A;  1FXD A;  3D2W A;  3AT1 B;  5HSP A;  4QWB A;  3R1L A;  5L1L A;  4UF4 A;  1WG4 A;  1BC6 A;  1VQY A;  5AXL A;  1FEH A;  2XM3 A;  1KQ4 A;  3H5S A;  2KZZ A;  5IOS A;  3S2D K;  4WTY A;  1RT3 A;  2G0C A;  3CJS A;  3G82 A;  3H59 A;  5B0C A;  1MWQ A;  2X3D A;  1JVI A;  2HUR A;  4GVB A;  5A8W B;  3FBE A;  4HL9 A;  4NXN J;  3TUJ C;  3BO4 A;  3EGN A;  2K1R B;  1MNE A;  4DF8 A;  3LAN A;  1XMQ F;  1RK8 A;  2OAU A;  4I6A A;  1B64 A;  4HT7 A;  1C1C A;  1ZAX A;  5IXU A;  1P1T A;  3DRY A;  4ZPB A;  2WB4 A;  1W25 A;  4AND A;  4MMO A;  2WZ1 A;  1P8G A;  5F0U A;  4QU7 A;  4UOC A;  3Q8U A;  1LFW A;  3GG0 A;  1SJR A;  3PEH A;  3OXG A;  3MM6 A;  1MMD A;  1NPR A;  3ULH A;  2CQI A;  5IYB K;  3KG0 A;  3RBZ A;  1SQG A;  4F0M A;  2FVS A;  3JYT B;  2PHC B;  4B9S A;  3MTJ A;  2MZR A;  1QSY A;  3DDI A;  1EB0 A;  4DPT A;  5L38 A;  2HHT A;  4WJ3 M;  3GYN A;  2HEK A;  2BOA A;  2GW8 A;  4JI8 J;  3H98 A;  1MRO B;  2YWW A;  2BKP A;  1OMS A;  4G6V B;  5JVG Q;  4IFV B;  3KLV A;  2EG1 A;  3R6L B;  3NEK A;  5HVG A;  3CCV S;  1Y1W K;  5B0E A;  1S9G A;  4FPR A;  2R7T A;  2E44 A;  2LXU A;  3OTB A;  2UVW A;  3PG9 A;  4OV1 A;  4EGL A;  4OYB A;  3GCW P;  4B9U A;  2LKZ A;  5IYB C;  4F50 A;  1LWE A;  4B3T F;  1S0O A;  1RU1 A;  1Q0N A;  2BAB A;  2IBO A;  1HA1 A;  3M2U A;  3GTM A;  1UJ4 A;  1KQS R;  1FK9 A;  2DB1 A;  4IQX A;  4JI5 F;  3W2W A;  3BUE A;  3FMB A;  2O67 A;  1DCH A;  2ZKU A;  5FDL A;  4A3G K;  3S1N K;  4FF1 A;  2ZE2 A;  2YQ1 A;  3UDL A;  4I4B A;  4H54 A;  3S1Q K;  3FBC A;  1WEZ A;  2OFG X;  1DFD A;  3EGV A;  4JI7 F;  1TKX B;  3DYA A;  4CLZ A;  3OXL A;  2HHU A;  2HLT A;  1H98 A;  3SIP B;  4OJ1 A;  3QGI A;  5ETL A;  4NLY A;  2DGS A;  1T03 B;  1VR6 A;  2H4Y B;  3NNA A;  2DTJ A;  4TY8 A;  4ECS A;  2XQC A;  2RDD A;  3GE9 A;  1FJC A;  1DLO B;  4A3G C;  3LTO A;  2E7X A;  4AD6 A;  2Y0S D;  2IRY A;  4CDI A;  4F4Y A;  2BA9 A;  4CZC A;  2M3D A;  5EX0 A;  3CJ0 A;  2KFN A;  1YRT A;  5LL6 d;  1MMN A;  3CC4 S;  2IJN A;  2GNK A;  2RDJ A;  4NLU A;  1HBU A;  2XGQ A;  2VQF F;  3CO0 P;  2KT3 A;  4CLS A;  2DCU B;  4LUB A;  5IOR A;  3M4O C;  3PJX A;  2Q79 A;  4WIL A;  3HD2 A;  1TWG A;  2LEC A;  3NOG A;  1DTQ B;  3EZ5 A;  4A8Q A;  4TXS A;  2D74 B;  3G8T A;  3OR1 A;  1D1U A;  3MEE B;  3CJQ A;  4JI4 F;  1DAX A;  2DNZ A;  2EWH A;  3T5K A;  3PEJ A;  2VU5 A;  1TEL A;  3S0X A;  2XS7 A;  2FQO A;  5F3Z A;  4ECU A;  2IC3 B;  2OO4 A;  5C3E K;  1AXQ A;  1PBA A;  1C0U A;  4M5D B;  4FPI A;  1UWA A;  3GEE A;  4ZIW A;  2DD8 S;  3NLC A;  1JLG A;  3TNV A;  3QT5 A;  1RCO B;  2Z4P A;  1QVF R;  1TP7 A;  2OSQ A;  1DQ8 A;  4DL6 A;  2HNY A;  3EXY A;  5CH7 B;  1AUD A;  1GFW B;  3EZU A;  2DHX A;  4E98 A;  3AD7 C;  4PAA A;  3F41 A;  2Y8Y A;  4WP3 A;  1JLE B;  2RU3 A;  1LNQ A;  2Z2Y B;  3IO1 A;  1G4C A;  5ETV A;  3HMJ G;  3MM8 A;  3E01 A;  3IAM 9;  3W61 A;  4Y0F A;  4DLG A;  2YX4 A;  1BXN A;  2M5Y A;  3LP0 A;  3MHY A;  1JNR B;  1N32 F;  2N4C A;  1IM4 A;  3OSN A;  2NZC A;  4LJZ A;  1EFW A;  3PJ9 A;  4IRC A;  2ZHO A;  3TX8 A;  2J76 E;  3A13 A;  1Q8L A;  2MST A;  2O1P A;  3V6J A;  5IOQ A;  3OJU A;  4K2X A;  5IC4 B;  2DNP A;  4JV0 A;  2AD9 A;  3CD6 S;  4FYW B;  1FRX A;  3RJM B;  3RB0 A;  5C44 C;  1TL1 A;  2PII A;  4KH0 B;  3MMB A;  3PO3 C;  5HRO A;  1RI7 A;  1TKT B;  2B8Q A;  2VIH A;  4KM9 A;  1AB4 A;  3DLG A;  2YVS A;  4LSN B;  1WTF A;  1NRK A;  4MEY A;  5ADZ A;  2QA4 S;  3RB6 A;  1WC3 A;  1JLQ A;  3MPU B;  2P9E A;  4C3H C;  3I0R B;  3NMA A;  1SIW B;  2JA8 K;  3D1H A;  5J2P A;  1IQZ A;  1QJH A;  1AB8 A;  4MFB A;  4WII A;  3ZNU A;  2CQC A;  4DJB A;  3LAK A;  1RSC A;  4NLS A;  5C24 B;  1LW2 B;  1RWP B;  1F1B B;  2XC9 A;  4JYA J;  4XTT A;  4A3M K;  2HS0 A;  2XCA A;  2CWX A;  4CQ1 A;  1QAI A;  1UFK A;  4ED7 A;  1NHU A;  4ELU A;  1O51 A;  1S0V A;  3MM6 B;  3CIM A;  1B4S A;  2SXL A;  1UWB A;  2FVQ A;  4NLQ A;  4PWD B;  5IC6 B;  2QL5 B;  4B08 A;  4ECR A;  4A3D K;  3HOV K;  3C16 B;  2HRT A;  4HAC A;  3ZTO A;  1QE1 B;  3MCO A;  4NYP A;  4LF4 F;  2CJ9 A;  2MQM A;  2E29 A;  2V0N A;  1XR7 A;  3VVT A;  1RAE B;  1Z2L A;  4EBE A;  3BGR A;  2DH8 A;  1S1W A;  1TVR B;  2LQ8 A;  4CNZ A;  2LU1 A;  2QLF B;  3MZI A;  4QIW D;  1HQE B;  2YKM B;  1U45 A;  1SMY A;  3RRG A;  1QUV A;  1WSR A;  1WCM A;  2W4D A;  3MMA B;  4AFF A;  2RJZ A;  2R2S A;  2AW0 A;  2BW7 A;  2H5I B;  2XHW A;  2EK6 A;  3AJ1 A;  3K8W A;  4IOA Q;  3GJT B;  2QMW A;  3LPE A;  2J0X A;  1K73 T;  1F9H A;  4LF6 F;  4ELV A;  4RBV A;  3M8P B;  2ZH3 A;  3MGJ A;  3KWM A;  1VQM S;  1TWH A;  3TVY A;  2W9B B;  3I4N C;  4OJH A;  5IYD K;  2GIF A;  1X5S A;  4AT1 B;  2A10 A;  4JI4 J;  5IOL A;  4OZN A;  1ZYQ A;  3SI8 A;  1FDD A;  4ZP8 A;  1N5V A;  5KG2 A;  1CG2 A;  1VQK S;  3KHR A;  2OI2 A;  3ZZU A;  3FSY A;  2M8D B;  2PEH A;  5KT4 A;  4XLN A;  3BDE A;  2RHS B;  4WIQ A;  4U67 Q;  2PE8 A;  4PKD B;  1RT4 A;  3EVO A;  3GWC A;  4RW6 B;  1VJQ A;  4RWX A;  2C2R A;  2CPF A;  5TMC A;  4M5G A;  1VHF A;  3S14 K;  4CI0 B;  3KLH A;  1TL5 A;  4C48 A;  2DO0 A;  1WF1 A;  3WX4 A;  2AV5 A;  3EZO A;  2C3M A;  4A93 K;  2XI2 A;  1F0X A;  1R8P A;  4P10 A;  1Y1V C;  1CJU A;  4O23 A;  3PY8 A;  1O27 A;  2BJ8 A;  1VQP S;  4LQ3 A;  2QSF A;  2VOD A;  2BBE A;  2JL9 A;  2IY5 B;  5KFT A;  1NB7 A;  1T3N A;  2I1R A;  2C2Z B;  2UXB J;  2OHD A;  2A0F B;  2IA6 A;  1HW9 A;  2BQR A;  4L3K A;  1EX8 A;  2WVC A;  1Y1V A;  4Y7N K;  1JLA A;  3CDW A;  1U26 A;  2JEG A;  3HHD A;  4X65 F;  2BYC A;  4NLO A;  3BSN A;  4BC9 A;  2FHJ D;  5E2Q A;  5I3U B;  3S17 K;  4QU6 A;  3R5G A;  4M5J A;  3KK1 A;  3AOD A;  3DGV A;  3AD8 C;  3AH6 A;  2DNY A;  4LJM A;  1I3Q C;  4KAT A;  1RTJ A;  1VK3 A;  1NO8 A;  5EWG A;  3R6G B;  4DCP B;  5IT9 Y;  2E1C A;  2R8J A;  2LEB A;  4CLK A;  2MLZ A;  1I3O B;  1O2B A;  2GGP A;  1QAJ A;  2E2J C;  4LRF A;  1WNE A;  1MSW D;  4OIR A;  2W4P A;  3IWN C;  3NGT A;  4BC7 A;  2RRB A;  3S17 C;  4GVB B;  4C0B A;  4DV1 F;  2K3I A;  3CDU A;  3MAQ A;  3WBZ A;  3R27 A;  3CT9 A;  1R6V A;  3ETO A;  2I9S A;  2YNF B;  1D0E A;  3CJ8 A;  1M1H A;  1PAE X;  2IAJ A;  1FA0 A;  4QZV B;  3D1O A;  3NS5 A;  2ASL A;  4WE1 B;  2GSU A;  1FTC A;  1LW0 B;  2VZ9 A;  4LSL A;  2BE2 A;  2HFZ A;  9ATC B;  2QO3 A;  2VJV A;  4USV A;  2NRE A;  1H7W A;  2N82 B;  3G4S S;  2D41 A;  2AX0 A;  2HFV A;  1YWX A;  3BSC A;  1APS A;  2VFU A;  5CHP A;  2BAN A;  2E1P A;  3N0V A;  1VHI A;  2CAD A;  2ZH5 A;  2CPX A;  4MJK A;  3AB4 B;  3ADA C;  1UVJ A;  4C2M K;  2QA2 A;  5DG9 A;  1RUS A;  3MM5 B;  3PYD A;  2GCF A;  7FD1 A;  2R7W A;  5L1I A;  1H2V Z;  5DGB A;  1YJT A;  4HHH A;  1SFO C;  2OEL A;  4H4O A;  3S01 A;  2ZJQ Q;  2R7O A;  2MDA A;  3CAG A;  1TFY A;  1IKX B;  1FRL A;  4RW8 A;  2O3D A;  2R93 K;  3IWL A;  4QYZ J;  3OTO F;  3MR6 A;  2IBK A;  4OHW A;  2Z58 B;  2CPJ A;  2HGL A;  5IM0 A;  3LO3 A;  5K20 B;  1VCT A;  3SYZ A;  3R7S B;  2Y3Y A;  4LFA J;  4B3S F;  3QGG A;  1UJ6 A;  3L4K A;  2VDI A;  3FKB A;  1RP5 A;  3EVM A;  1JB0 C;  2CKW A;  4LVO P;  4Y6I A;  1TAQ A;  4PCQ A;  3OUY B;  3TOQ A;  2OPQ A;  4I0W A;  4ZJL A;  4RW4 B;  1CS4 B;  5DET A;  2UXD J;  5LMN J;  4GTD A;  4KBI A;  5B0B A;  1M1G A;  1ZM9 A;  3MPV A;  4QWA A;  3CC7 S;  5KOW A;  3G82 B;  3NCR A;  3KJN B;  4Y2I A;  3HOY C;  3GTP C;  1JMT A;  3PDN A;  2W2P P;  2DNQ A;  1SCJ B;  4QR2 A;  1EH1 A;  2FHO B;  2E5L F;  1PIL A;  4DR7 J;  1FFG B;  2QG9 B;  4F2R A;  5C44 K;  1L3K A;  2HWI A;  1F2H A;  3E01 B;  2HBQ B;  3W5Z A;  3PO3 K;  1UAW A;  3V6K A;  2ZWP A;  3OHA A;  4CT8 A;  4TU9 A;  1TK8 A;  4NXM J;  2XCO A;  1N5S A;  2V9W A;  2DPJ A;  5I42 A;  3W1Y C;  4U7U D;  2ZBR A;  1VS3 A;  2VV5 A;  3VZH A;  1SJ4 P;  2EFO A;  3HD1 A;  1AZS A;  4QIG A;  3L4J A;  1BDF A;  4A47 A;  3K2Y A;  5D0G A;  5M3F K;  4X4S A;  3OL8 A;  4USI A;  3MEE A;  3DC2 A;  3RYL A;  1OO0 B;  3BSO A;  2DY9 A;  3KK3 B;  3EVW A;  4RKU C;  2HIQ A;  1HNI B;  2C2K B;  4UY8 5;  3EDR B;  3F44 A;  3HOV C;  4ECZ A;  3M8W A;  3NUH A;  2E2H K;  3H42 A;  3MWB A;  1J27 A;  4NE9 C;  2BUN A;  2HQD A;  1YSJ A;  1VIX A;  3PYG A;  5EDW A;  2KYZ A;  2L9N A;  1XR5 A;  4NOI A;  1TTH B;  2IM2 A;  3ISZ A;  3EGW B;  1U25 A;  1RE1 B;  1XNR J;  1N5Q A;  2A18 A;  3UW1 A;  4ANC A;  5HI7 A;  5HO4 A;  2UUA F;  2F8M A;  2EKY A;  1BD6 A;  5KFQ A;  1R8H A;  3PYF A;  3GFY A;  5ETQ A;  3NXZ A;  1Y5L B;  4WFB Q;  2DXE A;  1ZZN A;  1RAI B;  3HSZ A;  4PG5 A;  3OLB A;  4JI0 J;  1RTJ B;  4LVN P;  4OI4 A;  1FF2 A;  3JYT A;  4HEA 9;  3J80 U;  2ZH1 A;  2QE5 A;  3W2W B;  3CXC R;  1SFO A;  2B6A B;  3OJS A;  2F5G A;  2Y1I A;  2K7K A;  4QJV B;  3G86 A;  1TK5 A;  4OZ3 A;  1KD1 T;  2BOP A;  1LFP A;  3DLK A;  4PQU A;  1XC9 A;  2JA6 A;  2EW9 A;  1IKY A;  1BWV A;  2QYC A;  1IKV B;  1FNM A;  2ZNY A;  3HZG A;  1C1B B;  1CEZ A;  2UUW A;  1S6O A;  5HL8 A;  1SJ1 A;  2F8E X;  4WFX A;  2HQI A;  2HRU A;  3KKF A;  2H51 B;  2W7A A;  1MN9 A;  1F5A A;  1CPZ A;  1ZXO A;  3H5Y A;  1V3Z A;  2J6T A;  3M1V A;  1UEV A;  1HD1 A;  3M2R B;  4Q0B A;  5KT3 A;  1ZYR A;  4EU0 A;  2MKC A;  3BQ2 A;  3GTG A;  5JMN A;  1RAA B;  3FGV A;  4A8K A;  2L08 A;  1W26 A;  4Q5S A;  3GCX P;  1E6Y B;  5A8R B;  2D6F C;  1EKR A;  2W9A A;  5J2Q B;  1S7H A;  4WXW A;  4O44 A;  4ED0 A;  1UEU A;  4FNI A;  3M6U A;  2XB2 D;  3D6T B;  1VQN S;  3CVK A;  2HS4 A;  3H3V L;  5F9L A;  5FD1 A;  5T7L A;  1ZTT A;  2JSX A;  2B63 C;  4KRW A;  1FEE A;  3HK2 A;  5E7O B;  1I3Q K;  3A1Y G;  4QQB A;  2J5A A;  3SEO A;  5ETK A;  4KKO A;  2F9J A;  1CSJ A;  1IBC B;  2H5J B;  1JLA B;  5HJX A;  5KFP A;  3AJD A;  3BBC A;  1I6J A;  3T3F A;  1SFO K;  3OTO J;  3VVU A;  1AUS L;  1WHV A;  5GME A;  2E2J K;  2CXE A;  3TFH A;  2I5J B;  3BN4 A;  2HQG A;  4EO6 A;  1XBW A;  3GTL K;  4WPA A;  4RBU A;  4BHQ A;  3GFX A;  3A12 A;  5DZ6 A;  2FPH X;  4AXI A;  4J9P A;  1XZP B;  1KSP A;  3MR7 A;  3C19 A;  1NCL A;  2ZBI A;  1GE9 A;  2P8T A;  3UN3 A;  4CWB A;  4NA3 A;  3MD1 A;  1N8R T;  2VG7 B;  2CJX B;  3GJS B;  2NVQ K;  4GMK A;  3IN5 A;  5E3Q A;  4OHZ A;  2RGR A;  1TKZ B;  4K4X A;  3UI3 A;  1RT4 B;  5JVH Q;  4LFB J;  4EYH B;  1YHQ S;  1UW9 A;  1X4A A;  1JLC B;  3HVT A;  5B7W A;  4PUO B;  1OQ6 A;  4IG3 A;  4URQ U; 
#chains in the Genus database with same CATH homology
 1WOS A;  3TTG A;  1VRQ C;  1WOP A;  3GEE A;  3AD8 C;  3ADA C;  1XZQ B;  3A8J A;  1XZP B;  1VLO A;  3A8K A;  1XZP A;  3GEI A;  5L46 A;  2GAH C;  1WOR A;  1WSR A;  1X31 C;  2GAG C;  3TFH A;  3GEH A;  1WOO A;  1PJ6 A;  4PAB A;  3TFI A;  3AD7 C;  4P9S A;  1PJ7 A;  3GIR A;  1V5V A;  4PAA A;  3TFJ A;  1YX2 A;  3GSI A;  1XZQ A;  1PJ5 A;  3A8I A;  3AD9 C;  1WSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...