1VRQC

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
total genus 50
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1vrqC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1vrqC01
1WORA 1XZQB 1YX2A 3A8JA 3GEIA 3AD9C 3GEHA 1VRQC 1PJ7A 1WOOA 4PAAA 1PJ6A 3A8IA 3TFIA 3GSIA 1X31C 3AD8C 3A8KA 3ADAC 2GAHC 1V5VA 3TFHA 3TFJA 1XZQA 1WSVA 4P9SA 3AD7C 1WSRA 3GEEA 1WOSA 3GIRA 1XZPA 3TTGA 1WOPA 1XZPB 4PABA 2GAGC 1PJ5A 1VLOA 5L46A
chains in the Genus database with same CATH superfamily
5CJ9A 2M52A 5KFGA 1KVKA 1YJTA 6FDRA 5EN1A 4C4WA 3HHNB 2HHXA 2J76E 3I87A 2YX1A 1BXNA 1UFLA 4CT8A 4ZVSB 3GTPK 2HQFA 4K2XA 1RT6B 4G1PA 1C1CA 1K83C 5B0DA 4C98A 2LEBA 4NLTA 3CJ0A 1TVRA 1UJ4A 3OFFA 4O4GA 5HN0A 4DL2A 1RT5B 3N0BA 1S1VA 1U24A 3QGPA 4UY85 2B4OA 4YG2A 1K0VA 2DIVA 1WHVA 4PG4A 5HVFA 2FJVA 2HFOA 1YNJA 2ZNYA 1J5EF 3CDUA 1T3NA 2WAQL 4USVA 3JXOA 1C1CB 4NLGA 3NNAA 1XZPB 2GVDA 2AV5A 4LRFA 4JI5F 1DTTB 2HBQB 1C1BA 4IH5A 1IKWB 4KGZB 5D4DA 2Z4PA 2C1EB 1R31A 2LFVA 2HHWA 3RR7A 1YJRA 2HWTA 3DXJA 4DPUA 4JYAF 1ZVUA 1QAIA 2MQLA 4YB1P 4O3RA 3D68A 1VQPS 2DO4A 3HULA 2OAUA 1ACMB 3P49B 2MZQA 2VG5B 2V4QA 2VFSA 3O8WA 3PW4A 2AJ2A 3PEHA 1N32F 4XSXA 1RE1B 3Q8QB 5EX0A 2OPSA 1GXLA 3HHKA 3S15K 4KH1B 2CPYA 3GIJA 2M2BA 1VQMS 5GAEI 1NJXA 3MUVP 5MAOA 4ED1A 3A8IA 2CPJA 4ECWA 3M7VA 2GMJA 3TQEA 2UUTA 1NK8A 2H51B 2QGFB 3VTIA 1AROP 2ZFZA 5F8LA 4ECYA 5TMCA 3LW5C 2Y9HA 4TLQA 4OI2A 3MEEA 4IFVB 5IOQA 3MMAA 2HHSA 5DZ6A 1FRIA 3OTCA 5IYDC 2X1BA 2H48B 3C46A 1ZYRA 2CW0A 4B08A 3O2IA 1RU0A 1INNA 1L0WA 2XMKA 4K4WA 1G4CA 4IFVA 2HHHJ 1NK0A 1FEHA 2VBYA 3BSAA 4O4RA 2YH0A 3Q0AA 2PFDA 3HVTB 4NLWA 3S2DC 4PPDA 3AFGA 2VFRA 4M1KA 3UN5A 1J5OA 4X84A 2J7UA 3UW1A 4RJVA 2LA6A 4FS2A 2JA6A 1VFJA 4DWIA 3NCRA 1N5YB 4OI6A 1DCPA 1Y1VC 2PDAA 4JI0J 4E98A 4I6WA 3QAEA 2C2NA 2JC1A 1JLFA 2CVIA 5L38A 4EZ9A 4NLXA 3TO8A 5HAOA 3EGVA 2NZCA 4RMFA 2EWHA 2XMAA 1P8GA 4Q7AA 4Y6IA 1REGX 5J2QB 5M5WK 3BO4A 3WQPA 1RI7A 4URGA 2Q3PA 1ZM4A 5H1SV 5GAGI 1KP6A 1WQGA 1DBDA 1VGXA 5J2PB 3MHYA 3OREA 4QIGA 4B3SJ 3M8ZA 1YSJA 3I4HX 2QSFA 4OL8A 4G65A 1VBKA 3OUYA 3LGNA 4AQYJ 5FJ4A 4UY8T 1RT4A 3DLGA 4ZJLA 4JI2J 5CHCB 4G1IA 4IO1A 3H25A 3TUZC 5KFYA 2XO7A 5BXIA 4A4JA 1LNQA 1MMDA 2I9SA 3C15A 4ZPTR 4RLEA 1FESA 3NBPB 3CW2C 3NS5A 2JVRA 1MW7A 4DBQA 1VMBA 1JLCA 4XPCA 3OL8A 1SH0A 3FSIA 3MGJA 2LMIA 4O44A 1O27A 1B7FA 3ISND 3DGPA 1U4BA 1Y10A 1Q4RA 1RADB 3O5TB 2AX1A 4ZOSA 3PR5B 3KLGB 2NSBA 3TAPA 2V4RA 1TMJA 3SDEA 3NGSA 4UOFA 4DR2F 1Y1WA 4IDKA 2UUBJ 2FZKB 4USUA 5E0OA 4ECTA 3K58A 3GTQA 1LWXA 4O4GB 4JV1A 3S6EA 4PG7A 2VJVA 3GTQC 3H7HB 4ZPDA 5KFNA 2R2SA 4TLRA 3RBZA 3G6XA 1RJJA 4N77A 3BP8C 3K5OA 3OPFA 4DU7A 3GIIA 2G0CA 1PAEX 1TR0A 3UNGC 1RGVA 5IP7C 4JI4J 4F2RA 4KTQA 2ALZA 2RUSA 1U6ZA 5C25B 2E2HA 4OZ2A 2DGOA 4QWDA 2KZMA 2IHR1 4PKDB 5HO4A 1G3OA 1AB4A 2F4VF 2MQMA 1PG5B 1XXAA 4R0JA 4PQUB 2DPJA 2OMLA 2DVIA 2MSSA 4FKXA 4CZCA 2YY3A 3SIPB 2RU3A 5ETTA 4CM0A 3BBFA 1VQLS 1LV5A 1DTQB 5KT7A 5C44K 2DXFA 3K17A 3DGVA 1TL7A 3UN3A 2GO8A 2KFYA 4WF9Q 4IUFA 2G2OA 5E3AA 4WFYA 2NXNA 5I3UA 3T41A 2F9JA 5FLXY 2J0XA 3LP0B 3CGIA 2E7WA 4LRAA 4DZDA 4A3CK 1G1XA 2KYZA 3MD3A 3AJDA 4BXXC 5LMUF 1FKOB 4KGXB 4QR0A 1MN7A 1Q78A 1U26A 5C7PA 2IRYA 3HSDA 1CJVB 2YQ3A 1FKPA 5F8JA 4C3JC 3DFEA 5I42A 1L3KA 1U25A 1IN0A 2V8VA 3GFZA 4Y28C 2OEJA 4FXWA 4X4RA 4I7FA 1J98A 4U7UK 5AXMA 3CD7A 4NZ0A 2YPZA 1YIJS 1FJGJ 1SJ1A 1HI9A 3NKYA 4WCEQ 2QA4G 1FK9B 1YKWA 2ZHBA 4E2FB 3Q22A 2XCQA 2WONA 3ISZA 1S6PA 4ZLJA 4DL4A 1G6BA 4C8KA 5FLMK 2F4VJ 3H59A 5HLFB 1JB0C 1VK8A 1WNEA 5J2NA 5U47A 2UXDF 1GXTA 5E5NA 2MGZA 4ZHRA 4XSZA 1TK8A 3M05A 4GTCA 1HQ2A 1NBEB 5IOLA 1PJ7A 4FNIA 2HG4A 1KONA 3WDOA 3QFWA 4MKYA 1IS1A 3HSZA 2HQIA 4B9NA 3G4CA 1HHQA 2C22A 1XMOJ 1P1TA 5B09A 1T9YA 5LM7E 1N36F 3QFHA 5LMUJ 3JAMU 2ZBCA 2AKWB 1K8AT 4BKWA 3RZDC 3MPDA 4O23A 4A3EK 3D0IE 5IT9Y 3S1MK 1H2UX 1VRTA 4P2FA 1CJTB 3PHTA 3PY8A 3D1OA 2P6SA 3A12A 1HW8A 5ETPA 3UD5A 3EM1A 3UVJB 3GTJC 5F8MA 1YJVA 1LWEB 2K8GA 5IT9U 2IVYA 2Q1LA 3GWCA 4A93C 5ETSA 2OPRA 3S0XA 1KLNA 5J2PA 5IYCK 2Z8QA 2GSOA 1HNVA 3RW6A 1C0UB 3D2WA 4IO9Q 5E41A 3TARA 5IFMA 2AEJA 5GAEU 1PYSB 4AQYF 1S4FA 1FERA 2FVCA 1EAYC 1JLBA 2VZ9A 2BE2B 4M5MA 2RS8A 3D1QA 4CH1A 3AH6A 5KFPA 1HNZJ 4A46A 1TWFK 1K47A 5MLCV 4DLEA 2J8AA 4CP5A 4YEAA 1VQ6S 2GQCA 1HNVB 1T05A 2DGVA 4B3MJ 1PSDA 4LMZA 1RCOB 2YNIA 3IP0A 4EU0A 4OYIA 1I50K 2DR8A 2QN6B 2JRSA 1P1LA 4DV1J 4GTAA 3BBBA 3RRHA 4NA1A 3OR1B 4YFKA 2JZ5A 1S1XA 2MKCA 1NB7A 2DIUA 3KJQB 1MNEA 4MTPA 4C3LA 2CJAA 1CULB 2VJUA 4OI0A 2QZ8A 1V5IB 4Q43A 3BM7A 3M8YA 2RHSB 4HHHA 4NA2A 2HWIA 3OJSA 2IDEA 4ECXA 4AL5A 4GTFA 2NVYK 2Y1RI 3LO3A 1I6HK 1UFWA 5ETQA 3GTLK 2YKMA 3KLVA 3RW7A 5DRKA 3NWGA 4E0DA 3QGGA 2ZD1A 3BN7A 4C3KA 4OHWA 3QSYB 2E1CA 5LL6d 1HYSB 3PNIA 4DHVA 3SBMA 2R93K 2R7WA 3SZZA 3BO3A 1XNRJ 3ZTQA 1S4EA 2HBRB 2V8HA 3AOAA 5E3CA 3US5A 1JNRB 4KB2A 4WIIA 2NPIA 3HD1A 1BQNA 2FQOA 3H3VL 1NK4A 3MD1A 3FBBA 4DU8A 3KLIB 2FJBB 4OI3A 4LF4F 2BQ3A 1DTQA 2ZM6J 1SH3A 4OHXA 3SZYA 3GTQK 3NBPA 2B63A 1ZS6A 4A3GC 4QJVB 2V63A 3BGOP 2Y3YA 2K2PA 3C19A 4WKRA 2WVCA 3IBCB 4ZA1A 5BJRA 4A8KA 4F0HA 1YK9A 4PWWA 2EG2A 2K1RB 3W7BA 1NJYA 3GTJK 2KB2A 1RHKB 1SVDA 1YTYA 1UVNA 4PXEA 1U2CA 2BKNA 3LP1B 1EKSA 3KLGA 1ZETA 4L74A 2H5IB 4C8LA 2EPIA 4MQ9A 3JS9A 2V4JB 3B6BA 2FZGB 3A8JA 1ZTTA 4USMA 1AB8A 1EP4A 2E7XA 2VG6A 3QWUA 1PAUB 2LLZA 5E3PA 4MAKA 1WQHA 2BM0A 1ROFA 4G6VB 5A8KA 2V94A 1RBOB 3AQPA 3O1LA 4QWAA 5F8HA 2BQUA 3ULHA 2VQEF 1RAEB 5A8WA 2X1FA 1C4CA 2RRNA 3I55S 4AL7A 4MEYA 4Y2AA 1FRKA 2YWKA 1WC5A 3DDNA 3ILOA 1WOPA 4HI2A 4X4UA 2CPHA 1RABB 2FLOA 4G1QB 3CCES 2RB7A 4JI1F 3THPA 1S9FA 2F8EX 1WF0A 1S1TB 4PRFA 2BDPA 5HP1A 1FWKA 4YHHJ 4EBCA 3HFVA 2BYCA 2GV1A 2HK3A 2V8DA 4PYAA 2FJXA 1K83A 4BXXK 2C2ZB 3V6DA 2FHJA 4DCPB 2W9CB 2ILZA 8AT1B 1IBMJ 2GJFA 3OT9A 5KG0A 4WKYA 2B9EA 2HHQA 1EP4B 1UEUA 3FDSA 3MR6A 2A6EA 2KFNA 2DTJA 1VQOS 1S0OA 1UVKA 4RNNA 3HT3A 4OLPA 4DUYF 4JI2F 2R7QA 2C2RA 2H4WB 2C28A 4ECVA 1U1OA 5B0BA 1VQ4S 3QLHA 2XCRB 1VS3A 4WE1B 5LXRA 1KN6A 2AIRB 1U6FA 1B4BA 1U8SA 4LF4J 4F0KA 1PO6A 4ZDNA 3TAQA 3MAAB 3IR6B 4TY8B 2VFVA 3GYNA 1B99A 2ZE2A 1TU0B 2XHCA 5HP1B 1EX8A 5DDQC 2HWHA 4DF8A 3FEXB 4ECZA 1TL1B 3PJXA 2PT0A 3FKIK 1TP7A 1TVRB 3EJMA 3HKWA 2CNNB 2LXFA 4K2JA 3LGMA 4CH7A 4PG5A 1Z1ZA 4HVZA 5KFDA 4NOIA 3D67A 4LF5F 5F9LA 3A4TA 1RUSA 2KH9A 4YB7A 3CTRA 4NZ7A 2AJ0A 3G4AA 3ELHA 2AZ3A 4Y2MA 1N5QA 1Q81T 3J80U 1RBAA 3CDWA 4URSA 4OIRA 3M9OB 4JP8A 1GMVA 4ZP8A 1TK0A 3JQJA 1F7UA 2BJEA 2KWAA 1ZM2A 1FTRA 2W2MP 3H20A 1CULA 3M8SA 2RDIA 3S1RC 2VBWA 3KJVB 3CCVS 5B0CA 3OW2R 3R8YA 1CJUB 2ZHAA 4QR1A 2IM1A 5AXNA 3G2XA 2Z56B 1C0TB 3U7JA 2AWZA 2W8KA 4JI7F 2KHDA 4ETXA 3RRGA 2MB0B 1TZ0A 3OUYB 3V5RA 2B56A 1P6TA 3DRYA 9RUBA 4C3IC 4CO3A 3K7AC 3P8BB 1ZAVA 4HTIA 4K59A 1F9NA 2IDLA 1RTIA 2YNHB 2L9DA 2VB6A 1F9HA 2CJXB 4YMEA 1G2EA 2LU2A 4YDDB 5D4LA 1EQRA 2CQ0A 3X3UA 2MXYA 4ELUA 1OQ6A 4KO0A 3GTGA 3Q2SC 2NXJA 2B7BB 4OZ3A 1XMBA 4DLGA 4C0BA 4EO8A 5F3TA 2NS1B 1QSYA 5A6PA 3FCVA 3DLJA 2CRLA 2NUHA 3TI0A 1LXNA 2GIRA 3MMBB 2MEWA 3AJ2A 2BABA 2ZUAA 1DCOA 3MM8B 3J7AN 1RT2A 1VBZA 1TKXB 4J9PA 2QE5A 1QY7A 4ZPCA 3WIUA 4X4VA 2NCKL 1GNKA 1KQKA 3U1MA 1T94A 3TX8A 3GTLC 4LBIA 4DSFA 3VV2B 4QU6A 2HLTA 2JH3A 4M5JA 4FF3A 1TKZB 4C11A 1PYTA 3NGTA 2H65B 1GEHA 1SFOK 4ID5A 3OR2A 3W5XA 2GSUA 2QT7A 2C2DA 4LFBJ 3VGTA 4QZVB 4KAIA 4B3OA 1FJCA 3CDBA 1SKRA 4I0WA 1VRUB 4TYAA 1S97A 1Y5NB 2ZOFA 1A9NB 3UD3P 4EO6A 1XK8A 3P45B 1S9GB 3M2RA 5A2QU 2XGPA 2OLWA 3MI7X 4P72A 2FVSA 4ECSA 2UVUA 2A6OA 3PO2K 3FNNA 3M8WA 4WP9A 2MZRA 3GFHA 5JVHQ 3UR0A 2YNGA 4HLBA 1JJ4A 4DPOA 5M3MK 2UVVA 4F3OA 1VGYA 2JA5C 3GYGA 3CJQA 4WU2A 5J1EB 1B7YB 2FYXA 1RT5A 4A3FK 1HYSA 2HIYA 2ZBRA 2F65A 2ZC4A 1HQMA 2MKHA 2DNYA 4ICLB 4ZP6A 1SKSA 4CH0S 4NLPA 3HZEA 1KC8T 4KB4A 4LBPA 1K73T 4A48A 1O28A 2W7VA 2JNJA 1H38A 8ATCB 1UJ5A 3FSYA 3I96A 4N41A 2CWXA 4PXBA 1FJ7A 4MIBA 3DM2B 4ELTA 1H2VZ 5FDLA 2R2UA 3DRSA 3GPAA 1UEVA 2DT9A 1SIZA 1UA1A 1F2GA 3W9HA 1FK9A 1GXUA 3OSNA 2BOPA 3UDLA 4M63A 3TEHB 4K50A 2YXLA 3HP6A 4RW7B 3MFHA 2AZ1A 1IBAA 4A3CC 1WOOA 3GTOK 1HW9A 4M5DA 4BS2A 3L4KA 2E44A 2CZVC 2DGWA 4C0HA 1VQYA 2BW7A 3RR8A 4P74A 1HL6A 2DH7A 5J2MB 4HT5A 1QVFR 4TY8A 2IIHA 1OMSA 5A6WA 5M2UA 5EDWA 3UNYA 1OS5A 5IC6B 4EK2A 2MJNA 3NAHA 2RH6A 4P9SA 4DQSA 1R6VA 2V8GA 3LGHA 1RBLA 5C24A 3G8TA 1UWBB 1SQFA 4YFXA 3DDKA 2QL9B 3DRSB 2EFNA 1ZM3A 1XZQA 3MMJA 1Q7YT 1SJ3P 3JTOA 2WHOA 1MMLA 2GZOA 1LK5A 3W8GA 4WPAA 1XPPA 5EX3A 2IM2A 3KJVA 4KSEB 2M3DA 1TWFA 1SJ4P 4BWJA 3UR3C 3BPDA 4LFCF 1N5SA 2UXCJ 3CD6S 4DF4A 4U9RA 4NI2B 4KYZA 4X4OA 1QDUB 4P5BA 1RWNB 4KATA 4DL0C 4DX6A 3RAQA 4KN4A 2DHGA 4KC6A 3ITHB 3F44A 1XERA 4C8ZA 1RTDA 3GP9A 3FOEA 3GTGC 4DR6J 2KRBA 2ALYB 4LQ3A 2AU0A 4FZVA 5ITHA 4ANEA 1HNWF 3FKIC 1IL2A 3AD7C 3CXCR 1XNQF 2NXCA 2FB0A 2RJZA 2EC0A 1VQ7S 5TMFA 3ET6A 2WBRA 2EFGA 3MECB 4F7VA 4FYVB 3LQVA 1KR4A 1XWLA 3DOKA 2FY1A 4PWDB 2QLXA 3ZZUA 2RKIA 1TWHK 3J81U 3OHBA 1FRXA 1Y5IB 2DCLA 3D6HB 1R9TK 2ADCA 2PA8L 1N6QB 1SBRA 4JUZA 2E2HC 4DPYA 3IXQA 3I4NC 4ILDA 1IQ0A 2GAGC 5AXLA 4XDDA 5HVGA 1PJ6A 3RRKA 1KVIA 3BSOA 3DDIA 3QO9A 1TELA 1X4AA 3TVKA 5LOQA 2C2OB 1SC6A 4FF1A 3UCUP 4K5RA 4W90B 2APOA 3S1TA 2GGPB 3J81j 2P9EA 3MMBA 2FZCB 4DQPA 1SH2A 1YZ6A 4I68A 1Y1WK 3M8QA 2K3IA 1XC9A 3GTOC 2C42A 1ZBSA 1ZYQA 2L9NA 1TK5A 2B7CB 2XEXA 1N36J 5EHHA 3GDZA 3CO9A 2EFVA 1N88A 2JDJA 4IDKB 3GR0A 3JTNA 2E2JC 1JQWA 3FZBA 1SIWB 3PW5A 3GFYA 2UUCJ 3R97A 3TTGA 3MWBA 4R8UB 3U1LA 3DRRA 1XEZA 7FDRA 4GTLA 3PZPA 3LPYA 3KG1A 1VRQC 5IOTA 3J80Y 1ZZNA 1WCMK 3I5CA 1IBMF 3KK2B 1FXRA 3BF4A 2ZOMA 4ALZA 2ADBA 4LR9A 3AA8A 5KFTA 1SC3B 4A8YA 1JLCB 1R89A 3PRVA 3TYTA 4OYAA 2HLUA 4LF8J 3QZ7A 1Q7LB 2VFTA 5L8RC 2PMZL 3Q23A 3BGRB 3S1MC 1WDTA 1S10A 4KQZA 3MPWA 3WC0A 3EWGA 3R1HA 2BKPA 2YTCA 4J9NA 2DEIA 1NPPA 5J2QA 1YX2A 2LVWA 2YU9K 1XMQF 4O2DA 2J9EA 4PG6A 4O3NA 3DKDA 1YITS 2VDIA 2D9OA 2K7JA 3I4PA 1GMWD 2B4PA 1NO8A 2RIJA 4ILLA 4KPCA 1NK5A 1EK8A 4UUWA 1TWCC 2WW4A 2I38A 4LF5J 4EI2A 3OFEA 4UW2A 3ZTSA 1HPZA 3GTPC 2NR0A 5IP9C 5KFUA 4J9RA 1DQ8A 2QA2A 4DCOB 4K4XA 1NJIT 1N34J 3ONQA 2VL1A 4FZBA 3CWJA 4DL3A 3GJRB 1FJGF 3WODA 3TZYA 1F9FA 4CCHA 2BJ1A 1JVIA 4DFJA 1RT7A 2FLPA 2Q6BA 3R9LA 4JK1A 3GIRA 5HK4A 2CJ9A 1SFOA 4TN2A 4JOUA 3CCJS 4LSLA 1U49A 2D3OR 4DL7A 2K06A 2PO4A 3PDNA 2V2KA 3MUTP 4JI0F 3KFWX 2QLJB 1NJWA 1UW4A 4A3DK 2D69A 2DHSA 2R8HA 1R9TC 1NH8A 1YWXA 3V6DB 3KK1A 2HEKA 3FKIA 3MM9A 4DG1A 1FT8A 1HI8A 2GVDB 4A3LC 1WCMA 2BE5A 4BLAA 2QL5B 3I4MC 2KHCA 1D1UA 2UXDJ 3JB9k 1MLAA 2IMOA 5HJYA 2O5DA 3CIZA 2XNQA 1BS2A 3C6UB 4PCQA 4YR3A 2HKEA 2N4CA 2KM8C 2R7ZK 4QCLA 5DG8A 1O26A 4I69A 3ITHA 3KJNB 4X6AC 2CDQA 5H9EK 2J0QD 2AMCB 3UPFA 1R3NA 3N0VA 4WIQA 1WTBA 2HRYA 2CA9A 3CCUS 3TRGA 1IVZA 3GE9A 3MM7B 2IYIA 1SPBP 3H5UA 1HMVB 3W2WB 3HHEA 2AT1B 4OI4A 1HQUA 2VG5A 5CD4H 3TANA 3DLEB 2YKNB 3L3CA 2MQQA 2R2RA 4JI7J 2LP4A 4F67A 1K1QA 3VAKA 4GKJJ 5HLFA 4KFBA 3HJVA 1RKJA 4PR6A 1SJRA 3FVYA 2Q66A 1SKWA 2E1MC 5D77A 2CQGA 2ASLA 1KOOA 1YJUA 1R9TA 3TJAA 2FJEB 1J27A 1NH7A 5C5JA 1BWVA 2W01A 3SZ2A 2CPFA 4B9VA 2PC6A 3WX4A 2VPYB 4V1Ak 3CUNA 2CJKA 2GCFA 3SMZA 4DN0A 5F3ZA 3M30B 3T6BA 1NHUA 4J7CA 2OH2A 2HFVA 3RBXA 3QGIA 4ZH4A 2OPRB 2LU1A 2YU9C 1R8CA 4RPFA 3P3DA 4NYZA 3EVMA 3GTMK 3BSNA 3D0HE 2ZZNA 4CRJA 4ZK7M 4BHQA 1XZPA 5ETOA 4ZCKA 2VPWB 5HROA 1LQ9A 2O3DA 4NLRA 4ZIVA 1O29A 1F7VA 2C3OA 3VAHA 3TZWA 1IJFB 4A3JC 1O6XA 1WACA 4IQXA 1MN9A 1WSRA 4QOTA 1BDFA 5DG7A 4DV1F 4Y2CA 4GTDA 2E1AA 3THTA 5E68A 4GT9A 1N0UA 1U1QA 1NZAA 2BMBA 4WFZA 1S99A 3HJFA 4N47A 3BSCA 4J9KA 3HO1A 4FYDA 2ASJA 2LKZA 4LR7A 3DYAA 1X4CA 3S1RK 3CAGA 2Z58B 2WK4A 2LQ5A 1QUVA 1S6OA 4FF2A 1T3OA 4ZKAA 3DRRB 1X8DA 1KFSA 3QIPB 1CC7A 2B51A 1QSSA 4WJBA 3D3BJ 2ZWOA 4P2XA 1T9VA 3KG4A 4IQMA 4ERDA 1IKVA 3D6MB 2QYGA 2N82B 5CA5A 4RX6A 1UVJA 4YB5A 3MEEB 3MZIA 4A3LK 3H98A 1RACB 1X9MA 2R7UA 1OPZA 1WHXA 1WC0A 3OXFA 3OLBA 1EHWA 3FK4A 2IC3B 3QGHA 3CCWA 1LFWA 5C3EC 2B63K 2J5AA 1FKPB 2DRBA 3PACA 3FRYA 2R92A 4KHPF 3Q8PB 3KUHA 3PIOQ 1WHYA 5GMKa 2RS2A 4GKKJ 3G82B 2ATLA 3J7YI 1XXBA 2DNNA 4EYIB 2FTRA 4Y2KA 2R7RA 2CQIA 4M8LA 4TNOA 2JA7C 3QO9B 1EB0A 4WP3A 3SSRA 3UE2A 1FRJA 4OYWA 3QQCD 1XTZA 1Q8KA 3S15C 2CDRB 4W4MA 2M8DB 2V9KA 2HAIA 2LCWA 3H40A 3S17K 1WOSA 3EGWB 4CDIA 5AT1B 1RK8A 4ILMA 5A0YB 1M5HA 2HGLA 4IFYB 3TUJC 2UV8A 4ZCLA 1Q86T 1F60B 1I51B 4I2QA 3HZGA 2E9TA 1J2VA 4FBTA 1X5SA 5F8NA 1EI6A 1WC4A 3LP1A 1T0TV 2J7KA 1V5VA 1EZZB 9ATCB 4NL5A 2LQBA 2B43A 4KBIA 5IP7K 3LP0A 3LUYA 1Y5LB 3T1HF 5HSPA 1QLNA 3ENWA 4IH7A 2GGPA 2DNQA 4CTAB 1ZPVA 2UVWA 3ILIA 4X4NA 1WJ9A 3D6TB 3A3OB 3BGUA 5DDOC 2WTFA 4OIPA 2RHQB 2ILYA 4DPWA 3T5JA 3Q83A 3EUNA 5HQMA 4RW9B 4QWBA 4ANDA 3CIMA 3J7A1 1O2AA 3FHZA 1CJKB 1I6JA 5JVOA 3R5AA 2YU9A 2WSEC 3IBFB 5JVGQ 3F0NA 2A69A 1NEEA 4NEYA 1YRXA 3B4MA 4MIAA 1UFKA 2XMWA 4TYBA 2KM8B 1Q1KA 2PE8A 5B0EA 2E5GA 2H9ZA 4KM9A 4V19J 1X5OA 3IPJA 3HSGA 1S1WA 1AZSB 1WI6A 3C6UA 2CNOB 2DISA 1N32J 2ZD1B 3LA0A 3M32A 1UZHA 1WI8A 3L9ZA 3OTOF 4AYBL 2RQ4A 3U02A 3DLEA 2UVRA 4EMDA 3CQZA 4A8QA 1FNOA 4DPTA 2XNRA 4WFBQ 2AQ4A 1CJVA 3IC1A 4WXWA 4PXDA 5GMEA 5ETRA 1I94J 3EE3A 1U2FA 4EFAC 4BC7A 2YNIB 4V19X 4DR5J 4JI5J 3K5PA 4R5PA 3ZZOA 3H2VE 2UP1A 5KOXA 4OX7A 1BWEA 4ED5A 1FCAA 1V9OA 1DLOA 4PPZA 1O24A 4C45A 4IRDA 1X9WA 2ZH5A 2WONB 3MM6A 1BHNA 2HPUA 5HVHA 3I5AA 4MIWA 4BLBA 2NVXK 1AZSA 1V3SA 2RH3A 1KEKA 4NASA 1RTJB 3EDQB 3W64A 4CT9A 4UTGA 2LQ8A 3I0RB 4OZ0A 5A8RB 1R6YA 5JFEA 2V6AA 1JXLA 2HFSA 4NCGB 3AB4B 3HHLC 2KT3A 4ED8A 5DLGA 4ZCIA 4MFBA 3DLHA 4DX7A 4NZ6A 1XNRF 3MAQA 2HFUA 3FBEA 2AX0A 2ZH8A 2R2TA 1RYSA 1FA0A 5LSOA 3RZOK 3SI8A 2XLJA 2BV3A 4DV3J 5I3QA 1I5OB 2D3ZA 3BBCA 1PCAA 3PJWA 4WK1A 3FMWA 4CNYA 2PA3A 1TWHC 5I3PA 4LFAF 3GYXB 3TJ8A 1B4AA 1QUPA 2QV6A 3CMAS 2Y8WA 3GTOA 2OD6A 3PFOA 3RU0A 2X7IA 1YLXA 1UVMA 3OXGA 2O67A 1Q53A 3MEGB 1QTNB 3KMQA 2PFFB 1DURA 2KXHA 4Y52K 3KNAA 1GX5A 3K5NA 2ZKUA 1S59A 3N01A 4EBEA 3B4DA 2IM0A 1REVB 4ILRA 2W7AA 4LF7J 1UV7A 5HQLA 1T9XA 2OFHX 1RWUA 3C8YA 2V2QA 2YKQA 4B3SF 2E5LF 4ZIWA 1VBYA 1NU4A 3IMQJ 1IM4A 2FGOA 4H4OB 3IAS9 1Z4UA 1NSAA 3PV8A 4IRCA 3GZ7A 2D3UA 2JA8C 3HOYC 2MLYA 1Q16B 4L3NA 1RA6A 1O2BA 3R7SB 1T95A 3EX7B 2DHAA 4LSNA 3MDFA 1T8EA 4KRWA 4ZPWR 2ZZMA 4P75A 3NGUA 2WVEA 4KC5A 3LOUA 1VJQA 1IBKF 4IG3B 2VQEJ 2A2CA 3WX8A 3BKUA 4Q5VA 3K89A 3OL6A 4DV0F 4F3MA 1R0CB 3BGRA 5G4DA 1TFYA 2HRUA 2YKPA 2P9GA 1KBRA 2WW8A 2F3JA 5IM0B 2CPDA 2MKKA 2F9DA 2HURA 4QIFA 2QLBB 1Y3KA 3L7PA 2BQRA 1V6HA 2FQTA 3TVZA 4DR3J 1XR5A 3NP5A 1DZ5A 1NDPA 3LAPA 4OYMA 1ZXOA 3MR7A 3SSQA 4FS1A 3SFGA 3W60A 4L75A 4PG8A 5GAHI 2IVFB 3MURP 2WAQD 3GJTB 4H4MA 5CYMB 2CPEA 2Y3PA 3PYGA 1HI1A 5J1PA 1AXQA 2ZJRQ 4OX6A 4BBRC 2GS8A 3NLCA 3NMRA 5J2MA 1N5TA 2ZBQA 4F8RA 1YJWS 2XY5A 5DETA 3CJ8A 1OY9A 2J6UA 5FJ8K 2DNOA 3PW0A 3BEGB 4NPOA 4Y0FA 5T14A 2A68A 2HVDA 3JQKA 3UDCA 3IGVA 3DRPA 1NAQA 3CJ2A 4N5SA 1RT7B 5ETMA 4ES2A 1FDAA 4J9MA 4B3RF 2Q43A 2XMUA 2Z2LA 2N4DA 3QPIA 4OLOA 3T1YF 3CMQA 4ES1A 4CLFA 4ZVOB 2EFPA 3V6JA 1ZAWA 3D28A 3POTA 2EBBA 2VODA 4NXNJ 2HYIB 1JKHA 2F7VA 3CQZK 3EMTA 3GTJA 3OL7A 1T03A 3MR3A 1FWPA 1R8HA 1PIEA 3LP2B 2GSNA 1USMA 5C25A 1RHMB 4NI2A 4MK9A 5DGBA 4JYAJ 2M70A 1DJ0A 2EK6A 1B70B 4RWWA 2QX0A 4G1QA 3BDPA 3UFCX 1NKBA 3Q8VA 3JSRA 3QRPA 1X4BA 1JIHA 2C3PA 1YBTA 1X4DA 3HM9A 5KAKA 4ANCA 4Q2LA 3LP2A 4CLKA 4JV0A 1UVIA 2CFXA 3N9UC 2MKIA 3P5TL 5KFAA 3M32B 4K4ZA 2RQMA 3QX3A 2XGQA 4DSLA 2JFKA 1E6VA 2HHVA 3BDEA 3O44A 3THVA 1FXDA 4LF6F 3W9IA 4KDDA 2C3MA 1O5JA 1CS4A 2XMVA 2PMWA 2V2ZA 1Y1WC 2G1DA 3N6MA 1OWXA 4G0WA 2D41A 2WB1D 2FJWA 2F1FA 1HWLA 4OZJA 2KKHA 1HBOB 4NMLA 1HI0P 1S5ZA 1Z2LA 4WBFA 3EZ5A 1F6TA 2VUMK 2C2MB 3T1AA 3A3PB 1CS4B 2DNLA 3BO2A 3R2DJ 4KFBB 4QYZK 2Z2YB 1JXEA 4LF2A 3X1LB 1FKAF 3J81Y 2ZJQQ 2QO3A 4CYUA 4A3BC 2MSTA 1TL3B 1E6YA 1UWAA 1Q8LA 3H5SA 4WK3A 1M1KT 1OYDA 5IV3A 5DQIA 4CLPA 3CJ5A 1RLCL 1HBUA 2NVQC 4YY3J 3CMES 3QYYA 2QL7B 1JLEA 3M8QB 1LW2A 1KD1T 5AE3A 2BJ3A 2C3UA 2N3LA 3IS9B 2XI2A 1VR6A 4KMHA 2K1RA 3LWMA 4WZMA 2A2DA 4X4PA 5JUMA 4X65J 2D6FC 3EPGA 1HWIA 4FKYA 2LEPA 3ZO7A 4DV2F 1FNMA 1CQMA 4Z37A 4ED6A 3GSIA 3PM9A 2V6UA 4RNHA 4Q0BB 2GX8A 5DM7Q 4FDFA 5M5YK 3K0JA 2E5HA 5IV4A 4YP3A 1I6VA 4BY1C 1VQKS 1WKLA 2GHVC 3I0SB 3W63A 3V81B 1LWCA 2B5JA 2CADA 3PYEA 2CJQA 4UUXA 4ZCMA 5ETKA 2GA7A 3UO0A 2RDJA 3C14A 1K83K 1BD6A 1VLYA 3DLKA 1NRKA 3M6UA 5KG5A 1HWJA 2HFZA 1S0NA 2UUBF 1WKJA 3T5KA 3JSYA 3CF5Q 1RTJA 4YR2A 3CQZC 1SV5A 3MOJB 2J0SD 2NVTK 4OV6A 2AYBA 2VF3A 3DOMA 2CIMA 1Y9OA 1XNQJ 1YNNA 3RUBL 3M6VA 4A8WA 4PUOB 3VALA 4Y3CA 2H3EB 2MKSA 2XC9A 3JSMA 3I4NK 4HACB 2N3OA 3V4IB 1UA0A 2AYGA 2UU9F 4RU9A 5IQQA 1GX6A 3MTKA 5LXYA 4QYZJ 2MQPA 1PJ5A 2AYMA 2OEKA 5I4MA 2IYGA 3TFIA 2M5YA 2R9LA 3WHIA 3MM7A 2AHOB 3TQ1A 3G6VA 2MY8A 4DV6F 1RYRA 4C3MA 2HVIA 3R5JB 4USJC 1XZQB 3FOFA 1ZPWX 1I50C 4CI0B 3BGFA 3TA1A 1QE1B 4C7QA 1X0PA 3HD2A 3TR5A 2NZ4A 1T05B 2R7SA 3U1NA 1FF2A 4F3QA 3B78A 3DRPB 3HX9A 2RDDA 4JV5J 2AD9A 2WZ1A 1IR2A 1F3VA 4D3HA 3Q89A 3MEGA 3ENVA 3OJUA 2OTJS 4I6YA 1MWZA 4A3BK 3ZZPA 3CJKB 2KXNB 1F93A 3N0CA 5GVQA 4NCBA 4LOWA 1T9TA 1H98A 4X4QA 3KK1B 4ZVTB 4XDCA 1VCTA 1RT4B 1N52B 2NYHA 4C2MA 3RBDA 2VG7B 3PKYA 4HKQA 1WCMC 2EBGA 5DLFA 4ID8A 3GV7B 2XYPB 4K0KF 3T1YJ 4GZYA 2BW2A 2YWWA 1F1BB 1RA7A 2RGRA 3PVXA 2IY5B 5G0RA 1FDDA 2PHCB 4KY3A 2NUUG 1A0OB 5KG2A 1T03B 5JMNA 3Q86A 4J37A 5KFEA 4WFNQ 2W8LA 2XCPA 1ELOA 3K8VA 4ITSA 1T02A 2XZTB 3OTEA 4KPYA 4HHJA 2V67A 1Y7PA 3E2EA 4HYKA 3D1HA 4OZLA 4F4YA 1VBXA 4GRSA 4DMZA 2JA7K 4ENOA 1I3QA 3DMJB 1VIOA 2VBXA 1H7XA 2FHJD 3FFIB 1FXLA 1V3ZA 2HGMA 3W1YC 1ZBTA 2F8MA 4RKUC 2CXEA 2MZSA 3M3YC 2W2QP 2MZJA 1H3DA 3S16C 4KMUA 1MU2B 3R5GA 5A2QY 1CJKA 4LIWA 3R6GB 4IOCQ 3MPYA 2L41A 1B0PA 3VAMA 2UXCF 2C2KB 4AL6A 3DOLA 3M30A 2BVZA 1R43A 3W66A 3MEKA 2RF2B 3VQSA 1YQHA 2D3O1 4X66F 3CD5A 1CBKA 2E2HK 1PBUA 1EH1A 1U1RA 4ZHRB 1VDHA 4YS2A 3KXDA 1XIQA 5J1EA 3GG1A 2GW8A 2E2IA 2F4FA 2CQCA 2ZKTA 5IQ6A 3EXYA 5L46A 2RNEA 4BLGA 3DU5A 2YQ0A 1LWEA 2HQDA 3SV4A 3F41A 4DSJA 2DB1A 3PX0A 2HBZB 3AD8C 4RW4A 1UPPA 3ZFVA 4CYUB 2HW3A 5KFLA 4ZVHA 1M5OC 2VICA 3TNVA 3EXCX 3ZNJ1 2XY6A 5KT3A 2UUWA 1IM6A 4RUAA 1H73A 4WYLA 5AE2A 4DUZF 2R7OA 1KHVA 1QVGR 2OEMA 3H5YA 4KH0B 1FRHA 2DNMA 4C9DA 5T7LA 2YPYA 2EEYA 1C1BB 3ZZRA 3D54A 1O0PA 4GO7X 3L09A 2ZJPQ 2IVMA 5FIIA 2FVPA 4I67A 3K7AK 3GSDA 1WG1A 6AT1B 2QMWA 2VC0A 2M7SA 4ZPAA 3I0RA 1NDLA 1FX4A 4Y65A 3MF5A 2NVXC 1VISA 4LSZB 5L1KA 3JSBA 3PO5A 5KFXA 1S1TA 4NEZA 3PX4A 1IBCB 3HF5A 2DGSA 2EC2A 2HNYA 3R5BA 1Y3JA 4OJ3A 1LWCB 2XYGB 3HVRA 1WD6A 2P5VA 5KFRA 2VD3A 3H4BA 3MMCA 2JWNA 1N5YA 2WBMA 3H0GA 4A3MC 1C0UA 2XULA 1UJ6A 2E2IC 4IG0B 1UL3A 5SZTA 2G9OA 4DX8H 4CTAA 2DH9A 1RWPB 1SL0A 1VIXA 2MHEA 3C2PA 3I5BA 1UWBA 1HQEA 1RWVB 3SXLA 3MMCB 1HNIB 3KLFB 2H5JB 4GTEA 4DSIA 1RT3A 4YQWA 3HHDA 4DI6A 4F25A 5E3QA 4ECQA 3KHGA 1UP1A 3MMAB 3LWLA 2FHKA 3ET6B 2GIFA 3NUHA 2PEBA 4ZP9A 4CQ1A 4B3MF 5KT6A 3M2VA 4Y34A 2RU9A 2RSQA 2GVZA 4LQ9A 1KRPA 5KG7A 2L48A 3SQGA 3EVOA 4Q44A 3PKMA 3RJMB 2BBEA 1T9UA 1N6QA 4C3HC 3DRXA 3GTGK 4ZPBA 3SEOA 2CJBA 4B3RJ 2GIQA 3FJ2A 5L1LA 2FLNA 1X60A 5M3FK 1TAQA 1YZ7A 3CJ4A 1REVA 3I31A 3RAMA 3TAMA 2GMHA 2V34A 4AT1B 4QIWD 3QIDA 2VDHA 4N8NA 1USOA 2XZWA 3H0GC 2WCXA 1A7GE 4H4OA 2ZH9A 3CCSS 1LKZA 4HT7A 4LRBA 3HOYK 3HMJG 4GFQA 1BQMB 2BJ7A 2QYCA 2P5MA 4YOEA 3V6KA 1CJUA 3GEHA 1NJZA 5D8HB 4DCJB 5KFKA 2EXUA 3MFIA 1TWHA 2DR9A 3I6PA 3HVTA 4W98A 2RILA 3UVJA 3UCZP 1OJ4A 2V2VA 3GIKA 1GT8A 4K4YA 3GJQB 5DDPC 5KFIA 4AD6A 4UOHA 2QFJA 3ZTOA 4ICLA 4QYRA 5M5XK 2IM3A 5IZHA 2OI2A 2XMJA 4O44B 4DQIA 4B17A 3KOAA 2VG6B 4LF8F 4RW8A 3IWXA 1JLAA 4AXIA 5B7WA 2J0WA 3P6YC 1I3QC 2DNHA 1WG4A 2R93C 2QRRA 3TZZA 4EYHB 1D8ZA 4NCGA 4CO1A 1JMTA 4OHVA 2W2PP 1VQ9S 1NK7A 1I94F 3HOZK 1MWYA 1PKUA 2M9KA 5F0WA 3EGZA 2CQPA 3RBEA 3TZXA 2BRKA 2CQ3A 4DUTA 1X31C 5K20B 4LJMA 5CABA 1C2PA 1GE9A 4M1XA 4LQYA 5K5MA 3S17C 3GTMA 1HBMB 2VH7A 3IRXA 3S14K 1ZTWA 4F2SA 3TP2A 5H9FK 1EJ7L 2RAQA 5DG9A 2XMMA 3Q8YA 3IM9A 3VHQA 4OFZA 3D3CJ 3AY0A 3FFIA 4OX9F 3W5ZA 1EETB 1SJQA 2DNGA 4KB7A 5IT4A 4B9TA 5KFZA 2KU7A 2FJAB 3W5YA 1VQ8S 5KT5A 1FI4A 2MQ8A 5L39A 1YHQS 2OFGX 1X4EA 1AT1B 1TWAK 3C3LA 1O25A 1W25A 1Y0HA 1DAXA 3CSKA 3MM5A 5IS2A 3NGDA 3JSMB 1NUEA 1WIHA 1XR7A 1M5PC 4A93K 2CKWA 1HMVA 5I42B 1QD1A 4ATNA 1RB0A 2RVJA 4USKA 2MZ1A 5CXTA 2DEJA 1WC1A 3DXBA 3R3TA 4OQJA 2HHHF 1YDLA 4MKVA 3GR1A 2MYFA 4NWBA 3SFUA 4I1TA 4HEA9 4JI8F 3MM5B 2DYAA 4DV0J 1RAGB 1FJEB 3GIMA 5D4NA 1G7CB 4WP8A 4ECRA 3F56A 4DFKA 4LFAJ 4QIWL 5D4PA 4Y7NC 4X4SA 2UUAF 1GTHA 2ZVIA 2MHNA 3M1VB 4NRTA 3CJRA 2B4UA 2FC8A 1DY3A 2BA9A 5CZVA 5KFQA 5DQHA 5AJ3J 2R7XA 4CLZA 3M8PA 2DR7A 3L4JA 1EKRA 4HL9A 1S1WB 4U67Q 1RU2A 3S16K 1AA1B 1B0VA 4WXOA 4DR4J 2A3JA 3KK3B 4UZCA 1Z2ZA 4NLSA 4QJVA 1T9WA 4GMKA 3A8EA 3H0GK 3BPSP 4ZMMA 2JLGA 4KR0B 2ZM6F 1QAXA 4KKOB 4RUHA 1SUQB 2DXDA 1LW0B 2VFUA 4ED7A 3CC7S 1VJEA 5EGEA 4K4TA 3V6HA 1NZ8A 3NOGA 3MXHP 5J1NA 5EWEA 1WF2A 4ZPVR 2AGOA 3S2HC 3NCPA 3Q24A 3R5DA 3MM9B 2E1PA 2H54B 5C42A 1F5BA 2Y8YA 3KHRA 2MJUA 2MLZA 1H2TZ 2H5EA 3NNCA 2R7ZC 2B63C 2ERRA 4DV6J 2CG8A 4A8XA 4WJ4A 4N8OA 2VASA 1P9YA 4X6AK 5IXUA 2FHOB 1Y00A 4RL1A 3NL0A 3FBCA 1C0AA 1NHVA 2W9BB 4CLUA 5K8PA 1PILA 2VOPA 2IAJB 1S6QB 4DV7J 5DDRC 1ITPA 3AH5A 3PW2A 1U1MA 2GJIA 3OEPA 4U6PA 1K9MT 3PG9A 2KXFA 1NDCA 4K4UA 2OIHA 1JLQA 1WTFA 4W92B 1AW0A 2R93A 1XJWB 4DV3F 2YKNA 5D0HA 4MYUA 1S9EB 1Q8IA 1RZMA 4A8OA 4O0NA 4I4BA 2HZAA 3CCMS 3GTKK 1VHIA 2XI3A 2KTQA 3ENAA 3S1QC 4ECUA 3EPIA 3ILLA 3A3NB 1RU1A 3R7BB 3G87A 5IYDK 4FYYB 1X4HA 2CUYA 1K1SA 3G71S 3V4IA 3RZDK 1IUJA 1RAOA 3CE8A 1S49A 1X4FA 3DOMB 2KJVA 1KS2A 3FUYA 2B9XA 2GHPA 4H4KC 4AFFA 2V8PA 2AJ4A 4I56A 2AP6A 1N56A 2KG0A 4EBDA 1FFGB 1NPRA 2PN6A 4LF7F 2Y1LB 4TVAB 5A0YA 3DYAB 3MAAA 4K4SA 5H9FJ 1TWCK 3VAFA 1HR0F 3MTJA 4ZLNA 4MKBA 4RR5A 8RUCA 4NLUA 3PO2C 3QT7A 1UETA 1KOHA 5LT5A 3OTBA 3K59A 1HNZF 2ZWPA 3GEEA 4OJGA 4MJKA 1IWAA 3BH7B 5K8OA 4NLQA 2DY9A 1IKVB 4K8RA 1SL1A 2BJ9A 4FYWB 4CIOA 1VC5A 2VU5A 1VYAA 2HHPA 1S0MA 2ZH4A 5GAGU 2VUMC 4F4AA 1DHMA 4OZ5A 2XSFA 5IP9K 1A6LA 3E01B 4ZVFA 4DR1F 1U1PA 4J9OA 3AJ1A 5GADI 4J9VA 2BJDA 2Z57B 4ED0A 3M4XA 1U8WA 1IQZA 2F63A 2OD4A 2A0FB 3QMQA 1ZA1B 5F8IA 1OSDA 4RO0A 5HBMB 4GC6A 3G82A 4KV8B 3FEYB 5B0GA 5KT4A 2RUGA 2CPIA 2Q6CA 4C8NA 1OY8A 5CYMA 4PWDA 1NDKA 4FN5A 3S8SA 3ISNC 1Y11A 2E66A 4YDXA 1U1NA 3QBCA 2P8IA 2V0NA 2F40A 2H4YB 1F0XA 5HMXA 2HK2A 4WJ3M 3KHLA 2KJWA 3GONA 1BQMA 4IG3A 3KDNA 4C8YA 2I5JB 2ZNZA 4LVOP 3EYZA 4UQGA 1LWFB 1RXOB 1OO0B 1I3QK 4NRUA 3FZ2A 2ZHOA 1FVSA 2W7OA 4TQRA 3HXAA 4Y00A 4ED2A 3GV8B 2R8GA 2XSJB 3OV7A 1IW7A 4F36A 4C8OA 4LF1A 2CQHA 3W62A 4HR2A 3ADAC 1N8RT 1URRA 2L3MA 1MU2A 3DCAA 4G0VA 1SV5B 1MROA 1Y1VK 1UMJA 1YJNS 2WVDA 1IE0A 4M94A 4MMOA 2MKYA 3KLEA 1YCLA 3CJSA 5DZ7A 4X62J 2V4JA 3ZXWA 4ETZA 4JI6J 4GO5X 2O5JA 2PPBA 4ZS6A 2DD8S 3AXKA 1N54B 4TXSA 4DR2J 3DOLB 1U6BA 3BN4A 3RG6A 5KFVA 2HZVA 2OO4A 4I64A 4IRKA 1VQSA 2LEAA 3CCZA 4C48A 4M5HA 4BWMA 3T19A 4IH6A 1FVQA 3H90A 4G3IA 4GC7A 1U0HB 2CFAB 5IYBC 5KG3A 2ACMA 1RAAB 4FBUA 1NPKA 4M5KA 4M5NA 1C4AA 5B08A 4ID5B 4JI8J 3CEDA 2OSQA 4TU7A 4FYXB 4Q45A 2I2YA 1XXCA 1FKOA 2J7WA 5C2GA 3QJJA 4QQBA 2G0JA 3D6FB 3H5XA 1U2RA 2FHMA 3M2UB 4A3IK 1TWFC 1TL4A 2HMIB 1RWMB 2EFOA 2RMLA 4ED4A 3CC4S 3QJLA 4L3KA 4XLPA 2HRTA 2FIUA 3EICA 2XYHB 1LK7A 1RQ0A 5T7LB 4NE9C 3VAGA 2XB2D 2MY7A 3M2UA 3T6JA 5FD1A 3TUPA 2AEMA 2HFNA 2I0XA 2VG7A 2ZITA 3N4WA 4KASA 1HD1A 3MCNA 2XWYA 5GADU 2CG4A 2XMTA 4FNHA 2HHUA 4P2SA 4QR2A 3GLJA 2DNZA 3KLHB 1S79A 1N34F 3VR1A 1EETA 2HGNA 4OHYA 2DCUB 3NXZA 2J9DA 3K5MA 4DZ6A 1SC1B 2Y1IA 3AT1B 2HQCA 3SV3A 1TWGA 2JEFA 5D0EA 2YWEA 5IWAJ 3CC2S 2W1BA 2QFIA 1R7IA 4DXLA 1PYOB 4P52A 3HOWK 4NA3A 2EFQA 2ZH3A 1UW9A 1B0TA 3T5HA 3QIPA 4YN3B 2JEIA 2G0IA 2ROGA 1QE1A 3T9NA 1N33J 4CO0A 2DGXA 3EDRB 5ADZA 3M2VB 3ZZTA 3FEZA 3NAIA 3JTPA 1M5VC 4LR8A 2BM1A 3R6LB 4FVCA 4CM2A 4Q8FA 1F9EB 4M5IA 2ASDA 2FVRA 3GB0A 1JLBB 2B5JB 3OQ2A 4PXCA 3W61A 2JJ4D 2R7TA 4EUVA 1IBLF 4JI6F 2JHEA 4BY1K 3NWRA 3AODA 2Z2MA 2CPZA 1FFWB 2JL9A 5D4OA 3L7OA 3U27A 3G8QA 3SCIE 3HK2A 2QA4S 2HIQA 2A6MA 2HAFA 2YNFA 1DTTA 1ZZFA 4DR5F 3BUEA 4L73A 1YVFA 3RYLA 2JOQA 3NEKA 1EIYB 1FO1A 4HACA 4LVNP 1S76D 3C16A 1TWGC 3UDEA 1H6KX 4H4KA 4BC9A 2VV5A 4J9LA 3MCSA 4YFUA 3LAMA 4F26A 3MCOA 4KV8A 2JFDA 2Q79A 4OX8A 3H8YA 3I9V9 3JYTB 3PYDA 1FX2A 3J7YU 5IOSA 3GCWP 2N7YA 4E8UA 5THWA 2FVQA 2P6TA 5E7OB 1S1UA 1HR0J 1YI2S 2MLXA 1F5AA 5GAHU 3C6TA 2HHTA 3I4MK 3DGPB 2GQ2A 2VA2A 3WZ0A 2JEJA 2YX4A 3TOQA 4ZVUB 4MEXA 3H0PA 4J91A 3PYFA 2VKZG 1DD5A 2FD2A 1RHQB 2GNKA 1CJTA 2OELA 4KGKA 1XBWA 3NMAA 1IR1A 2RT3A 2WSFC 4RW6B 3MPVA 3Q8SB 1FFSB 2DNRA 4KAWX 1HPZB 2Z2ZA 1RT2B 2JA6K 2E7VA 5M2PA 4C3JK 1BY9A 1Q5YA 1S6UA 4DSKA 4A8SA 2UZAA 3CDEA 3A1YG 3PIPQ 5BYQA 3UDVA 3OTOJ 4KMAA 2I5JA 2ZC3A 1HNXJ 3IRWP 1YJ7A 3SSSA 3AD9C 2XCAA 2WB4A 1RAIB 3HOVK 5CCLA 3UI3A 4F50A 2DGUA 3G8SA 1K0TA 1TAUA 3VVUA 1VJWA 1NK6A 4M5GA 1HNWJ 3PRBA 2OPPB 1N4LA 2JLEA 3UWTA 1QM9A 2PA8D 1X9SA 4U7CA 3N5FA 5D3GB 2MPUA 2BRLA 2P2CB 4CLTA 4DL6A 2QEXS 2R8JA 1AUSL 2B9WA 2V69A 4ZP7A 1SKUB 2E9RX 3JSTA 4WFAQ 3BKFA 2HQGA 1IJEB 2JA7A 4HHUA 1URNA 2XY7A 4KE5A 2M88A 4A47A 2A6HA 2GC8A 1JNZB 4C6AA 2NVYC 4AUKA 3KLEB 3QRRA 1GQEA 4Q5SA 1O8BA 5AE1A 3BV8A 1KQFB 3DMJA 2DRDA 5D78A 5F9NA 4DV7F 4DL5A 4EGLA 2GFFA 4CO4A 3S14C 3RB0A 2KT5A 5KTQA 4U8YA 2BE7D 3A8KA 2HNYB 3NY0A 5KFHA 5FLXU 1D9AA 3IWNC 2PMHA 1V3RA 2A10A 2JC0A 4K4VA 2CQBA 2CFAA 4DSEA 3PX6A 5L9NA 4JI3J 2HMIA 3OFGA 3CO0P 2JVOA 3S1NC 4LK1A 4B3OB 1IKXB 4AYBD 1QAJA 5DO2A 5DGAA 1KTQA 2QA1A 2VQFF 4A3EC 2CAJA 3BKTA 1P9QC 1SJFA 1RHJB 4P7TA 4KGMA 4B3TF 1NSKL 4G7ZA 2GMLA 1KWMA 1Y1VA 2VBZA 2W9CA 1RT3B 2HS3A 2J9DE 4ED3A 1GMUA 4X65F 1AUDA 3EZOA 2YNGB 3QNWB 1SL2A 3PHEA 3WIVA 3QSIA 1NNDA 1SQGA 1JQGA 4DUZJ 1SI9A 1Q5VA 3GEIA 3MR5A 2ZH7A 3G96A 4ZVRB 4RW4B 4DR7J 1RAHB 4O3OA 2ABYA 3OLAA 1MG7A 2MZTA 1WSVA 3A13A 3D9BA 3DLBA 1X7VA 1DARA 4OYXA 1HQUB 5HATA 1KTVA 2W4DA 1TKTA 2E9ZA 2RRBA 1I3OB 2OPSB 3LPXA 2XZDB 3D4JA 3BYRA 4Y52C 4DR3F 4F0MA 4A3IC 3RAXA 3R27A 2NXEA 1HNXF 4URQU 3N79A 3GTPA 5KFOA 4BY7C 4IR1A 1L3UA 4GVBA 4UOCA 2XSJA 3OD2A 4H4MB 4USWA 3R2CJ 2KZZA 1HBUB 2UV8G 3HVWA 2HNZA 2OPQA 1WQFA 4PUOA 2R8IA 2KVIA 5EWFA 4N76A 3AOBA 3HCXA 1ISEA 4RNMA 4FP9A 3W3SA 4ZVPB 3M4OC 3JAMY 5DQGA 3TVYA 5LJ3Y 4IR9A 2ROPA 2VQFJ 3KKFA 3HKZL 3S7RA 1U02A 4J90A 3OVAA 4F02A 3D0GE 1FE4A 2AJFE 2NXUA 3OXLA 3P4UB 1SC4B 3VA7A 2AGPA 1TWAC 3RTVA 3E8OA 4U95A 4CO5A 1WELA 1FDBA 4B02A 4A3GK 4KHMA 2KRRA 3HOWC 3ILJA 3ZTPA 4QBUA 1I6HC 3FCHA 2E2IK 2DGTA 1KVJA 5HQ8A 2YVSA 1EARA 1U7LA 2R42A 1RP5A 1HARA 4Q8EA 3ETMA 1TKDA 5ETNA 1GAOA 1S1UB 4UZBA 4I2PB 5L9XA 2I8EA 1S7IA 2CQ2A 4QIEA 3ENQA 2X3DA 3S2DK 4HH1A 1BC6A 5KT2A 2ZEJA 3GMGA 5EGHA 2K7KA 1N5VA 4OJ1A 3AXMA 4P73A 1TQLA 1OSCA 3VGUA 2PI4A 2O1PA 2DNKA 4NXMF 1X0FA 1M1GA 2ZH1A 2ZDOA 2W2OP 3GTYX 2WOMA 3LAJA 3OSPA 2D7SA 1J6WA 2J9CA 2WVFA 5GMDA 4NYOA 3S1NK 3GTLA 1T11A 1HBNB 4A3FC 2DGQA 4KM8A 4KO0B 3FMBA 3S01A 1BQXA 1LW0A 2VPXB 5C4JC 3M3YK 2IRUA 7FD1A 2RRAA 2NSCA 2VOOA 3JQMA 4MH8A 2W9AA 5AXKA 2JEGA 2V6SA 4L6V3 1HA1A 2BEFA 5D6GA 2CQ1A 4BDPA 1H0HB 2PGCA 4IFYA 2XS7A 4M95A 2EW9A 2GVZB 1KQSR 2EKNA 3IAM9 1B3TA 4Q2MA 4I2QB 1J5OB 1QSLA 1ZQ1C 3V81A 1PC5A 5CAAA 5DM6Q 1RWKB 1M5SA 2B6AA 3TJ9A 2FQQB 3HI9A 4X4TA 4RBUA 2Y0SL 4H54A 3C14B 1PGZA 4DR6F 2ATCB 2QLFB 3CNQP 2J6SA 4OYOA 2OTLS 4J3NA 2OKQA 2GAHC 2HNDA 1CEZA 5KOWA 4NX9A 1I50A 1CSJA 1EQMA 2BX6A 5C2CA 5IC4B 2I6WA 1WEXA 4IOAQ 3HSJA 2R92K 2NLWA 2COLA 4JBCA 1ULRA 5D3GA 1S77D 1U48A 4CNZA 4ZVQB 2BANB 3QAUA 1F5CA 1ZA2B 3DHWC 5F0UA 3DU6A 1OIAA 4NLOA 5IORA 3J7Z5 1S72S 3N6LA 3KMSA 4JV2A 1KKHA 4YUDA 6FD1A 1MWQA 1J6XA 2W24A 1S9GA 3M2RB 4IKAA 1YRUA 4P10A 5LSLA 3P5BP 5CCMA 4I7FB 4L76A 3OTDA 2DK2A 3VGVA 2DRAA 2ZOGA 2LA4A 1UZDA 1RWWB 4FPIA 4C2MC 1BQNB 4J9SA 4D3GA 3S1QK 1KLMB 3CJ3A 2OMOA 3MAHA 3V4GA 2G13A 4XK8C 2QC3A 5SUHA 1TUGB 2Y1JA 2C3YA 2G1HA 4RW6A 5DS7A 1S7HA 1RTZA 4J5OA 2ZUFA 2FLLA 1RLDA 2MKJA 4YR0A 2KDOA 2HZCA 4DN9A 1LXJA 1HBMA 2RE1A 3IRXB 3RB4A 3FQKA 1E6YB 2QJ3A 1HWUA 4K5SA 2ZH2A 3KHHA 4DV5J 3SCJE 3QT5A 3MUMP 1WHWA 1FD2A 1BJTA 1D3WA 2W7PA 2WSCC 3CCTA 1W2IA 2R7VA 3W65A 1LW2B 3B82A 5AJ3F 4EWTA 3FCWA 2DHXA 4IG0A 2V9WA 3PO3C 3PXGa 1JJHA 1NMEB 3M1VA 4QWCA 1RCXB 2AF6A 1K44A 2JA5K 5A8RA 3TW0A 2FC9A 1R8BA 2B4VA 3IGNA 1Q82T 1Q8BA 4CLWA 2XCOA 4KJIA 2KN4A 3KLFA 4FM9A 3B8HA 3LTOA 4A8MP 2YWHA 3UD4P 4R5PB 3MOZA 3OHAA 4BCAA 3D5MA 4YFNA 1FDNA 4GKKF 3ERED 1HIYA 3VWSA 3LALA 3CCLS 4NXNF 1XN9A 4O3PA 2OPPA 4Z7YA 3Q8UA 2DR5A 2E29A 3BZQA 3I9ZA 3PR4A 1YG0A 1RKIA 1FE0A 2Y0SD 3EQLA 4L72B 3OPKA 5JJBA 2CZ4A 1QAYA 2QTWA 2LYVA 3AOCA 1JLFB 3PEJA 1VHFA 1HHTP 4GKJF 4RNFA 1M0SA 5KFBA 3EGNA 5DJBA 1D9FA 2AEFA 2NVQK 1DQAA 2ZFHA 3RB6A 4QPTA 5KG1A 4P5AA 4MK7A 2WB1L 3T1HJ 1G51A 4MKAA 1AFJA 3G4SS 2OUGA 2XLIA 2MMYA 2D9PA 3CT9A 2YX7A 2MQNA 5IT0A 3DLLQ 4A3KC 2IAJA 3TX0A 3E01A 3GQCA 3D66A 2P9CA 4I2PA 1EFWA 2PD1A 3H42A 1KQ4A 2PIIA 3W9JA 2BKOA 3FBFA 4ELVA 1BGWA 5C42B 2OHDA 3N28A 3IFEA 1VC6A 2CYYA 3IWLA 3GCXP 4QPXA 3HXMA 4PWUA 3FGVA 1YBUA 1CVJA 3LH2S 5RUBA 5KFMA 4OZNA 4LK0A 4DG1B 1JLAB 1L5UA 4PZVA 1ZM9A 4DV2J 1RTDB 4RW7A 3GTKC 5CZXA 5EUHA 1UPMB 1VRTB 2ZBPA 2C2EA 4X2BA 3LANA 2RQCA 2POKA 3VQTA 3M9NB 5I3UB 1VI7A 3M8RA 3JYTA 2PSZA 1TWGK 4QIVA 1JLGB 1TL3A 1CC8A 1IKYA 2NVXA 3RB3A 3DM2A 4OX9J 4BBRK 2BE2A 4XTTA 2PI5A 2V68A 1D09B 1F2HA 2LDIA 3I82A 4RBTA 2CZ9A 2XS2A 4NXMJ 3AA9A 2YKOA 4ZN1A 2UXBF 2K3KA 2KL8A 2LXUA 1UAWA 1RWXB 4DJBA 4C3HK 2OGUA 1AYEA 2CQDA 4OYPA 2NPFA 4CO2A 1PBAA 5CYQA 2DNPA 3CCQS 1MROB 2PEHA 3EZUA 3OL9A 3BS9A 3V2UC 4Y7NK 4LR2A 2H1YA 1R0AA 4LLGA 2IC3A 3CULA 2AYEA 1S1XB 2CPXA 4XPEA 4BY7K 4R25A 1VLOA 5LMNF 4YB6A 4USIA 1LEOA 7AT1B 4O3QA 5ETLA 3W8PA 4PQUA 3KK2A 3AAWB 1TWAA 1OPIA 1BE4A 3PCOB 4PQAA 4K7QA 1B64A 1ZAXA 3HOXK 3MM8A 4CLYA 4C11B 4CLSA 4OIXA 3M6WA 1MMNA 4QW9A 4ZVEA 2HVEA 4OZ1A 2ZUEA 1WEZA 1Q79A 4F04B 4QW8A 1DFDA 2GJ2A 4GTBA 2IA6A 1HWKA 5BR8F 1S1VB 1GFWB 1UEKA 3HVAA 1QJHA 4Z7CA 1XMQJ 1NK9A 3DLGB 4KGVB 2CWKA 1R8AA 3KK3A 1S9EA 4MK8A 2HSEB 1B4SA 3BR9A 3HOZC 4QU7A 2NQPA 1DRZA 2YBVA 2KI2A 3TA0A 1UCNA 3TFJA 5D0RA 2X51A 3MEDB 1OY6A 1J5EJ 1TFWA 3BH6B 4DV5F 4RW8B 2DY1A 4DS4A 2W4PA 4RNOA 3CJKA 3BP3A 3H3VD 3KLIA 4DR7F 2QMUB 2PMZD 3V4MA 4OYZA 4X62F 2KG1A 2L9WA 3F73A 3AB2B 4ZN3A 2W4CA 1NSQA 1FWLA 2KYXA 3QT6A 4XLNA 1IKXA 3GG0A 3DNCA 3ZZ0A 4WZQA 1LOUA 1TV6A 3SDEB 2N7CA 4F4ZA 3MEDA 3FRZA 4R0EA 1RHRB 3KUEA 5F8GA 2XTJP 2KO1A 2EK1A 5B0FA 1NLKL 1PC4A 1YRTA 3P96A 4BBSK 1U0HA 2M4MA 2MGZB 2UXBJ 1WDDA 1E6VB 1BLUA 3IR7B 1ZOTA 2E5IA 1U09A 3QATA 1FEEA 2B8QA 2MDAA 2BXJA 5G0RB 1S0VA 4UQTA 3RZOC 5A76A 4DV4J 3H2LA 5BR8J 3GTMC 2IBKA 2EKYA 1IBKJ 3VCDA 2IJNA 2BZ2A 1TL5A 1GH8A 4J9UE 5IYBK 1RT1B 1TL1A 4A3JK 5HMWA 1NKEA 1H72C 5IYCC 3PO4A 1M5KC 3CCRS 3NGKA 4J9QA 2HNZB 2OPQB 4F4KA 2FGCA 2MQOA 3BQ0A 4Y2IA 2DBBA 1YJ9S 2E5LJ 4KN7A 4P2MA 2KT2A 2IJFA 2B0GA 3VAIA 3KLHA 1RT1A 1DCHA 2I1RA 2GQQA 1WORA 5LSRA 4FXVA 4B9MA 1GTEA 1RHUB 2YKAA 5C24B 2HBYB 2CVEA 2X1GA 2R4FA 4GVLA 1RAJA 3PJ9A 3I0SA 3MM6B 1N48A 3BREA 4OV1A 4M5DB 1TTHB 1W7WA 3HOXC 3GTKA 1R27B 3CVKA 4RU2A 4C8MA 3QT8A 2IFXA 2X1AA 3OVSA 3G6YA 2B3TB 1TKZA 3OVBA 4U8VA 1IKWA 2B8PA 1RWOB 1P27B 4KKOA 1NSPA 2DPIA 3QLHB 5E2QA 5HMYA 3UQSA 4B9SA 3KYLA 5KG6A 3K2YA 5HI7A 4Q0BA 3Q8RB 2EI5A 1SQEA 2KFZA 2HS4A 3TA2A 4DV4F 5C3EK 4OINA 5FLMC 1Q0NA 1X4GA 4CWBA 2YWFA 2G2ZA 4FF4A 2NYIA 4JB8B 2R3VA 1S6PB 1VOMA 3WBZA 4B9LA 4ZITA 3FSXA 1QTMA 3HOUC 5H9EJ 1KNZA 2UU9J 2G4BA 1NCLA 1R0BG 2VC1A 4LUBA 4PABA 3NCQA 2ZH6A 4U7UD 1JLGA 1VQNS 2VONA 1NKCA 2ZZTA 4LFBF 3TWZA 1BUXA 1OYEA 2OP5A 1UVLA 3M4OK 4DPXA 2CJYB 3ZTRA 4A3KK 3FC9A 5J2NB 5EWGA 1D9DA 1DLOB 2ROEA 1KDNA 1R0AB 2QIFA 1HBOA 3DC2A 4U96A 4A3MK 4N7TA 3NGRA 1N33F 1L3SA 3Q2TC 1RTHB 2RD5C 4WE1A 4O0IA 5CH7B 2UUAJ 5K9FA 1JWWA 2DHHA 3ZZZA 5KFSA 3ICLA 1CQNA 3QWPA 2B9YA 1HLWA 1S6QA 4HH0A 2VA3A 2DJWA 3IBWA 2W2NP 2AGQA 1D8YA 5C4JK 4HDHA 4NOHA 1HKAA 1LWFA 5K14B 2X3GA 1TMMA 2A18A 2RKIB 1F3FA 2NVTC 5A8WB 1FNXH 1C0TA 4PYDA 1JLQB 4BBSC 1RTHA 5CYJA 1IQTA 5E3RA 5LMNJ 1RDRA 2IA0A 1ICEB 4CLLA 4WYWA 3R7NB 2QSWA 3K5LA 1T7PA 2CNLB 3DI6A 2CNKB 3D7SB 1H7WA 3G6ES 2QMXA 1L3TA 2HNDB 2HVZA 3GFXA 4YY3F 5HANA 3CPWR 5JXSA 2ASYA 3K8WA 3E3XA 4NMXA 3WC2A 1S48A 3IG1B 5KG4A 2V6TA 1LFPA 1R8PA 4LJZA 4DUYJ 4RUCA 2YH1A 1SXLA 4KMDA 2OSRA 5KFFA 1UKUA 1VQ5S 3R1LA 2FJDB 4JI4F 2JA6C 1M90T 4FXDA 3DLKB 1KLMA 1FHTA 3CB4A 3ZC4A 3SCKE 1N0VC 2AJQA 2DO0A 2V50A 3ETOA 2W9BA 4RZRA 3VAJA 1FTCA 4RUBA 2YQ1A 1RT6A 4Q4ZA 1GMWA 2O5IA 4USTA 2IRXA 1KSPA 1X5PA 1ZH5A 3BQ1A 4LRCA 2BR0A 1WUUA 5HL7Q 2WVBA 4DFPA 2HQ3A 2FUG9 5M2RA 5HL8A 3HHLA 1YBAA 2ZE2B 3PFEA 1IXKA 3EVWA 5T41A 3IA0A 4DQRA 5HBMA 1JJCB 2BJ8A 3T01A 3M6XA 4Z2XA 4X64F 1Y4ZB 3NG8A 1HD0A 1APSA 3G9CA 2BE9B 3OR1A 2R92C 4DX5A 5LJ5Y 2O66A 4S0MA 3POTB 1NB2A 3DXSX 2AW0A 2F5GA 2UUCF 1SUQA 1H74A 1SFOC 1UTAA 4DDQA 4USHA 1JJ2R 2J6TA 4P6QA 4WILA 2QLWA 1M1HA 5HJXA 2YKMB 5IM0A 1O2FB 1S12A 2XM3A 3LF0A 5C4XK 3HPOA 2E2JK 1NXIA 4G0UA 1JK9B 3HLUA 4EEYA 4LREA 2KVQE 3T3FA 4IOBA 1I1GA 2AJ1A 1XR6A 3DHXA 3UCGA 2A1BA 3IM8A 4DEZA 1NM2A 4OIOA 4WFXA 3K57A 4FPRA 5K8MA 4B3TJ 3PO3K 4NLDA 1OQ3A 2LQJA 1WKKA 3N3YA 2P8TA 4LSLB 5KFCA 3AQOA 3B54A 3OR2B 2B6AB 1HFEL 3HKZD 3IN5A 2YWGA 3PRDA 4ES3A 4NYPA 4RWXA 3H4DA 2RQKA 3BR8A 4HI1A 4AH6A 2U2FA 4I6AA 1U1KA 4DFMA 3NNHA 3VZIA 4G7HA 2VUGA 5EGYA 1XMOF 1WF1A 3BB5A 1TKTB 4KT0C 3GILA 2JA5A 1WG5A 4PAAA 2DH8A 2XBPA 2IPOB 1BGXT 4C0OC 4G7OA 3GU0A 5K8NA 1IBLJ 1JKHB 2VPZB 1JOEA 3NS6A 5D15A 2SXLA 1SMYA 4TY9A 5KFWA 4ZJQA 1WEYA 3LAKA 3CDAA 2WOMB 1W2BR 4JI1J 3FKBA 1WWHA 4O3SA 3J7ZT 4F4XA 1IWGA 1HBNA 2FY8A 3IR5B 3HFKA 4R8UA 3W2WA 4TQSA 3C16B 4UOGA 1TL7B 2O01C 1TKXA 1YGYA 3MPUB 3CJTA 3TFHA 4LBHA 4XAKA 1DQ9A 2JA8K 1TWCA 3NOCA 1X5TA 1IR0A 2D74B 2JSXA 1VH2A 1S57A 3DOKB 2ZDPA 3M8PB 4DQQA 4P71A 3HFZB 5FDLB 3GV5B 1MSWD 2DXEA 1TV6B 3BGLA 2W25A 3N5BA 2BUNA 1JLEB 3MCMA 4MFBB 4A3DC 2VHGA 4OMFG 4QWEA 4LT6A 3PTWA 4FVMA 4NLYA 3IS9A 2Z30B 1KHWA 4WTYA 4ZVGA 4RW9A 2DITA 1IKYB 3SQGB 2MTLA 4K0KJ 4GVBB 5D0GA 3HDSA 3T9ZA 2ZUGA 3KWMA 5BYRA 3W2VA 4LF6J 4X66J 2HVHA 3O6QA 4DS5A 2BOAA 1VK3A 1RAFB 1XQIA 2VUMA 4ER8A 4WU3A 2LXIA 4UF4A 3ZZYA 4AE5A 5L1JA 2Z0GA 1VC0A 3QRQA 2M8HA 5F41A 4EZ6A 4OHZA 2ACYA 3VVTA 4WWSA 1WC3A 2XS5A 3KNGA 5ETVA 3HOUK 2FDNA 1D0EA 4HTJA 4N56A 4XO0A 2D1CA 4DOZA 3DN9A 2R8KA 3G86A 4OJHA 3IG1A 4OIQA 1U0SA 5CYQB 3TEGA 2IMWP 4BBYA 4LRDA 3T02A 3CD0A 2IJRA 5KFJA 2OJ3A 5A8KB 5B0AA 3AHPA 3LPEA 3KJFB 1BMQB 2GHWA 3R5CA 3O3LA 3GJSB 2CQ4A 1HNIA 3I56S 1U47A 3L7UA 5HMZA 3MECA 2LECA 3W2VB 4LSNB 4B9UA 3C6TB 1FD8A 1SB6A 1FRMA 3T00A 4MT1A 2YNFB 4KHRA 2V5HG 4MYTA 2NVYA 1U45A 3KUGA 3SYZA 2HS0A 1J6VA 3HHLD 4IYQA 3E51A 4OYBA 3NRBA 2QG9B 1L3VA 2R7ZA 4DR1J 3UN2A 3KDOA 4C97A 2JX2A 1HHSA 1HQEB 3MMLB 5E33A 3SCLE 1AFIA 3RGIA 3L95X 3RZAA 4LIRA 1KQGB 1WC6A 2VKRA 1RSCA 3N6NA 3VZHA 2DR6A 4LF9J 4ZLLA 2E5JA 3ZNUA 4DDFA 2ZVSA 3PW7A 4OI1A 2Y0BB 4DR4F 5C44C 2XO6A 4C3IK 4X64J 3Q3QA 3BJYA 5L1IA 5K14A 4UT4A 4ZLPA 3IO1A 3HHLB 3SQOP 1W26A 4M5LA 1CLFA 4WTOB 1Q95G 4TKTA 2XQCA 4P7VA 1RTIB 2YNHA 5CQGA 3FQLA 4AXJA 4LFCJ 5CHPA 2IBOA 4PEOA 2NREA 3KG0A 1CPZA 2XLKA 1FRLA 4JV5F 2JLFA 3T5LA 3TAMB 1TUVA 3C66A 4NLVA 2GO9A 1JX4A 3QJPA 1O51A 4C2MK 2BACA 3MR2A 4ZJOA 3VGSA 3L4BC 3HOVC 1JXVA 4HDGA 3C15B 2VIHA 4F4WA 2BANA 4JI3F 4KARA 3S2HK 4KHPJ 3HT0A 1VRUA 5IWAF 4TU8A 3I32A 1U1LA 3BYPA 1EQ0A 3NS7B 2F8HA 4TU9A 3H2UB 5BYSA 3TUIC 3M9MB 2EG1A 3QZ8A 2FPHX 5HROB 5CD4A 2G2YA 2EBEA 2EVZA 2J8SA 3DI6B 1KFDA 3K7RA 1SCJB 2XHWA 3KTQA 3OBIA 2DKOB 2RF2A 4LF9F 1RISA 5C4XC 2LQ9A 3VF0B 2U1AA 1GK8A 4A8FA 4YHHF 2L08A 2M0GB 3OFHA 4RBVA 4KIAA 1NHKL 4XIUA 2LDYA 4NCAA 5TJ3A 2XWXA 1CG2A 2XG8A 4XCHA 2ZBIA 2E1RA 3BQ2A 1TUWA 2WRMA
chains in the Genus database with same CATH topology
1WORA 1XZQB 1YX2A 3A8JA 3GEIA 3AD9C 3GEHA 1VRQC 1PJ7A 1WOOA 4PAAA 1PJ6A 3A8IA 3TFIA 3GSIA 1X31C 3AD8C 3A8KA 3ADAC 2GAHC 1V5VA 3TFHA 3TFJA 1XZQA 1WSVA 4P9SA 3AD7C 1WSRA 3GEEA 1WOSA 3GIRA 1XZPA 3TTGA 1WOPA 1XZPB 4PABA 2GAGC 1PJ5A 1VLOA 5L46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOR A;  1XZQ B;  1YX2 A;  3A8J A;  3GEI A;  3AD9 C;  3GEH A;  1VRQ C;  1PJ7 A;  1WOO A;  4PAA A;  1PJ6 A;  3A8I A;  3TFI A;  3GSI A;  1X31 C;  3AD8 C;  3A8K A;  3ADA C;  2GAH C;  1V5V A;  3TFH A;  3TFJ A;  1XZQ A;  1WSV A;  4P9S A;  3AD7 C;  1WSR A;  3GEE A;  1WOS A;  3GIR A;  1XZP A;  3TTG A;  1WOP A;  1XZP B;  4PAB A;  2GAG C;  1PJ5 A;  1VLO A;  5L46 A; 
#chains in the Genus database with same CATH topology
 5CJ9 A;  2M52 A;  5KFG A;  1KVK A;  1YJT A;  6FDR A;  5EN1 A;  4C4W A;  3HHN B;  2HHX A;  2J76 E;  3I87 A;  2YX1 A;  1BXN A;  1UFL A;  4CT8 A;  4ZVS B;  3GTP K;  2HQF A;  4K2X A;  1RT6 B;  4G1P A;  1C1C A;  1K83 C;  5B0D A;  4C98 A;  2LEB A;  4NLT A;  3CJ0 A;  1TVR A;  1UJ4 A;  3OFF A;  4O4G A;  5HN0 A;  4DL2 A;  1RT5 B;  3N0B A;  1S1V A;  1U24 A;  3QGP A;  4UY8 5;  2B4O A;  4YG2 A;  1K0V A;  2DIV A;  1WHV A;  4PG4 A;  5HVF A;  2FJV A;  2HFO A;  1YNJ A;  2ZNY A;  1J5E F;  3CDU A;  1T3N A;  2WAQ L;  4USV A;  3JXO A;  1C1C B;  4NLG A;  3NNA A;  1XZP B;  2GVD A;  2AV5 A;  4LRF A;  4JI5 F;  1DTT B;  2HBQ B;  1C1B A;  4IH5 A;  1IKW B;  4KGZ B;  5D4D A;  2Z4P A;  2C1E B;  1R31 A;  2LFV A;  2HHW A;  3RR7 A;  1YJR A;  2HWT A;  3DXJ A;  4DPU A;  4JYA F;  1ZVU A;  1QAI A;  2MQL A;  4YB1 P;  4O3R A;  3D68 A;  1VQP S;  2DO4 A;  3HUL A;  2OAU A;  1ACM B;  3P49 B;  2MZQ A;  2VG5 B;  2V4Q A;  2VFS A;  3O8W A;  3PW4 A;  2AJ2 A;  3PEH A;  1N32 F;  4XSX A;  1RE1 B;  3Q8Q B;  5EX0 A;  2OPS A;  1GXL A;  3HHK A;  3S15 K;  4KH1 B;  2CPY A;  3GIJ A;  2M2B A;  1VQM S;  5GAE I;  1NJX A;  3MUV P;  5MAO A;  4ED1 A;  3A8I A;  2CPJ A;  4ECW A;  3M7V A;  2GMJ A;  3TQE A;  2UUT A;  1NK8 A;  2H51 B;  2QGF B;  3VTI A;  1ARO P;  2ZFZ A;  5F8L A;  4ECY A;  5TMC A;  3LW5 C;  2Y9H A;  4TLQ A;  4OI2 A;  3MEE A;  4IFV B;  5IOQ A;  3MMA A;  2HHS A;  5DZ6 A;  1FRI A;  3OTC A;  5IYD C;  2X1B A;  2H48 B;  3C46 A;  1ZYR A;  2CW0 A;  4B08 A;  3O2I A;  1RU0 A;  1INN A;  1L0W A;  2XMK A;  4K4W A;  1G4C A;  4IFV A;  2HHH J;  1NK0 A;  1FEH A;  2VBY A;  3BSA A;  4O4R A;  2YH0 A;  3Q0A A;  2PFD A;  3HVT B;  4NLW A;  3S2D C;  4PPD A;  3AFG A;  2VFR A;  4M1K A;  3UN5 A;  1J5O A;  4X84 A;  2J7U A;  3UW1 A;  4RJV A;  2LA6 A;  4FS2 A;  2JA6 A;  1VFJ A;  4DWI A;  3NCR A;  1N5Y B;  4OI6 A;  1DCP A;  1Y1V C;  2PDA A;  4JI0 J;  4E98 A;  4I6W A;  3QAE A;  2C2N A;  2JC1 A;  1JLF A;  2CVI A;  5L38 A;  4EZ9 A;  4NLX A;  3TO8 A;  5HAO A;  3EGV A;  2NZC A;  4RMF A;  2EWH A;  2XMA A;  1P8G A;  4Q7A A;  4Y6I A;  1REG X;  5J2Q B;  5M5W K;  3BO4 A;  3WQP A;  1RI7 A;  4URG A;  2Q3P A;  1ZM4 A;  5H1S V;  5GAG I;  1KP6 A;  1WQG A;  1DBD A;  1VGX A;  5J2P B;  3MHY A;  3ORE A;  4QIG A;  4B3S J;  3M8Z A;  1YSJ A;  3I4H X;  2QSF A;  4OL8 A;  4G65 A;  1VBK A;  3OUY A;  3LGN A;  4AQY J;  5FJ4 A;  4UY8 T;  1RT4 A;  3DLG A;  4ZJL A;  4JI2 J;  5CHC B;  4G1I A;  4IO1 A;  3H25 A;  3TUZ C;  5KFY A;  2XO7 A;  5BXI A;  4A4J A;  1LNQ A;  1MMD A;  2I9S A;  3C15 A;  4ZPT R;  4RLE A;  1FES A;  3NBP B;  3CW2 C;  3NS5 A;  2JVR A;  1MW7 A;  4DBQ A;  1VMB A;  1JLC A;  4XPC A;  3OL8 A;  1SH0 A;  3FSI A;  3MGJ A;  2LMI A;  4O44 A;  1O27 A;  1B7F A;  3ISN D;  3DGP A;  1U4B A;  1Y10 A;  1Q4R A;  1RAD B;  3O5T B;  2AX1 A;  4ZOS A;  3PR5 B;  3KLG B;  2NSB A;  3TAP A;  2V4R A;  1TMJ A;  3SDE A;  3NGS A;  4UOF A;  4DR2 F;  1Y1W A;  4IDK A;  2UUB J;  2FZK B;  4USU A;  5E0O A;  4ECT A;  3K58 A;  3GTQ A;  1LWX A;  4O4G B;  4JV1 A;  3S6E A;  4PG7 A;  2VJV A;  3GTQ C;  3H7H B;  4ZPD A;  5KFN A;  2R2S A;  4TLR A;  3RBZ A;  3G6X A;  1RJJ A;  4N77 A;  3BP8 C;  3K5O A;  3OPF A;  4DU7 A;  3GII A;  2G0C A;  1PAE X;  1TR0 A;  3UNG C;  1RGV A;  5IP7 C;  4JI4 J;  4F2R A;  4KTQ A;  2ALZ A;  2RUS A;  1U6Z A;  5C25 B;  2E2H A;  4OZ2 A;  2DGO A;  4QWD A;  2KZM A;  2IHR 1;  4PKD B;  5HO4 A;  1G3O A;  1AB4 A;  2F4V F;  2MQM A;  1PG5 B;  1XXA A;  4R0J A;  4PQU B;  2DPJ A;  2OML A;  2DVI A;  2MSS A;  4FKX A;  4CZC A;  2YY3 A;  3SIP B;  2RU3 A;  5ETT A;  4CM0 A;  3BBF A;  1VQL S;  1LV5 A;  1DTQ B;  5KT7 A;  5C44 K;  2DXF A;  3K17 A;  3DGV A;  1TL7 A;  3UN3 A;  2GO8 A;  2KFY A;  4WF9 Q;  4IUF A;  2G2O A;  5E3A A;  4WFY A;  2NXN A;  5I3U A;  3T41 A;  2F9J A;  5FLX Y;  2J0X A;  3LP0 B;  3CGI A;  2E7W A;  4LRA A;  4DZD A;  4A3C K;  1G1X A;  2KYZ A;  3MD3 A;  3AJD A;  4BXX C;  5LMU F;  1FKO B;  4KGX B;  4QR0 A;  1MN7 A;  1Q78 A;  1U26 A;  5C7P A;  2IRY A;  3HSD A;  1CJV B;  2YQ3 A;  1FKP A;  5F8J A;  4C3J C;  3DFE A;  5I42 A;  1L3K A;  1U25 A;  1IN0 A;  2V8V A;  3GFZ A;  4Y28 C;  2OEJ A;  4FXW A;  4X4R A;  4I7F A;  1J98 A;  4U7U K;  5AXM A;  3CD7 A;  4NZ0 A;  2YPZ A;  1YIJ S;  1FJG J;  1SJ1 A;  1HI9 A;  3NKY A;  4WCE Q;  2QA4 G;  1FK9 B;  1YKW A;  2ZHB A;  4E2F B;  3Q22 A;  2XCQ A;  2WON A;  3ISZ A;  1S6P A;  4ZLJ A;  4DL4 A;  1G6B A;  4C8K A;  5FLM K;  2F4V J;  3H59 A;  5HLF B;  1JB0 C;  1VK8 A;  1WNE A;  5J2N A;  5U47 A;  2UXD F;  1GXT A;  5E5N A;  2MGZ A;  4ZHR A;  4XSZ A;  1TK8 A;  3M05 A;  4GTC A;  1HQ2 A;  1NBE B;  5IOL A;  1PJ7 A;  4FNI A;  2HG4 A;  1KON A;  3WDO A;  3QFW A;  4MKY A;  1IS1 A;  3HSZ A;  2HQI A;  4B9N A;  3G4C A;  1HHQ A;  2C22 A;  1XMO J;  1P1T A;  5B09 A;  1T9Y A;  5LM7 E;  1N36 F;  3QFH A;  5LMU J;  3JAM U;  2ZBC A;  2AKW B;  1K8A T;  4BKW A;  3RZD C;  3MPD A;  4O23 A;  4A3E K;  3D0I E;  5IT9 Y;  3S1M K;  1H2U X;  1VRT A;  4P2F A;  1CJT B;  3PHT A;  3PY8 A;  3D1O A;  2P6S A;  3A12 A;  1HW8 A;  5ETP A;  3UD5 A;  3EM1 A;  3UVJ B;  3GTJ C;  5F8M A;  1YJV A;  1LWE B;  2K8G A;  5IT9 U;  2IVY A;  2Q1L A;  3GWC A;  4A93 C;  5ETS A;  2OPR A;  3S0X A;  1KLN A;  5J2P A;  5IYC K;  2Z8Q A;  2GSO A;  1HNV A;  3RW6 A;  1C0U B;  3D2W A;  4IO9 Q;  5E41 A;  3TAR A;  5IFM A;  2AEJ A;  5GAE U;  1PYS B;  4AQY F;  1S4F A;  1FER A;  2FVC A;  1EAY C;  1JLB A;  2VZ9 A;  2BE2 B;  4M5M A;  2RS8 A;  3D1Q A;  4CH1 A;  3AH6 A;  5KFP A;  1HNZ J;  4A46 A;  1TWF K;  1K47 A;  5MLC V;  4DLE A;  2J8A A;  4CP5 A;  4YEA A;  1VQ6 S;  2GQC A;  1HNV B;  1T05 A;  2DGV A;  4B3M J;  1PSD A;  4LMZ A;  1RCO B;  2YNI A;  3IP0 A;  4EU0 A;  4OYI A;  1I50 K;  2DR8 A;  2QN6 B;  2JRS A;  1P1L A;  4DV1 J;  4GTA A;  3BBB A;  3RRH A;  4NA1 A;  3OR1 B;  4YFK A;  2JZ5 A;  1S1X A;  2MKC A;  1NB7 A;  2DIU A;  3KJQ B;  1MNE A;  4MTP A;  4C3L A;  2CJA A;  1CUL B;  2VJU A;  4OI0 A;  2QZ8 A;  1V5I B;  4Q43 A;  3BM7 A;  3M8Y A;  2RHS B;  4HHH A;  4NA2 A;  2HWI A;  3OJS A;  2IDE A;  4ECX A;  4AL5 A;  4GTF A;  2NVY K;  2Y1R I;  3LO3 A;  1I6H K;  1UFW A;  5ETQ A;  3GTL K;  2YKM A;  3KLV A;  3RW7 A;  5DRK A;  3NWG A;  4E0D A;  3QGG A;  2ZD1 A;  3BN7 A;  4C3K A;  4OHW A;  3QSY B;  2E1C A;  5LL6 d;  1HYS B;  3PNI A;  4DHV A;  3SBM A;  2R93 K;  2R7W A;  3SZZ A;  3BO3 A;  1XNR J;  3ZTQ A;  1S4E A;  2HBR B;  2V8H A;  3AOA A;  5E3C A;  3US5 A;  1JNR B;  4KB2 A;  4WII A;  2NPI A;  3HD1 A;  1BQN A;  2FQO A;  3H3V L;  1NK4 A;  3MD1 A;  3FBB A;  4DU8 A;  3KLI B;  2FJB B;  4OI3 A;  4LF4 F;  2BQ3 A;  1DTQ A;  2ZM6 J;  1SH3 A;  4OHX A;  3SZY A;  3GTQ K;  3NBP A;  2B63 A;  1ZS6 A;  4A3G C;  4QJV B;  2V63 A;  3BGO P;  2Y3Y A;  2K2P A;  3C19 A;  4WKR A;  2WVC A;  3IBC B;  4ZA1 A;  5BJR A;  4A8K A;  4F0H A;  1YK9 A;  4PWW A;  2EG2 A;  2K1R B;  3W7B A;  1NJY A;  3GTJ K;  2KB2 A;  1RHK B;  1SVD A;  1YTY A;  1UVN A;  4PXE A;  1U2C A;  2BKN A;  3LP1 B;  1EKS A;  3KLG A;  1ZET A;  4L74 A;  2H5I B;  4C8L A;  2EPI A;  4MQ9 A;  3JS9 A;  2V4J B;  3B6B A;  2FZG B;  3A8J A;  1ZTT A;  4USM A;  1AB8 A;  1EP4 A;  2E7X A;  2VG6 A;  3QWU A;  1PAU B;  2LLZ A;  5E3P A;  4MAK A;  1WQH A;  2BM0 A;  1ROF A;  4G6V B;  5A8K A;  2V94 A;  1RBO B;  3AQP A;  3O1L A;  4QWA A;  5F8H A;  2BQU A;  3ULH A;  2VQE F;  1RAE B;  5A8W A;  2X1F A;  1C4C A;  2RRN A;  3I55 S;  4AL7 A;  4MEY A;  4Y2A A;  1FRK A;  2YWK A;  1WC5 A;  3DDN A;  3ILO A;  1WOP A;  4HI2 A;  4X4U A;  2CPH A;  1RAB B;  2FLO A;  4G1Q B;  3CCE S;  2RB7 A;  4JI1 F;  3THP A;  1S9F A;  2F8E X;  1WF0 A;  1S1T B;  4PRF A;  2BDP A;  5HP1 A;  1FWK A;  4YHH J;  4EBC A;  3HFV A;  2BYC A;  2GV1 A;  2HK3 A;  2V8D A;  4PYA A;  2FJX A;  1K83 A;  4BXX K;  2C2Z B;  3V6D A;  2FHJ A;  4DCP B;  2W9C B;  2ILZ A;  8AT1 B;  1IBM J;  2GJF A;  3OT9 A;  5KG0 A;  4WKY A;  2B9E A;  2HHQ A;  1EP4 B;  1UEU A;  3FDS A;  3MR6 A;  2A6E A;  2KFN A;  2DTJ A;  1VQO S;  1S0O A;  1UVK A;  4RNN A;  3HT3 A;  4OLP A;  4DUY F;  4JI2 F;  2R7Q A;  2C2R A;  2H4W B;  2C28 A;  4ECV A;  1U1O A;  5B0B A;  1VQ4 S;  3QLH A;  2XCR B;  1VS3 A;  4WE1 B;  5LXR A;  1KN6 A;  2AIR B;  1U6F A;  1B4B A;  1U8S A;  4LF4 J;  4F0K A;  1PO6 A;  4ZDN A;  3TAQ A;  3MAA B;  3IR6 B;  4TY8 B;  2VFV A;  3GYN A;  1B99 A;  2ZE2 A;  1TU0 B;  2XHC A;  5HP1 B;  1EX8 A;  5DDQ C;  2HWH A;  4DF8 A;  3FEX B;  4ECZ A;  1TL1 B;  3PJX A;  2PT0 A;  3FKI K;  1TP7 A;  1TVR B;  3EJM A;  3HKW A;  2CNN B;  2LXF A;  4K2J A;  3LGM A;  4CH7 A;  4PG5 A;  1Z1Z A;  4HVZ A;  5KFD A;  4NOI A;  3D67 A;  4LF5 F;  5F9L A;  3A4T A;  1RUS A;  2KH9 A;  4YB7 A;  3CTR A;  4NZ7 A;  2AJ0 A;  3G4A A;  3ELH A;  2AZ3 A;  4Y2M A;  1N5Q A;  1Q81 T;  3J80 U;  1RBA A;  3CDW A;  4URS A;  4OIR A;  3M9O B;  4JP8 A;  1GMV A;  4ZP8 A;  1TK0 A;  3JQJ A;  1F7U A;  2BJE A;  2KWA A;  1ZM2 A;  1FTR A;  2W2M P;  3H20 A;  1CUL A;  3M8S A;  2RDI A;  3S1R C;  2VBW A;  3KJV B;  3CCV S;  5B0C A;  3OW2 R;  3R8Y A;  1CJU B;  2ZHA A;  4QR1 A;  2IM1 A;  5AXN A;  3G2X A;  2Z56 B;  1C0T B;  3U7J A;  2AWZ A;  2W8K A;  4JI7 F;  2KHD A;  4ETX A;  3RRG A;  2MB0 B;  1TZ0 A;  3OUY B;  3V5R A;  2B56 A;  1P6T A;  3DRY A;  9RUB A;  4C3I C;  4CO3 A;  3K7A C;  3P8B B;  1ZAV A;  4HTI A;  4K59 A;  1F9N A;  2IDL A;  1RTI A;  2YNH B;  2L9D A;  2VB6 A;  1F9H A;  2CJX B;  4YME A;  1G2E A;  2LU2 A;  4YDD B;  5D4L A;  1EQR A;  2CQ0 A;  3X3U A;  2MXY A;  4ELU A;  1OQ6 A;  4KO0 A;  3GTG A;  3Q2S C;  2NXJ A;  2B7B B;  4OZ3 A;  1XMB A;  4DLG A;  4C0B A;  4EO8 A;  5F3T A;  2NS1 B;  1QSY A;  5A6P A;  3FCV A;  3DLJ A;  2CRL A;  2NUH A;  3TI0 A;  1LXN A;  2GIR A;  3MMB B;  2MEW A;  3AJ2 A;  2BAB A;  2ZUA A;  1DCO A;  3MM8 B;  3J7A N;  1RT2 A;  1VBZ A;  1TKX B;  4J9P A;  2QE5 A;  1QY7 A;  4ZPC A;  3WIU A;  4X4V A;  2NCK L;  1GNK A;  1KQK A;  3U1M A;  1T94 A;  3TX8 A;  3GTL C;  4LBI A;  4DSF A;  3VV2 B;  4QU6 A;  2HLT A;  2JH3 A;  4M5J A;  4FF3 A;  1TKZ B;  4C11 A;  1PYT A;  3NGT A;  2H65 B;  1GEH A;  1SFO K;  4ID5 A;  3OR2 A;  3W5X A;  2GSU A;  2QT7 A;  2C2D A;  4LFB J;  3VGT A;  4QZV B;  4KAI A;  4B3O A;  1FJC A;  3CDB A;  1SKR A;  4I0W A;  1VRU B;  4TYA A;  1S97 A;  1Y5N B;  2ZOF A;  1A9N B;  3UD3 P;  4EO6 A;  1XK8 A;  3P45 B;  1S9G B;  3M2R A;  5A2Q U;  2XGP A;  2OLW A;  3MI7 X;  4P72 A;  2FVS A;  4ECS A;  2UVU A;  2A6O A;  3PO2 K;  3FNN A;  3M8W A;  4WP9 A;  2MZR A;  3GFH A;  5JVH Q;  3UR0 A;  2YNG A;  4HLB A;  1JJ4 A;  4DPO A;  5M3M K;  2UVV A;  4F3O A;  1VGY A;  2JA5 C;  3GYG A;  3CJQ A;  4WU2 A;  5J1E B;  1B7Y B;  2FYX A;  1RT5 A;  4A3F K;  1HYS A;  2HIY A;  2ZBR A;  2F65 A;  2ZC4 A;  1HQM A;  2MKH A;  2DNY A;  4ICL B;  4ZP6 A;  1SKS A;  4CH0 S;  4NLP A;  3HZE A;  1KC8 T;  4KB4 A;  4LBP A;  1K73 T;  4A48 A;  1O28 A;  2W7V A;  2JNJ A;  1H38 A;  8ATC B;  1UJ5 A;  3FSY A;  3I96 A;  4N41 A;  2CWX A;  4PXB A;  1FJ7 A;  4MIB A;  3DM2 B;  4ELT A;  1H2V Z;  5FDL A;  2R2U A;  3DRS A;  3GPA A;  1UEV A;  2DT9 A;  1SIZ A;  1UA1 A;  1F2G A;  3W9H A;  1FK9 A;  1GXU A;  3OSN A;  2BOP A;  3UDL A;  4M63 A;  3TEH B;  4K50 A;  2YXL A;  3HP6 A;  4RW7 B;  3MFH A;  2AZ1 A;  1IBA A;  4A3C C;  1WOO A;  3GTO K;  1HW9 A;  4M5D A;  4BS2 A;  3L4K A;  2E44 A;  2CZV C;  2DGW A;  4C0H A;  1VQY A;  2BW7 A;  3RR8 A;  4P74 A;  1HL6 A;  2DH7 A;  5J2M B;  4HT5 A;  1QVF R;  4TY8 A;  2IIH A;  1OMS A;  5A6W A;  5M2U A;  5EDW A;  3UNY A;  1OS5 A;  5IC6 B;  4EK2 A;  2MJN A;  3NAH A;  2RH6 A;  4P9S A;  4DQS A;  1R6V A;  2V8G A;  3LGH A;  1RBL A;  5C24 A;  3G8T A;  1UWB B;  1SQF A;  4YFX A;  3DDK A;  2QL9 B;  3DRS B;  2EFN A;  1ZM3 A;  1XZQ A;  3MMJ A;  1Q7Y T;  1SJ3 P;  3JTO A;  2WHO A;  1MML A;  2GZO A;  1LK5 A;  3W8G A;  4WPA A;  1XPP A;  5EX3 A;  2IM2 A;  3KJV A;  4KSE B;  2M3D A;  1TWF A;  1SJ4 P;  4BWJ A;  3UR3 C;  3BPD A;  4LFC F;  1N5S A;  2UXC J;  3CD6 S;  4DF4 A;  4U9R A;  4NI2 B;  4KYZ A;  4X4O A;  1QDU B;  4P5B A;  1RWN B;  4KAT A;  4DL0 C;  4DX6 A;  3RAQ A;  4KN4 A;  2DHG A;  4KC6 A;  3ITH B;  3F44 A;  1XER A;  4C8Z A;  1RTD A;  3GP9 A;  3FOE A;  3GTG C;  4DR6 J;  2KRB A;  2ALY B;  4LQ3 A;  2AU0 A;  4FZV A;  5ITH A;  4ANE A;  1HNW F;  3FKI C;  1IL2 A;  3AD7 C;  3CXC R;  1XNQ F;  2NXC A;  2FB0 A;  2RJZ A;  2EC0 A;  1VQ7 S;  5TMF A;  3ET6 A;  2WBR A;  2EFG A;  3MEC B;  4F7V A;  4FYV B;  3LQV A;  1KR4 A;  1XWL A;  3DOK A;  2FY1 A;  4PWD B;  2QLX A;  3ZZU A;  2RKI A;  1TWH K;  3J81 U;  3OHB A;  1FRX A;  1Y5I B;  2DCL A;  3D6H B;  1R9T K;  2ADC A;  2PA8 L;  1N6Q B;  1SBR A;  4JUZ A;  2E2H C;  4DPY A;  3IXQ A;  3I4N C;  4ILD A;  1IQ0 A;  2GAG C;  5AXL A;  4XDD A;  5HVG A;  1PJ6 A;  3RRK A;  1KVI A;  3BSO A;  3DDI A;  3QO9 A;  1TEL A;  1X4A A;  3TVK A;  5LOQ A;  2C2O B;  1SC6 A;  4FF1 A;  3UCU P;  4K5R A;  4W90 B;  2APO A;  3S1T A;  2GGP B;  3J81 j;  2P9E A;  3MMB A;  2FZC B;  4DQP A;  1SH2 A;  1YZ6 A;  4I68 A;  1Y1W K;  3M8Q A;  2K3I A;  1XC9 A;  3GTO C;  2C42 A;  1ZBS A;  1ZYQ A;  2L9N A;  1TK5 A;  2B7C B;  2XEX A;  1N36 J;  5EHH A;  3GDZ A;  3CO9 A;  2EFV A;  1N88 A;  2JDJ A;  4IDK B;  3GR0 A;  3JTN A;  2E2J C;  1JQW A;  3FZB A;  1SIW B;  3PW5 A;  3GFY A;  2UUC J;  3R97 A;  3TTG A;  3MWB A;  4R8U B;  3U1L A;  3DRR A;  1XEZ A;  7FDR A;  4GTL A;  3PZP A;  3LPY A;  3KG1 A;  1VRQ C;  5IOT A;  3J80 Y;  1ZZN A;  1WCM K;  3I5C A;  1IBM F;  3KK2 B;  1FXR A;  3BF4 A;  2ZOM A;  4ALZ A;  2ADB A;  4LR9 A;  3AA8 A;  5KFT A;  1SC3 B;  4A8Y A;  1JLC B;  1R89 A;  3PRV A;  3TYT A;  4OYA A;  2HLU A;  4LF8 J;  3QZ7 A;  1Q7L B;  2VFT A;  5L8R C;  2PMZ L;  3Q23 A;  3BGR B;  3S1M C;  1WDT A;  1S10 A;  4KQZ A;  3MPW A;  3WC0 A;  3EWG A;  3R1H A;  2BKP A;  2YTC A;  4J9N A;  2DEI A;  1NPP A;  5J2Q A;  1YX2 A;  2LVW A;  2YU9 K;  1XMQ F;  4O2D A;  2J9E A;  4PG6 A;  4O3N A;  3DKD A;  1YIT S;  2VDI A;  2D9O A;  2K7J A;  3I4P A;  1GMW D;  2B4P A;  1NO8 A;  2RIJ A;  4ILL A;  4KPC A;  1NK5 A;  1EK8 A;  4UUW A;  1TWC C;  2WW4 A;  2I38 A;  4LF5 J;  4EI2 A;  3OFE A;  4UW2 A;  3ZTS A;  1HPZ A;  3GTP C;  2NR0 A;  5IP9 C;  5KFU A;  4J9R A;  1DQ8 A;  2QA2 A;  4DCO B;  4K4X A;  1NJI T;  1N34 J;  3ONQ A;  2VL1 A;  4FZB A;  3CWJ A;  4DL3 A;  3GJR B;  1FJG F;  3WOD A;  3TZY A;  1F9F A;  4CCH A;  2BJ1 A;  1JVI A;  4DFJ A;  1RT7 A;  2FLP A;  2Q6B A;  3R9L A;  4JK1 A;  3GIR A;  5HK4 A;  2CJ9 A;  1SFO A;  4TN2 A;  4JOU A;  3CCJ S;  4LSL A;  1U49 A;  2D3O R;  4DL7 A;  2K06 A;  2PO4 A;  3PDN A;  2V2K A;  3MUT P;  4JI0 F;  3KFW X;  2QLJ B;  1NJW A;  1UW4 A;  4A3D K;  2D69 A;  2DHS A;  2R8H A;  1R9T C;  1NH8 A;  1YWX A;  3V6D B;  3KK1 A;  2HEK A;  3FKI A;  3MM9 A;  4DG1 A;  1FT8 A;  1HI8 A;  2GVD B;  4A3L C;  1WCM A;  2BE5 A;  4BLA A;  2QL5 B;  3I4M C;  2KHC A;  1D1U A;  2UXD J;  3JB9 k;  1MLA A;  2IMO A;  5HJY A;  2O5D A;  3CIZ A;  2XNQ A;  1BS2 A;  3C6U B;  4PCQ A;  4YR3 A;  2HKE A;  2N4C A;  2KM8 C;  2R7Z K;  4QCL A;  5DG8 A;  1O26 A;  4I69 A;  3ITH A;  3KJN B;  4X6A C;  2CDQ A;  5H9E K;  2J0Q D;  2AMC B;  3UPF A;  1R3N A;  3N0V A;  4WIQ A;  1WTB A;  2HRY A;  2CA9 A;  3CCU S;  3TRG A;  1IVZ A;  3GE9 A;  3MM7 B;  2IYI A;  1SPB P;  3H5U A;  1HMV B;  3W2W B;  3HHE A;  2AT1 B;  4OI4 A;  1HQU A;  2VG5 A;  5CD4 H;  3TAN A;  3DLE B;  2YKN B;  3L3C A;  2MQQ A;  2R2R A;  4JI7 J;  2LP4 A;  4F67 A;  1K1Q A;  3VAK A;  4GKJ J;  5HLF A;  4KFB A;  3HJV A;  1RKJ A;  4PR6 A;  1SJR A;  3FVY A;  2Q66 A;  1SKW A;  2E1M C;  5D77 A;  2CQG A;  2ASL A;  1KOO A;  1YJU A;  1R9T A;  3TJA A;  2FJE B;  1J27 A;  1NH7 A;  5C5J A;  1BWV A;  2W01 A;  3SZ2 A;  2CPF A;  4B9V A;  2PC6 A;  3WX4 A;  2VPY B;  4V1A k;  3CUN A;  2CJK A;  2GCF A;  3SMZ A;  4DN0 A;  5F3Z A;  3M30 B;  3T6B A;  1NHU A;  4J7C A;  2OH2 A;  2HFV A;  3RBX A;  3QGI A;  4ZH4 A;  2OPR B;  2LU1 A;  2YU9 C;  1R8C A;  4RPF A;  3P3D A;  4NYZ A;  3EVM A;  3GTM K;  3BSN A;  3D0H E;  2ZZN A;  4CRJ A;  4ZK7 M;  4BHQ A;  1XZP A;  5ETO A;  4ZCK A;  2VPW B;  5HRO A;  1LQ9 A;  2O3D A;  4NLR A;  4ZIV A;  1O29 A;  1F7V A;  2C3O A;  3VAH A;  3TZW A;  1IJF B;  4A3J C;  1O6X A;  1WAC A;  4IQX A;  1MN9 A;  1WSR A;  4QOT A;  1BDF A;  5DG7 A;  4DV1 F;  4Y2C A;  4GTD A;  2E1A A;  3THT A;  5E68 A;  4GT9 A;  1N0U A;  1U1Q A;  1NZA A;  2BMB A;  4WFZ A;  1S99 A;  3HJF A;  4N47 A;  3BSC A;  4J9K A;  3HO1 A;  4FYD A;  2ASJ A;  2LKZ A;  4LR7 A;  3DYA A;  1X4C A;  3S1R K;  3CAG A;  2Z58 B;  2WK4 A;  2LQ5 A;  1QUV A;  1S6O A;  4FF2 A;  1T3O A;  4ZKA A;  3DRR B;  1X8D A;  1KFS A;  3QIP B;  1CC7 A;  2B51 A;  1QSS A;  4WJB A;  3D3B J;  2ZWO A;  4P2X A;  1T9V A;  3KG4 A;  4IQM A;  4ERD A;  1IKV A;  3D6M B;  2QYG A;  2N82 B;  5CA5 A;  4RX6 A;  1UVJ A;  4YB5 A;  3MEE B;  3MZI A;  4A3L K;  3H98 A;  1RAC B;  1X9M A;  2R7U A;  1OPZ A;  1WHX A;  1WC0 A;  3OXF A;  3OLB A;  1EHW A;  3FK4 A;  2IC3 B;  3QGH A;  3CCW A;  1LFW A;  5C3E C;  2B63 K;  2J5A A;  1FKP B;  2DRB A;  3PAC A;  3FRY A;  2R92 A;  4KHP F;  3Q8P B;  3KUH A;  3PIO Q;  1WHY A;  5GMK a;  2RS2 A;  4GKK J;  3G82 B;  2ATL A;  3J7Y I;  1XXB A;  2DNN A;  4EYI B;  2FTR A;  4Y2K A;  2R7R A;  2CQI A;  4M8L A;  4TNO A;  2JA7 C;  3QO9 B;  1EB0 A;  4WP3 A;  3SSR A;  3UE2 A;  1FRJ A;  4OYW A;  3QQC D;  1XTZ A;  1Q8K A;  3S15 C;  2CDR B;  4W4M A;  2M8D B;  2V9K A;  2HAI A;  2LCW A;  3H40 A;  3S17 K;  1WOS A;  3EGW B;  4CDI A;  5AT1 B;  1RK8 A;  4ILM A;  5A0Y B;  1M5H A;  2HGL A;  4IFY B;  3TUJ C;  2UV8 A;  4ZCL A;  1Q86 T;  1F60 B;  1I51 B;  4I2Q A;  3HZG A;  2E9T A;  1J2V A;  4FBT A;  1X5S A;  5F8N A;  1EI6 A;  1WC4 A;  3LP1 A;  1T0T V;  2J7K A;  1V5V A;  1EZZ B;  9ATC B;  4NL5 A;  2LQB A;  2B43 A;  4KBI A;  5IP7 K;  3LP0 A;  3LUY A;  1Y5L B;  3T1H F;  5HSP A;  1QLN A;  3ENW A;  4IH7 A;  2GGP A;  2DNQ A;  4CTA B;  1ZPV A;  2UVW A;  3ILI A;  4X4N A;  1WJ9 A;  3D6T B;  3A3O B;  3BGU A;  5DDO C;  2WTF A;  4OIP A;  2RHQ B;  2ILY A;  4DPW A;  3T5J A;  3Q83 A;  3EUN A;  5HQM A;  4RW9 B;  4QWB A;  4AND A;  3CIM A;  3J7A 1;  1O2A A;  3FHZ A;  1CJK B;  1I6J A;  5JVO A;  3R5A A;  2YU9 A;  2WSE C;  3IBF B;  5JVG Q;  3F0N A;  2A69 A;  1NEE A;  4NEY A;  1YRX A;  3B4M A;  4MIA A;  1UFK A;  2XMW A;  4TYB A;  2KM8 B;  1Q1K A;  2PE8 A;  5B0E A;  2E5G A;  2H9Z A;  4KM9 A;  4V19 J;  1X5O A;  3IPJ A;  3HSG A;  1S1W A;  1AZS B;  1WI6 A;  3C6U A;  2CNO B;  2DIS A;  1N32 J;  2ZD1 B;  3LA0 A;  3M32 A;  1UZH A;  1WI8 A;  3L9Z A;  3OTO F;  4AYB L;  2RQ4 A;  3U02 A;  3DLE A;  2UVR A;  4EMD A;  3CQZ A;  4A8Q A;  1FNO A;  4DPT A;  2XNR A;  4WFB Q;  2AQ4 A;  1CJV A;  3IC1 A;  4WXW A;  4PXD A;  5GME A;  5ETR A;  1I94 J;  3EE3 A;  1U2F A;  4EFA C;  4BC7 A;  2YNI B;  4V19 X;  4DR5 J;  4JI5 J;  3K5P A;  4R5P A;  3ZZO A;  3H2V E;  2UP1 A;  5KOX A;  4OX7 A;  1BWE A;  4ED5 A;  1FCA A;  1V9O A;  1DLO A;  4PPZ A;  1O24 A;  4C45 A;  4IRD A;  1X9W A;  2ZH5 A;  2WON B;  3MM6 A;  1BHN A;  2HPU A;  5HVH A;  3I5A A;  4MIW A;  4BLB A;  2NVX K;  1AZS A;  1V3S A;  2RH3 A;  1KEK A;  4NAS A;  1RTJ B;  3EDQ B;  3W64 A;  4CT9 A;  4UTG A;  2LQ8 A;  3I0R B;  4OZ0 A;  5A8R B;  1R6Y A;  5JFE A;  2V6A A;  1JXL A;  2HFS A;  4NCG B;  3AB4 B;  3HHL C;  2KT3 A;  4ED8 A;  5DLG A;  4ZCI A;  4MFB A;  3DLH A;  4DX7 A;  4NZ6 A;  1XNR F;  3MAQ A;  2HFU A;  3FBE A;  2AX0 A;  2ZH8 A;  2R2T A;  1RYS A;  1FA0 A;  5LSO A;  3RZO K;  3SI8 A;  2XLJ A;  2BV3 A;  4DV3 J;  5I3Q A;  1I5O B;  2D3Z A;  3BBC A;  1PCA A;  3PJW A;  4WK1 A;  3FMW A;  4CNY A;  2PA3 A;  1TWH C;  5I3P A;  4LFA F;  3GYX B;  3TJ8 A;  1B4A A;  1QUP A;  2QV6 A;  3CMA S;  2Y8W A;  3GTO A;  2OD6 A;  3PFO A;  3RU0 A;  2X7I A;  1YLX A;  1UVM A;  3OXG A;  2O67 A;  1Q53 A;  3MEG B;  1QTN B;  3KMQ A;  2PFF B;  1DUR A;  2KXH A;  4Y52 K;  3KNA A;  1GX5 A;  3K5N A;  2ZKU A;  1S59 A;  3N01 A;  4EBE A;  3B4D A;  2IM0 A;  1REV B;  4ILR A;  2W7A A;  4LF7 J;  1UV7 A;  5HQL A;  1T9X A;  2OFH X;  1RWU A;  3C8Y A;  2V2Q A;  2YKQ A;  4B3S F;  2E5L F;  4ZIW A;  1VBY A;  1NU4 A;  3IMQ J;  1IM4 A;  2FGO A;  4H4O B;  3IAS 9;  1Z4U A;  1NSA A;  3PV8 A;  4IRC A;  3GZ7 A;  2D3U A;  2JA8 C;  3HOY C;  2MLY A;  1Q16 B;  4L3N A;  1RA6 A;  1O2B A;  3R7S B;  1T95 A;  3EX7 B;  2DHA A;  4LSN A;  3MDF A;  1T8E A;  4KRW A;  4ZPW R;  2ZZM A;  4P75 A;  3NGU A;  2WVE A;  4KC5 A;  3LOU A;  1VJQ A;  1IBK F;  4IG3 B;  2VQE J;  2A2C A;  3WX8 A;  3BKU A;  4Q5V A;  3K89 A;  3OL6 A;  4DV0 F;  4F3M A;  1R0C B;  3BGR A;  5G4D A;  1TFY A;  2HRU A;  2YKP A;  2P9G A;  1KBR A;  2WW8 A;  2F3J A;  5IM0 B;  2CPD A;  2MKK A;  2F9D A;  2HUR A;  4QIF A;  2QLB B;  1Y3K A;  3L7P A;  2BQR A;  1V6H A;  2FQT A;  3TVZ A;  4DR3 J;  1XR5 A;  3NP5 A;  1DZ5 A;  1NDP A;  3LAP A;  4OYM A;  1ZXO A;  3MR7 A;  3SSQ A;  4FS1 A;  3SFG A;  3W60 A;  4L75 A;  4PG8 A;  5GAH I;  2IVF B;  3MUR P;  2WAQ D;  3GJT B;  4H4M A;  5CYM B;  2CPE A;  2Y3P A;  3PYG A;  1HI1 A;  5J1P A;  1AXQ A;  2ZJR Q;  4OX6 A;  4BBR C;  2GS8 A;  3NLC A;  3NMR A;  5J2M A;  1N5T A;  2ZBQ A;  4F8R A;  1YJW S;  2XY5 A;  5DET A;  3CJ8 A;  1OY9 A;  2J6U A;  5FJ8 K;  2DNO A;  3PW0 A;  3BEG B;  4NPO A;  4Y0F A;  5T14 A;  2A68 A;  2HVD A;  3JQK A;  3UDC A;  3IGV A;  3DRP A;  1NAQ A;  3CJ2 A;  4N5S A;  1RT7 B;  5ETM A;  4ES2 A;  1FDA A;  4J9M A;  4B3R F;  2Q43 A;  2XMU A;  2Z2L A;  2N4D A;  3QPI A;  4OLO A;  3T1Y F;  3CMQ A;  4ES1 A;  4CLF A;  4ZVO B;  2EFP A;  3V6J A;  1ZAW A;  3D28 A;  3POT A;  2EBB A;  2VOD A;  4NXN J;  2HYI B;  1JKH A;  2F7V A;  3CQZ K;  3EMT A;  3GTJ A;  3OL7 A;  1T03 A;  3MR3 A;  1FWP A;  1R8H A;  1PIE A;  3LP2 B;  2GSN A;  1USM A;  5C25 A;  1RHM B;  4NI2 A;  4MK9 A;  5DGB A;  4JYA J;  2M70 A;  1DJ0 A;  2EK6 A;  1B70 B;  4RWW A;  2QX0 A;  4G1Q A;  3BDP A;  3UFC X;  1NKB A;  3Q8V A;  3JSR A;  3QRP A;  1X4B A;  1JIH A;  2C3P A;  1YBT A;  1X4D A;  3HM9 A;  5KAK A;  4ANC A;  4Q2L A;  3LP2 A;  4CLK A;  4JV0 A;  1UVI A;  2CFX A;  3N9U C;  2MKI A;  3P5T L;  5KFA A;  3M32 B;  4K4Z A;  2RQM A;  3QX3 A;  2XGQ A;  4DSL A;  2JFK A;  1E6V A;  2HHV A;  3BDE A;  3O44 A;  3THV A;  1FXD A;  4LF6 F;  3W9I A;  4KDD A;  2C3M A;  1O5J A;  1CS4 A;  2XMV A;  2PMW A;  2V2Z A;  1Y1W C;  2G1D A;  3N6M A;  1OWX A;  4G0W A;  2D41 A;  2WB1 D;  2FJW A;  2F1F A;  1HWL A;  4OZJ A;  2KKH A;  1HBO B;  4NML A;  1HI0 P;  1S5Z A;  1Z2L A;  4WBF A;  3EZ5 A;  1F6T A;  2VUM K;  2C2M B;  3T1A A;  3A3P B;  1CS4 B;  2DNL A;  3BO2 A;  3R2D J;  4KFB B;  4QYZ K;  2Z2Y B;  1JXE A;  4LF2 A;  3X1L B;  1FKA F;  3J81 Y;  2ZJQ Q;  2QO3 A;  4CYU A;  4A3B C;  2MST A;  1TL3 B;  1E6Y A;  1UWA A;  1Q8L A;  3H5S A;  4WK3 A;  1M1K T;  1OYD A;  5IV3 A;  5DQI A;  4CLP A;  3CJ5 A;  1RLC L;  1HBU A;  2NVQ C;  4YY3 J;  3CME S;  3QYY A;  2QL7 B;  1JLE A;  3M8Q B;  1LW2 A;  1KD1 T;  5AE3 A;  2BJ3 A;  2C3U A;  2N3L A;  3IS9 B;  2XI2 A;  1VR6 A;  4KMH A;  2K1R A;  3LWM A;  4WZM A;  2A2D A;  4X4P A;  5JUM A;  4X65 J;  2D6F C;  3EPG A;  1HWI A;  4FKY A;  2LEP A;  3ZO7 A;  4DV2 F;  1FNM A;  1CQM A;  4Z37 A;  4ED6 A;  3GSI A;  3PM9 A;  2V6U A;  4RNH A;  4Q0B B;  2GX8 A;  5DM7 Q;  4FDF A;  5M5Y K;  3K0J A;  2E5H A;  5IV4 A;  4YP3 A;  1I6V A;  4BY1 C;  1VQK S;  1WKL A;  2GHV C;  3I0S B;  3W63 A;  3V81 B;  1LWC A;  2B5J A;  2CAD A;  3PYE A;  2CJQ A;  4UUX A;  4ZCM A;  5ETK A;  2GA7 A;  3UO0 A;  2RDJ A;  3C14 A;  1K83 K;  1BD6 A;  1VLY A;  3DLK A;  1NRK A;  3M6U A;  5KG5 A;  1HWJ A;  2HFZ A;  1S0N A;  2UUB F;  1WKJ A;  3T5K A;  3JSY A;  3CF5 Q;  1RTJ A;  4YR2 A;  3CQZ C;  1SV5 A;  3MOJ B;  2J0S D;  2NVT K;  4OV6 A;  2AYB A;  2VF3 A;  3DOM A;  2CIM A;  1Y9O A;  1XNQ J;  1YNN A;  3RUB L;  3M6V A;  4A8W A;  4PUO B;  3VAL A;  4Y3C A;  2H3E B;  2MKS A;  2XC9 A;  3JSM A;  3I4N K;  4HAC B;  2N3O A;  3V4I B;  1UA0 A;  2AYG A;  2UU9 F;  4RU9 A;  5IQQ A;  1GX6 A;  3MTK A;  5LXY A;  4QYZ J;  2MQP A;  1PJ5 A;  2AYM A;  2OEK A;  5I4M A;  2IYG A;  3TFI A;  2M5Y A;  2R9L A;  3WHI A;  3MM7 A;  2AHO B;  3TQ1 A;  3G6V A;  2MY8 A;  4DV6 F;  1RYR A;  4C3M A;  2HVI A;  3R5J B;  4USJ C;  1XZQ B;  3FOF A;  1ZPW X;  1I50 C;  4CI0 B;  3BGF A;  3TA1 A;  1QE1 B;  4C7Q A;  1X0P A;  3HD2 A;  3TR5 A;  2NZ4 A;  1T05 B;  2R7S A;  3U1N A;  1FF2 A;  4F3Q A;  3B78 A;  3DRP B;  3HX9 A;  2RDD A;  4JV5 J;  2AD9 A;  2WZ1 A;  1IR2 A;  1F3V A;  4D3H A;  3Q89 A;  3MEG A;  3ENV A;  3OJU A;  2OTJ S;  4I6Y A;  1MWZ A;  4A3B K;  3ZZP A;  3CJK B;  2KXN B;  1F93 A;  3N0C A;  5GVQ A;  4NCB A;  4LOW A;  1T9T A;  1H98 A;  4X4Q A;  3KK1 B;  4ZVT B;  4XDC A;  1VCT A;  1RT4 B;  1N52 B;  2NYH A;  4C2M A;  3RBD A;  2VG7 B;  3PKY A;  4HKQ A;  1WCM C;  2EBG A;  5DLF A;  4ID8 A;  3GV7 B;  2XYP B;  4K0K F;  3T1Y J;  4GZY A;  2BW2 A;  2YWW A;  1F1B B;  1RA7 A;  2RGR A;  3PVX A;  2IY5 B;  5G0R A;  1FDD A;  2PHC B;  4KY3 A;  2NUU G;  1A0O B;  5KG2 A;  1T03 B;  5JMN A;  3Q86 A;  4J37 A;  5KFE A;  4WFN Q;  2W8L A;  2XCP A;  1ELO A;  3K8V A;  4ITS A;  1T02 A;  2XZT B;  3OTE A;  4KPY A;  4HHJ A;  2V67 A;  1Y7P A;  3E2E A;  4HYK A;  3D1H A;  4OZL A;  4F4Y A;  1VBX A;  4GRS A;  4DMZ A;  2JA7 K;  4ENO A;  1I3Q A;  3DMJ B;  1VIO A;  2VBX A;  1H7X A;  2FHJ D;  3FFI B;  1FXL A;  1V3Z A;  2HGM A;  3W1Y C;  1ZBT A;  2F8M A;  4RKU C;  2CXE A;  2MZS A;  3M3Y C;  2W2Q P;  2MZJ A;  1H3D A;  3S16 C;  4KMU A;  1MU2 B;  3R5G A;  5A2Q Y;  1CJK A;  4LIW A;  3R6G B;  4IOC Q;  3MPY A;  2L41 A;  1B0P A;  3VAM A;  2UXC F;  2C2K B;  4AL6 A;  3DOL A;  3M30 A;  2BVZ A;  1R43 A;  3W66 A;  3MEK A;  2RF2 B;  3VQS A;  1YQH A;  2D3O 1;  4X66 F;  3CD5 A;  1CBK A;  2E2H K;  1PBU A;  1EH1 A;  1U1R A;  4ZHR B;  1VDH A;  4YS2 A;  3KXD A;  1XIQ A;  5J1E A;  3GG1 A;  2GW8 A;  2E2I A;  2F4F A;  2CQC A;  2ZKT A;  5IQ6 A;  3EXY A;  5L46 A;  2RNE A;  4BLG A;  3DU5 A;  2YQ0 A;  1LWE A;  2HQD A;  3SV4 A;  3F41 A;  4DSJ A;  2DB1 A;  3PX0 A;  2HBZ B;  3AD8 C;  4RW4 A;  1UPP A;  3ZFV A;  4CYU B;  2HW3 A;  5KFL A;  4ZVH A;  1M5O C;  2VIC A;  3TNV A;  3EXC X;  3ZNJ 1;  2XY6 A;  5KT3 A;  2UUW A;  1IM6 A;  4RUA A;  1H73 A;  4WYL A;  5AE2 A;  4DUZ F;  2R7O A;  1KHV A;  1QVG R;  2OEM A;  3H5Y A;  4KH0 B;  1FRH A;  2DNM A;  4C9D A;  5T7L A;  2YPY A;  2EEY A;  1C1B B;  3ZZR A;  3D54 A;  1O0P A;  4GO7 X;  3L09 A;  2ZJP Q;  2IVM A;  5FII A;  2FVP A;  4I67 A;  3K7A K;  3GSD A;  1WG1 A;  6AT1 B;  2QMW A;  2VC0 A;  2M7S A;  4ZPA A;  3I0R A;  1NDL A;  1FX4 A;  4Y65 A;  3MF5 A;  2NVX C;  1VIS A;  4LSZ B;  5L1K A;  3JSB A;  3PO5 A;  5KFX A;  1S1T A;  4NEZ A;  3PX4 A;  1IBC B;  3HF5 A;  2DGS A;  2EC2 A;  2HNY A;  3R5B A;  1Y3J A;  4OJ3 A;  1LWC B;  2XYG B;  3HVR A;  1WD6 A;  2P5V A;  5KFR A;  2VD3 A;  3H4B A;  3MMC A;  2JWN A;  1N5Y A;  2WBM A;  3H0G A;  4A3M C;  1C0U A;  2XUL A;  1UJ6 A;  2E2I C;  4IG0 B;  1UL3 A;  5SZT A;  2G9O A;  4DX8 H;  4CTA A;  2DH9 A;  1RWP B;  1SL0 A;  1VIX A;  2MHE A;  3C2P A;  3I5B A;  1UWB A;  1HQE A;  1RWV B;  3SXL A;  3MMC B;  1HNI B;  3KLF B;  2H5J B;  4GTE A;  4DSI A;  1RT3 A;  4YQW A;  3HHD A;  4DI6 A;  4F25 A;  5E3Q A;  4ECQ A;  3KHG A;  1UP1 A;  3MMA B;  3LWL A;  2FHK A;  3ET6 B;  2GIF A;  3NUH A;  2PEB A;  4ZP9 A;  4CQ1 A;  4B3M F;  5KT6 A;  3M2V A;  4Y34 A;  2RU9 A;  2RSQ A;  2GVZ A;  4LQ9 A;  1KRP A;  5KG7 A;  2L48 A;  3SQG A;  3EVO A;  4Q44 A;  3PKM A;  3RJM B;  2BBE A;  1T9U A;  1N6Q A;  4C3H C;  3DRX A;  3GTG K;  4ZPB A;  3SEO A;  2CJB A;  4B3R J;  2GIQ A;  3FJ2 A;  5L1L A;  2FLN A;  1X60 A;  5M3F K;  1TAQ A;  1YZ7 A;  3CJ4 A;  1REV A;  3I31 A;  3RAM A;  3TAM A;  2GMH A;  2V34 A;  4AT1 B;  4QIW D;  3QID A;  2VDH A;  4N8N A;  1USO A;  2XZW A;  3H0G C;  2WCX A;  1A7G E;  4H4O A;  2ZH9 A;  3CCS S;  1LKZ A;  4HT7 A;  4LRB A;  3HOY K;  3HMJ G;  4GFQ A;  1BQM B;  2BJ7 A;  2QYC A;  2P5M A;  4YOE A;  3V6K A;  1CJU A;  3GEH A;  1NJZ A;  5D8H B;  4DCJ B;  5KFK A;  2EXU A;  3MFI A;  1TWH A;  2DR9 A;  3I6P A;  3HVT A;  4W98 A;  2RIL A;  3UVJ A;  3UCZ P;  1OJ4 A;  2V2V A;  3GIK A;  1GT8 A;  4K4Y A;  3GJQ B;  5DDP C;  5KFI A;  4AD6 A;  4UOH A;  2QFJ A;  3ZTO A;  4ICL A;  4QYR A;  5M5X K;  2IM3 A;  5IZH A;  2OI2 A;  2XMJ A;  4O44 B;  4DQI A;  4B17 A;  3KOA A;  2VG6 B;  4LF8 F;  4RW8 A;  3IWX A;  1JLA A;  4AXI A;  5B7W A;  2J0W A;  3P6Y C;  1I3Q C;  2DNH A;  1WG4 A;  2R93 C;  2QRR A;  3TZZ A;  4EYH B;  1D8Z A;  4NCG A;  4CO1 A;  1JMT A;  4OHV A;  2W2P P;  1VQ9 S;  1NK7 A;  1I94 F;  3HOZ K;  1MWY A;  1PKU A;  2M9K A;  5F0W A;  3EGZ A;  2CQP A;  3RBE A;  3TZX A;  2BRK A;  2CQ3 A;  4DUT A;  1X31 C;  5K20 B;  4LJM A;  5CAB A;  1C2P A;  1GE9 A;  4M1X A;  4LQY A;  5K5M A;  3S17 C;  3GTM A;  1HBM B;  2VH7 A;  3IRX A;  3S14 K;  1ZTW A;  4F2S A;  3TP2 A;  5H9F K;  1EJ7 L;  2RAQ A;  5DG9 A;  2XMM A;  3Q8Y A;  3IM9 A;  3VHQ A;  4OFZ A;  3D3C J;  3AY0 A;  3FFI A;  4OX9 F;  3W5Z A;  1EET B;  1SJQ A;  2DNG A;  4KB7 A;  5IT4 A;  4B9T A;  5KFZ A;  2KU7 A;  2FJA B;  3W5Y A;  1VQ8 S;  5KT5 A;  1FI4 A;  2MQ8 A;  5L39 A;  1YHQ S;  2OFG X;  1X4E A;  1AT1 B;  1TWA K;  3C3L A;  1O25 A;  1W25 A;  1Y0H A;  1DAX A;  3CSK A;  3MM5 A;  5IS2 A;  3NGD A;  3JSM B;  1NUE A;  1WIH A;  1XR7 A;  1M5P C;  4A93 K;  2CKW A;  1HMV A;  5I42 B;  1QD1 A;  4ATN A;  1RB0 A;  2RVJ A;  4USK A;  2MZ1 A;  5CXT A;  2DEJ A;  1WC1 A;  3DXB A;  3R3T A;  4OQJ A;  2HHH F;  1YDL A;  4MKV A;  3GR1 A;  2MYF A;  4NWB A;  3SFU A;  4I1T A;  4HEA 9;  4JI8 F;  3MM5 B;  2DYA A;  4DV0 J;  1RAG B;  1FJE B;  3GIM A;  5D4N A;  1G7C B;  4WP8 A;  4ECR A;  3F56 A;  4DFK A;  4LFA J;  4QIW L;  5D4P A;  4Y7N C;  4X4S A;  2UUA F;  1GTH A;  2ZVI A;  2MHN A;  3M1V B;  4NRT A;  3CJR A;  2B4U A;  2FC8 A;  1DY3 A;  2BA9 A;  5CZV A;  5KFQ A;  5DQH A;  5AJ3 J;  2R7X A;  4CLZ A;  3M8P A;  2DR7 A;  3L4J A;  1EKR A;  4HL9 A;  1S1W B;  4U67 Q;  1RU2 A;  3S16 K;  1AA1 B;  1B0V A;  4WXO A;  4DR4 J;  2A3J A;  3KK3 B;  4UZC A;  1Z2Z A;  4NLS A;  4QJV A;  1T9W A;  4GMK A;  3A8E A;  3H0G K;  3BPS P;  4ZMM A;  2JLG A;  4KR0 B;  2ZM6 F;  1QAX A;  4KKO B;  4RUH A;  1SUQ B;  2DXD A;  1LW0 B;  2VFU A;  4ED7 A;  3CC7 S;  1VJE A;  5EGE A;  4K4T A;  3V6H A;  1NZ8 A;  3NOG A;  3MXH P;  5J1N A;  5EWE A;  1WF2 A;  4ZPV R;  2AGO A;  3S2H C;  3NCP A;  3Q24 A;  3R5D A;  3MM9 B;  2E1P A;  2H54 B;  5C42 A;  1F5B A;  2Y8Y A;  3KHR A;  2MJU A;  2MLZ A;  1H2T Z;  2H5E A;  3NNC A;  2R7Z C;  2B63 C;  2ERR A;  4DV6 J;  2CG8 A;  4A8X A;  4WJ4 A;  4N8O A;  2VAS A;  1P9Y A;  4X6A K;  5IXU A;  2FHO B;  1Y00 A;  4RL1 A;  3NL0 A;  3FBC A;  1C0A A;  1NHV A;  2W9B B;  4CLU A;  5K8P A;  1PIL A;  2VOP A;  2IAJ B;  1S6Q B;  4DV7 J;  5DDR C;  1ITP A;  3AH5 A;  3PW2 A;  1U1M A;  2GJI A;  3OEP A;  4U6P A;  1K9M T;  3PG9 A;  2KXF A;  1NDC A;  4K4U A;  2OIH A;  1JLQ A;  1WTF A;  4W92 B;  1AW0 A;  2R93 A;  1XJW B;  4DV3 F;  2YKN A;  5D0H A;  4MYU A;  1S9E B;  1Q8I A;  1RZM A;  4A8O A;  4O0N A;  4I4B A;  2HZA A;  3CCM S;  3GTK K;  1VHI A;  2XI3 A;  2KTQ A;  3ENA A;  3S1Q C;  4ECU A;  3EPI A;  3ILL A;  3A3N B;  1RU1 A;  3R7B B;  3G87 A;  5IYD K;  4FYY B;  1X4H A;  2CUY A;  1K1S A;  3G71 S;  3V4I A;  3RZD K;  1IUJ A;  1RAO A;  3CE8 A;  1S49 A;  1X4F A;  3DOM B;  2KJV A;  1KS2 A;  3FUY A;  2B9X A;  2GHP A;  4H4K C;  4AFF A;  2V8P A;  2AJ4 A;  4I56 A;  2AP6 A;  1N56 A;  2KG0 A;  4EBD A;  1FFG B;  1NPR A;  2PN6 A;  4LF7 F;  2Y1L B;  4TVA B;  5A0Y A;  3DYA B;  3MAA A;  4K4S A;  5H9F J;  1TWC K;  3VAF A;  1HR0 F;  3MTJ A;  4ZLN A;  4MKB A;  4RR5 A;  8RUC A;  4NLU A;  3PO2 C;  3QT7 A;  1UET A;  1KOH A;  5LT5 A;  3OTB A;  3K59 A;  1HNZ F;  2ZWP A;  3GEE A;  4OJG A;  4MJK A;  1IWA A;  3BH7 B;  5K8O A;  4NLQ A;  2DY9 A;  1IKV B;  4K8R A;  1SL1 A;  2BJ9 A;  4FYW B;  4CIO A;  1VC5 A;  2VU5 A;  1VYA A;  2HHP A;  1S0M A;  2ZH4 A;  5GAG U;  2VUM C;  4F4A A;  1DHM A;  4OZ5 A;  2XSF A;  5IP9 K;  1A6L A;  3E01 B;  4ZVF A;  4DR1 F;  1U1P A;  4J9O A;  3AJ1 A;  5GAD I;  4J9V A;  2BJD A;  2Z57 B;  4ED0 A;  3M4X A;  1U8W A;  1IQZ A;  2F63 A;  2OD4 A;  2A0F B;  3QMQ A;  1ZA1 B;  5F8I A;  1OSD A;  4RO0 A;  5HBM B;  4GC6 A;  3G82 A;  4KV8 B;  3FEY B;  5B0G A;  5KT4 A;  2RUG A;  2CPI A;  2Q6C A;  4C8N A;  1OY8 A;  5CYM A;  4PWD A;  1NDK A;  4FN5 A;  3S8S A;  3ISN C;  1Y11 A;  2E66 A;  4YDX A;  1U1N A;  3QBC A;  2P8I A;  2V0N A;  2F40 A;  2H4Y B;  1F0X A;  5HMX A;  2HK2 A;  4WJ3 M;  3KHL A;  2KJW A;  3GON A;  1BQM A;  4IG3 A;  3KDN A;  4C8Y A;  2I5J B;  2ZNZ A;  4LVO P;  3EYZ A;  4UQG A;  1LWF B;  1RXO B;  1OO0 B;  1I3Q K;  4NRU A;  3FZ2 A;  2ZHO A;  1FVS A;  2W7O A;  4TQR A;  3HXA A;  4Y00 A;  4ED2 A;  3GV8 B;  2R8G A;  2XSJ B;  3OV7 A;  1IW7 A;  4F36 A;  4C8O A;  4LF1 A;  2CQH A;  3W62 A;  4HR2 A;  3ADA C;  1N8R T;  1URR A;  2L3M A;  1MU2 A;  3DCA A;  4G0V A;  1SV5 B;  1MRO A;  1Y1V K;  1UMJ A;  1YJN S;  2WVD A;  1IE0 A;  4M94 A;  4MMO A;  2MKY A;  3KLE A;  1YCL A;  3CJS A;  5DZ7 A;  4X62 J;  2V4J A;  3ZXW A;  4ETZ A;  4JI6 J;  4GO5 X;  2O5J A;  2PPB A;  4ZS6 A;  2DD8 S;  3AXK A;  1N54 B;  4TXS A;  4DR2 J;  3DOL B;  1U6B A;  3BN4 A;  3RG6 A;  5KFV A;  2HZV A;  2OO4 A;  4I64 A;  4IRK A;  1VQS A;  2LEA A;  3CCZ A;  4C48 A;  4M5H A;  4BWM A;  3T19 A;  4IH6 A;  1FVQ A;  3H90 A;  4G3I A;  4GC7 A;  1U0H B;  2CFA B;  5IYB C;  5KG3 A;  2ACM A;  1RAA B;  4FBU A;  1NPK A;  4M5K A;  4M5N A;  1C4A A;  5B08 A;  4ID5 B;  4JI8 J;  3CED A;  2OSQ A;  4TU7 A;  4FYX B;  4Q45 A;  2I2Y A;  1XXC A;  1FKO A;  2J7W A;  5C2G A;  3QJJ A;  4QQB A;  2G0J A;  3D6F B;  3H5X A;  1U2R A;  2FHM A;  3M2U B;  4A3I K;  1TWF C;  1TL4 A;  2HMI B;  1RWM B;  2EFO A;  2RML A;  4ED4 A;  3CC4 S;  3QJL A;  4L3K A;  4XLP A;  2HRT A;  2FIU A;  3EIC A;  2XYH B;  1LK7 A;  1RQ0 A;  5T7L B;  4NE9 C;  3VAG A;  2XB2 D;  2MY7 A;  3M2U A;  3T6J A;  5FD1 A;  3TUP A;  2AEM A;  2HFN A;  2I0X A;  2VG7 A;  2ZIT A;  3N4W A;  4KAS A;  1HD1 A;  3MCN A;  2XWY A;  5GAD U;  2CG4 A;  2XMT A;  4FNH A;  2HHU A;  4P2S A;  4QR2 A;  3GLJ A;  2DNZ A;  3KLH B;  1S79 A;  1N34 F;  3VR1 A;  1EET A;  2HGN A;  4OHY A;  2DCU B;  3NXZ A;  2J9D A;  3K5M A;  4DZ6 A;  1SC1 B;  2Y1I A;  3AT1 B;  2HQC A;  3SV3 A;  1TWG A;  2JEF A;  5D0E A;  2YWE A;  5IWA J;  3CC2 S;  2W1B A;  2QFI A;  1R7I A;  4DXL A;  1PYO B;  4P52 A;  3HOW K;  4NA3 A;  2EFQ A;  2ZH3 A;  1UW9 A;  1B0T A;  3T5H A;  3QIP A;  4YN3 B;  2JEI A;  2G0I A;  2ROG A;  1QE1 A;  3T9N A;  1N33 J;  4CO0 A;  2DGX A;  3EDR B;  5ADZ A;  3M2V B;  3ZZT A;  3FEZ A;  3NAI A;  3JTP A;  1M5V C;  4LR8 A;  2BM1 A;  3R6L B;  4FVC A;  4CM2 A;  4Q8F A;  1F9E B;  4M5I A;  2ASD A;  2FVR A;  3GB0 A;  1JLB B;  2B5J B;  3OQ2 A;  4PXC A;  3W61 A;  2JJ4 D;  2R7T A;  4EUV A;  1IBL F;  4JI6 F;  2JHE A;  4BY1 K;  3NWR A;  3AOD A;  2Z2M A;  2CPZ A;  1FFW B;  2JL9 A;  5D4O A;  3L7O A;  3U27 A;  3G8Q A;  3SCI E;  3HK2 A;  2QA4 S;  2HIQ A;  2A6M A;  2HAF A;  2YNF A;  1DTT A;  1ZZF A;  4DR5 F;  3BUE A;  4L73 A;  1YVF A;  3RYL A;  2JOQ A;  3NEK A;  1EIY B;  1FO1 A;  4HAC A;  4LVN P;  1S76 D;  3C16 A;  1TWG C;  3UDE A;  1H6K X;  4H4K A;  4BC9 A;  2VV5 A;  4J9L A;  3MCS A;  4YFU A;  3LAM A;  4F26 A;  3MCO A;  4KV8 A;  2JFD A;  2Q79 A;  4OX8 A;  3H8Y A;  3I9V 9;  3JYT B;  3PYD A;  1FX2 A;  3J7Y U;  5IOS A;  3GCW P;  2N7Y A;  4E8U A;  5THW A;  2FVQ A;  2P6T A;  5E7O B;  1S1U A;  1HR0 J;  1YI2 S;  2MLX A;  1F5A A;  5GAH U;  3C6T A;  2HHT A;  3I4M K;  3DGP B;  2GQ2 A;  2VA2 A;  3WZ0 A;  2JEJ A;  2YX4 A;  3TOQ A;  4ZVU B;  4MEX A;  3H0P A;  4J91 A;  3PYF A;  2VKZ G;  1DD5 A;  2FD2 A;  1RHQ B;  2GNK A;  1CJT A;  2OEL A;  4KGK A;  1XBW A;  3NMA A;  1IR1 A;  2RT3 A;  2WSF C;  4RW6 B;  3MPV A;  3Q8S B;  1FFS B;  2DNR A;  4KAW X;  1HPZ B;  2Z2Z A;  1RT2 B;  2JA6 K;  2E7V A;  5M2P A;  4C3J K;  1BY9 A;  1Q5Y A;  1S6U A;  4DSK A;  4A8S A;  2UZA A;  3CDE A;  3A1Y G;  3PIP Q;  5BYQ A;  3UDV A;  3OTO J;  4KMA A;  2I5J A;  2ZC3 A;  1HNX J;  3IRW P;  1YJ7 A;  3SSS A;  3AD9 C;  2XCA A;  2WB4 A;  1RAI B;  3HOV K;  5CCL A;  3UI3 A;  4F50 A;  2DGU A;  3G8S A;  1K0T A;  1TAU A;  3VVU A;  1VJW A;  1NK6 A;  4M5G A;  1HNW J;  3PRB A;  2OPP B;  1N4L A;  2JLE A;  3UWT A;  1QM9 A;  2PA8 D;  1X9S A;  4U7C A;  3N5F A;  5D3G B;  2MPU A;  2BRL A;  2P2C B;  4CLT A;  4DL6 A;  2QEX S;  2R8J A;  1AUS L;  2B9W A;  2V69 A;  4ZP7 A;  1SKU B;  2E9R X;  3JST A;  4WFA Q;  3BKF A;  2HQG A;  1IJE B;  2JA7 A;  4HHU A;  1URN A;  2XY7 A;  4KE5 A;  2M88 A;  4A47 A;  2A6H A;  2GC8 A;  1JNZ B;  4C6A A;  2NVY C;  4AUK A;  3KLE B;  3QRR A;  1GQE A;  4Q5S A;  1O8B A;  5AE1 A;  3BV8 A;  1KQF B;  3DMJ A;  2DRD A;  5D78 A;  5F9N A;  4DV7 F;  4DL5 A;  4EGL A;  2GFF A;  4CO4 A;  3S14 C;  3RB0 A;  2KT5 A;  5KTQ A;  4U8Y A;  2BE7 D;  3A8K A;  2HNY B;  3NY0 A;  5KFH A;  5FLX U;  1D9A A;  3IWN C;  2PMH A;  1V3R A;  2A10 A;  2JC0 A;  4K4V A;  2CQB A;  2CFA A;  4DSE A;  3PX6 A;  5L9N A;  4JI3 J;  2HMI A;  3OFG A;  3CO0 P;  2JVO A;  3S1N C;  4LK1 A;  4B3O B;  1IKX B;  4AYB D;  1QAJ A;  5DO2 A;  5DGA A;  1KTQ A;  2QA1 A;  2VQF F;  4A3E C;  2CAJ A;  3BKT A;  1P9Q C;  1SJF A;  1RHJ B;  4P7T A;  4KGM A;  4B3T F;  1NSK L;  4G7Z A;  2GML A;  1KWM A;  1Y1V A;  2VBZ A;  2W9C A;  1RT3 B;  2HS3 A;  2J9D E;  4ED3 A;  1GMU A;  4X65 F;  1AUD A;  3EZO A;  2YNG B;  3QNW B;  1SL2 A;  3PHE A;  3WIV A;  3QSI A;  1NND A;  1SQG A;  1JQG A;  4DUZ J;  1SI9 A;  1Q5V A;  3GEI A;  3MR5 A;  2ZH7 A;  3G96 A;  4ZVR B;  4RW4 B;  4DR7 J;  1RAH B;  4O3O A;  2ABY A;  3OLA A;  1MG7 A;  2MZT A;  1WSV A;  3A13 A;  3D9B A;  3DLB A;  1X7V A;  1DAR A;  4OYX A;  1HQU B;  5HAT A;  1KTV A;  2W4D A;  1TKT A;  2E9Z A;  2RRB A;  1I3O B;  2OPS B;  3LPX A;  2XZD B;  3D4J A;  3BYR A;  4Y52 C;  4DR3 F;  4F0M A;  4A3I C;  3RAX A;  3R27 A;  2NXE A;  1HNX F;  4URQ U;  3N79 A;  3GTP A;  5KFO A;  4BY7 C;  4IR1 A;  1L3U A;  4GVB A;  4UOC A;  2XSJ A;  3OD2 A;  4H4M B;  4USW A;  3R2C J;  2KZZ A;  1HBU B;  2UV8 G;  3HVW A;  2HNZ A;  2OPQ A;  1WQF A;  4PUO A;  2R8I A;  2KVI A;  5EWF A;  4N76 A;  3AOB A;  3HCX A;  1ISE A;  4RNM A;  4FP9 A;  3W3S A;  4ZVP B;  3M4O C;  3JAM Y;  5DQG A;  3TVY A;  5LJ3 Y;  4IR9 A;  2ROP A;  2VQF J;  3KKF A;  3HKZ L;  3S7R A;  1U02 A;  4J90 A;  3OVA A;  4F02 A;  3D0G E;  1FE4 A;  2AJF E;  2NXU A;  3OXL A;  3P4U B;  1SC4 B;  3VA7 A;  2AGP A;  1TWA C;  3RTV A;  3E8O A;  4U95 A;  4CO5 A;  1WEL A;  1FDB A;  4B02 A;  4A3G K;  4KHM A;  2KRR A;  3HOW C;  3ILJ A;  3ZTP A;  4QBU A;  1I6H C;  3FCH A;  2E2I K;  2DGT A;  1KVJ A;  5HQ8 A;  2YVS A;  1EAR A;  1U7L A;  2R42 A;  1RP5 A;  1HAR A;  4Q8E A;  3ETM A;  1TKD A;  5ETN A;  1GAO A;  1S1U B;  4UZB A;  4I2P B;  5L9X A;  2I8E A;  1S7I A;  2CQ2 A;  4QIE A;  3ENQ A;  2X3D A;  3S2D K;  4HH1 A;  1BC6 A;  5KT2 A;  2ZEJ A;  3GMG A;  5EGH A;  2K7K A;  1N5V A;  4OJ1 A;  3AXM A;  4P73 A;  1TQL A;  1OSC A;  3VGU A;  2PI4 A;  2O1P A;  2DNK A;  4NXM F;  1X0F A;  1M1G A;  2ZH1 A;  2ZDO A;  2W2O P;  3GTY X;  2WOM A;  3LAJ A;  3OSP A;  2D7S A;  1J6W A;  2J9C A;  2WVF A;  5GMD A;  4NYO A;  3S1N K;  3GTL A;  1T11 A;  1HBN B;  4A3F C;  2DGQ A;  4KM8 A;  4KO0 B;  3FMB A;  3S01 A;  1BQX A;  1LW0 A;  2VPX B;  5C4J C;  3M3Y K;  2IRU A;  7FD1 A;  2RRA A;  2NSC A;  2VOO A;  3JQM A;  4MH8 A;  2W9A A;  5AXK A;  2JEG A;  2V6S A;  4L6V 3;  1HA1 A;  2BEF A;  5D6G A;  2CQ1 A;  4BDP A;  1H0H B;  2PGC A;  4IFY A;  2XS7 A;  4M95 A;  2EW9 A;  2GVZ B;  1KQS R;  2EKN A;  3IAM 9;  1B3T A;  4Q2M A;  4I2Q B;  1J5O B;  1QSL A;  1ZQ1 C;  3V81 A;  1PC5 A;  5CAA A;  5DM6 Q;  1RWK B;  1M5S A;  2B6A A;  3TJ9 A;  2FQQ B;  3HI9 A;  4X4T A;  4RBU A;  2Y0S L;  4H54 A;  3C14 B;  1PGZ A;  4DR6 F;  2ATC B;  2QLF B;  3CNQ P;  2J6S A;  4OYO A;  2OTL S;  4J3N A;  2OKQ A;  2GAH C;  2HND A;  1CEZ A;  5KOW A;  4NX9 A;  1I50 A;  1CSJ A;  1EQM A;  2BX6 A;  5C2C A;  5IC4 B;  2I6W A;  1WEX A;  4IOA Q;  3HSJ A;  2R92 K;  2NLW A;  2COL A;  4JBC A;  1ULR A;  5D3G A;  1S77 D;  1U48 A;  4CNZ A;  4ZVQ B;  2BAN B;  3QAU A;  1F5C A;  1ZA2 B;  3DHW C;  5F0U A;  3DU6 A;  1OIA A;  4NLO A;  5IOR A;  3J7Z 5;  1S72 S;  3N6L A;  3KMS A;  4JV2 A;  1KKH A;  4YUD A;  6FD1 A;  1MWQ A;  1J6X A;  2W24 A;  1S9G A;  3M2R B;  4IKA A;  1YRU A;  4P10 A;  5LSL A;  3P5B P;  5CCM A;  4I7F B;  4L76 A;  3OTD A;  2DK2 A;  3VGV A;  2DRA A;  2ZOG A;  2LA4 A;  1UZD A;  1RWW B;  4FPI A;  4C2M C;  1BQN B;  4J9S A;  4D3G A;  3S1Q K;  1KLM B;  3CJ3 A;  2OMO A;  3MAH A;  3V4G A;  2G13 A;  4XK8 C;  2QC3 A;  5SUH A;  1TUG B;  2Y1J A;  2C3Y A;  2G1H A;  4RW6 A;  5DS7 A;  1S7H A;  1RTZ A;  4J5O A;  2ZUF A;  2FLL A;  1RLD A;  2MKJ A;  4YR0 A;  2KDO A;  2HZC A;  4DN9 A;  1LXJ A;  1HBM A;  2RE1 A;  3IRX B;  3RB4 A;  3FQK A;  1E6Y B;  2QJ3 A;  1HWU A;  4K5S A;  2ZH2 A;  3KHH A;  4DV5 J;  3SCJ E;  3QT5 A;  3MUM P;  1WHW A;  1FD2 A;  1BJT A;  1D3W A;  2W7P A;  2WSC C;  3CCT A;  1W2I A;  2R7V A;  3W65 A;  1LW2 B;  3B82 A;  5AJ3 F;  4EWT A;  3FCW A;  2DHX A;  4IG0 A;  2V9W A;  3PO3 C;  3PXG a;  1JJH A;  1NME B;  3M1V A;  4QWC A;  1RCX B;  2AF6 A;  1K44 A;  2JA5 K;  5A8R A;  3TW0 A;  2FC9 A;  1R8B A;  2B4V A;  3IGN A;  1Q82 T;  1Q8B A;  4CLW A;  2XCO A;  4KJI A;  2KN4 A;  3KLF A;  4FM9 A;  3B8H A;  3LTO A;  4A8M P;  2YWH A;  3UD4 P;  4R5P B;  3MOZ A;  3OHA A;  4BCA A;  3D5M A;  4YFN A;  1FDN A;  4GKK F;  3ERE D;  1HIY A;  3VWS A;  3LAL A;  3CCL S;  4NXN F;  1XN9 A;  4O3P A;  2OPP A;  4Z7Y A;  3Q8U A;  2DR5 A;  2E29 A;  3BZQ A;  3I9Z A;  3PR4 A;  1YG0 A;  1RKI A;  1FE0 A;  2Y0S D;  3EQL A;  4L72 B;  3OPK A;  5JJB A;  2CZ4 A;  1QAY A;  2QTW A;  2LYV A;  3AOC A;  1JLF B;  3PEJ A;  1VHF A;  1HHT P;  4GKJ F;  4RNF A;  1M0S A;  5KFB A;  3EGN A;  5DJB A;  1D9F A;  2AEF A;  2NVQ K;  1DQA A;  2ZFH A;  3RB6 A;  4QPT A;  5KG1 A;  4P5A A;  4MK7 A;  2WB1 L;  3T1H J;  1G51 A;  4MKA A;  1AFJ A;  3G4S S;  2OUG A;  2XLI A;  2MMY A;  2D9P A;  3CT9 A;  2YX7 A;  2MQN A;  5IT0 A;  3DLL Q;  4A3K C;  2IAJ A;  3TX0 A;  3E01 A;  3GQC A;  3D66 A;  2P9C A;  4I2P A;  1EFW A;  2PD1 A;  3H42 A;  1KQ4 A;  2PII A;  3W9J A;  2BKO A;  3FBF A;  4ELV A;  1BGW A;  5C42 B;  2OHD A;  3N28 A;  3IFE A;  1VC6 A;  2CYY A;  3IWL A;  3GCX P;  4QPX A;  3HXM A;  4PWU A;  3FGV A;  1YBU A;  1CVJ A;  3LH2 S;  5RUB A;  5KFM A;  4OZN A;  4LK0 A;  4DG1 B;  1JLA B;  1L5U A;  4PZV A;  1ZM9 A;  4DV2 J;  1RTD B;  4RW7 A;  3GTK C;  5CZX A;  5EUH A;  1UPM B;  1VRT B;  2ZBP A;  2C2E A;  4X2B A;  3LAN A;  2RQC A;  2POK A;  3VQT A;  3M9N B;  5I3U B;  1VI7 A;  3M8R A;  3JYT A;  2PSZ A;  1TWG K;  4QIV A;  1JLG B;  1TL3 A;  1CC8 A;  1IKY A;  2NVX A;  3RB3 A;  3DM2 A;  4OX9 J;  4BBR K;  2BE2 A;  4XTT A;  2PI5 A;  2V68 A;  1D09 B;  1F2H A;  2LDI A;  3I82 A;  4RBT A;  2CZ9 A;  2XS2 A;  4NXM J;  3AA9 A;  2YKO A;  4ZN1 A;  2UXB F;  2K3K A;  2KL8 A;  2LXU A;  1UAW A;  1RWX B;  4DJB A;  4C3H K;  2OGU A;  1AYE A;  2CQD A;  4OYP A;  2NPF A;  4CO2 A;  1PBA A;  5CYQ A;  2DNP A;  3CCQ S;  1MRO B;  2PEH A;  3EZU A;  3OL9 A;  3BS9 A;  3V2U C;  4Y7N K;  4LR2 A;  2H1Y A;  1R0A A;  4LLG A;  2IC3 A;  3CUL A;  2AYE A;  1S1X B;  2CPX A;  4XPE A;  4BY7 K;  4R25 A;  1VLO A;  5LMN F;  4YB6 A;  4USI A;  1LEO A;  7AT1 B;  4O3Q A;  5ETL A;  3W8P A;  4PQU A;  3KK2 A;  3AAW B;  1TWA A;  1OPI A;  1BE4 A;  3PCO B;  4PQA A;  4K7Q A;  1B64 A;  1ZAX A;  3HOX K;  3MM8 A;  4CLY A;  4C11 B;  4CLS A;  4OIX A;  3M6W A;  1MMN A;  4QW9 A;  4ZVE A;  2HVE A;  4OZ1 A;  2ZUE A;  1WEZ A;  1Q79 A;  4F04 B;  4QW8 A;  1DFD A;  2GJ2 A;  4GTB A;  2IA6 A;  1HWK A;  5BR8 F;  1S1V B;  1GFW B;  1UEK A;  3HVA A;  1QJH A;  4Z7C A;  1XMQ J;  1NK9 A;  3DLG B;  4KGV B;  2CWK A;  1R8A A;  3KK3 A;  1S9E A;  4MK8 A;  2HSE B;  1B4S A;  3BR9 A;  3HOZ C;  4QU7 A;  2NQP A;  1DRZ A;  2YBV A;  2KI2 A;  3TA0 A;  1UCN A;  3TFJ A;  5D0R A;  2X51 A;  3MED B;  1OY6 A;  1J5E J;  1TFW A;  3BH6 B;  4DV5 F;  4RW8 B;  2DY1 A;  4DS4 A;  2W4P A;  4RNO A;  3CJK A;  3BP3 A;  3H3V D;  3KLI A;  4DR7 F;  2QMU B;  2PMZ D;  3V4M A;  4OYZ A;  4X62 F;  2KG1 A;  2L9W A;  3F73 A;  3AB2 B;  4ZN3 A;  2W4C A;  1NSQ A;  1FWL A;  2KYX A;  3QT6 A;  4XLN A;  1IKX A;  3GG0 A;  3DNC A;  3ZZ0 A;  4WZQ A;  1LOU A;  1TV6 A;  3SDE B;  2N7C A;  4F4Z A;  3MED A;  3FRZ A;  4R0E A;  1RHR B;  3KUE A;  5F8G A;  2XTJ P;  2KO1 A;  2EK1 A;  5B0F A;  1NLK L;  1PC4 A;  1YRT A;  3P96 A;  4BBS K;  1U0H A;  2M4M A;  2MGZ B;  2UXB J;  1WDD A;  1E6V B;  1BLU A;  3IR7 B;  1ZOT A;  2E5I A;  1U09 A;  3QAT A;  1FEE A;  2B8Q A;  2MDA A;  2BXJ A;  5G0R B;  1S0V A;  4UQT A;  3RZO C;  5A76 A;  4DV4 J;  3H2L A;  5BR8 J;  3GTM C;  2IBK A;  2EKY A;  1IBK J;  3VCD A;  2IJN A;  2BZ2 A;  1TL5 A;  1GH8 A;  4J9U E;  5IYB K;  1RT1 B;  1TL1 A;  4A3J K;  5HMW A;  1NKE A;  1H72 C;  5IYC C;  3PO4 A;  1M5K C;  3CCR S;  3NGK A;  4J9Q A;  2HNZ B;  2OPQ B;  4F4K A;  2FGC A;  2MQO A;  3BQ0 A;  4Y2I A;  2DBB A;  1YJ9 S;  2E5L J;  4KN7 A;  4P2M A;  2KT2 A;  2IJF A;  2B0G A;  3VAI A;  3KLH A;  1RT1 A;  1DCH A;  2I1R A;  2GQQ A;  1WOR A;  5LSR A;  4FXV A;  4B9M A;  1GTE A;  1RHU B;  2YKA A;  5C24 B;  2HBY B;  2CVE A;  2X1G A;  2R4F A;  4GVL A;  1RAJ A;  3PJ9 A;  3I0S A;  3MM6 B;  1N48 A;  3BRE A;  4OV1 A;  4M5D B;  1TTH B;  1W7W A;  3HOX C;  3GTK A;  1R27 B;  3CVK A;  4RU2 A;  4C8M A;  3QT8 A;  2IFX A;  2X1A A;  3OVS A;  3G6Y A;  2B3T B;  1TKZ A;  3OVB A;  4U8V A;  1IKW A;  2B8P A;  1RWO B;  1P27 B;  4KKO A;  1NSP A;  2DPI A;  3QLH B;  5E2Q A;  5HMY A;  3UQS A;  4B9S A;  3KYL A;  5KG6 A;  3K2Y A;  5HI7 A;  4Q0B A;  3Q8R B;  2EI5 A;  1SQE A;  2KFZ A;  2HS4 A;  3TA2 A;  4DV4 F;  5C3E K;  4OIN A;  5FLM C;  1Q0N A;  1X4G A;  4CWB A;  2YWF A;  2G2Z A;  4FF4 A;  2NYI A;  4JB8 B;  2R3V A;  1S6P B;  1VOM A;  3WBZ A;  4B9L A;  4ZIT A;  3FSX A;  1QTM A;  3HOU C;  5H9E J;  1KNZ A;  2UU9 J;  2G4B A;  1NCL A;  1R0B G;  2VC1 A;  4LUB A;  4PAB A;  3NCQ A;  2ZH6 A;  4U7U D;  1JLG A;  1VQN S;  2VON A;  1NKC A;  2ZZT A;  4LFB F;  3TWZ A;  1BUX A;  1OYE A;  2OP5 A;  1UVL A;  3M4O K;  4DPX A;  2CJY B;  3ZTR A;  4A3K K;  3FC9 A;  5J2N B;  5EWG A;  1D9D A;  1DLO B;  2ROE A;  1KDN A;  1R0A B;  2QIF A;  1HBO A;  3DC2 A;  4U96 A;  4A3M K;  4N7T A;  3NGR A;  1N33 F;  1L3S A;  3Q2T C;  1RTH B;  2RD5 C;  4WE1 A;  4O0I A;  5CH7 B;  2UUA J;  5K9F A;  1JWW A;  2DHH A;  3ZZZ A;  5KFS A;  3ICL A;  1CQN A;  3QWP A;  2B9Y A;  1HLW A;  1S6Q A;  4HH0 A;  2VA3 A;  2DJW A;  3IBW A;  2W2N P;  2AGQ A;  1D8Y A;  5C4J K;  4HDH A;  4NOH A;  1HKA A;  1LWF A;  5K14 B;  2X3G A;  1TMM A;  2A18 A;  2RKI B;  1F3F A;  2NVT C;  5A8W B;  1FNX H;  1C0T A;  4PYD A;  1JLQ B;  4BBS C;  1RTH A;  5CYJ A;  1IQT A;  5E3R A;  5LMN J;  1RDR A;  2IA0 A;  1ICE B;  4CLL A;  4WYW A;  3R7N B;  2QSW A;  3K5L A;  1T7P A;  2CNL B;  3DI6 A;  2CNK B;  3D7S B;  1H7W A;  3G6E S;  2QMX A;  1L3T A;  2HND B;  2HVZ A;  3GFX A;  4YY3 F;  5HAN A;  3CPW R;  5JXS A;  2ASY A;  3K8W A;  3E3X A;  4NMX A;  3WC2 A;  1S48 A;  3IG1 B;  5KG4 A;  2V6T A;  1LFP A;  1R8P A;  4LJZ A;  4DUY J;  4RUC A;  2YH1 A;  1SXL A;  4KMD A;  2OSR A;  5KFF A;  1UKU A;  1VQ5 S;  3R1L A;  2FJD B;  4JI4 F;  2JA6 C;  1M90 T;  4FXD A;  3DLK B;  1KLM A;  1FHT A;  3CB4 A;  3ZC4 A;  3SCK E;  1N0V C;  2AJQ A;  2DO0 A;  2V50 A;  3ETO A;  2W9B A;  4RZR A;  3VAJ A;  1FTC A;  4RUB A;  2YQ1 A;  1RT6 A;  4Q4Z A;  1GMW A;  2O5I A;  4UST A;  2IRX A;  1KSP A;  1X5P A;  1ZH5 A;  3BQ1 A;  4LRC A;  2BR0 A;  1WUU A;  5HL7 Q;  2WVB A;  4DFP A;  2HQ3 A;  2FUG 9;  5M2R A;  5HL8 A;  3HHL A;  1YBA A;  2ZE2 B;  3PFE A;  1IXK A;  3EVW A;  5T41 A;  3IA0 A;  4DQR A;  5HBM A;  1JJC B;  2BJ8 A;  3T01 A;  3M6X A;  4Z2X A;  4X64 F;  1Y4Z B;  3NG8 A;  1HD0 A;  1APS A;  3G9C A;  2BE9 B;  3OR1 A;  2R92 C;  4DX5 A;  5LJ5 Y;  2O66 A;  4S0M A;  3POT B;  1NB2 A;  3DXS X;  2AW0 A;  2F5G A;  2UUC F;  1SUQ A;  1H74 A;  1SFO C;  1UTA A;  4DDQ A;  4USH A;  1JJ2 R;  2J6T A;  4P6Q A;  4WIL A;  2QLW A;  1M1H A;  5HJX A;  2YKM B;  5IM0 A;  1O2F B;  1S12 A;  2XM3 A;  3LF0 A;  5C4X K;  3HPO A;  2E2J K;  1NXI A;  4G0U A;  1JK9 B;  3HLU A;  4EEY A;  4LRE A;  2KVQ E;  3T3F A;  4IOB A;  1I1G A;  2AJ1 A;  1XR6 A;  3DHX A;  3UCG A;  2A1B A;  3IM8 A;  4DEZ A;  1NM2 A;  4OIO A;  4WFX A;  3K57 A;  4FPR A;  5K8M A;  4B3T J;  3PO3 K;  4NLD A;  1OQ3 A;  2LQJ A;  1WKK A;  3N3Y A;  2P8T A;  4LSL B;  5KFC A;  3AQO A;  3B54 A;  3OR2 B;  2B6A B;  1HFE L;  3HKZ D;  3IN5 A;  2YWG A;  3PRD A;  4ES3 A;  4NYP A;  4RWX A;  3H4D A;  2RQK A;  3BR8 A;  4HI1 A;  4AH6 A;  2U2F A;  4I6A A;  1U1K A;  4DFM A;  3NNH A;  3VZI A;  4G7H A;  2VUG A;  5EGY A;  1XMO F;  1WF1 A;  3BB5 A;  1TKT B;  4KT0 C;  3GIL A;  2JA5 A;  1WG5 A;  4PAA A;  2DH8 A;  2XBP A;  2IPO B;  1BGX T;  4C0O C;  4G7O A;  3GU0 A;  5K8N A;  1IBL J;  1JKH B;  2VPZ B;  1JOE A;  3NS6 A;  5D15 A;  2SXL A;  1SMY A;  4TY9 A;  5KFW A;  4ZJQ A;  1WEY A;  3LAK A;  3CDA A;  2WOM B;  1W2B R;  4JI1 J;  3FKB A;  1WWH A;  4O3S A;  3J7Z T;  4F4X A;  1IWG A;  1HBN A;  2FY8 A;  3IR5 B;  3HFK A;  4R8U A;  3W2W A;  4TQS A;  3C16 B;  4UOG A;  1TL7 B;  2O01 C;  1TKX A;  1YGY A;  3MPU B;  3CJT A;  3TFH A;  4LBH A;  4XAK A;  1DQ9 A;  2JA8 K;  1TWC A;  3NOC A;  1X5T A;  1IR0 A;  2D74 B;  2JSX A;  1VH2 A;  1S57 A;  3DOK B;  2ZDP A;  3M8P B;  4DQQ A;  4P71 A;  3HFZ B;  5FDL B;  3GV5 B;  1MSW D;  2DXE A;  1TV6 B;  3BGL A;  2W25 A;  3N5B A;  2BUN A;  1JLE B;  3MCM A;  4MFB B;  4A3D C;  2VHG A;  4OMF G;  4QWE A;  4LT6 A;  3PTW A;  4FVM A;  4NLY A;  3IS9 A;  2Z30 B;  1KHW A;  4WTY A;  4ZVG A;  4RW9 A;  2DIT A;  1IKY B;  3SQG B;  2MTL A;  4K0K J;  4GVB B;  5D0G A;  3HDS A;  3T9Z A;  2ZUG A;  3KWM A;  5BYR A;  3W2V A;  4LF6 J;  4X66 J;  2HVH A;  3O6Q A;  4DS5 A;  2BOA A;  1VK3 A;  1RAF B;  1XQI A;  2VUM A;  4ER8 A;  4WU3 A;  2LXI A;  4UF4 A;  3ZZY A;  4AE5 A;  5L1J A;  2Z0G A;  1VC0 A;  3QRQ A;  2M8H A;  5F41 A;  4EZ6 A;  4OHZ A;  2ACY A;  3VVT A;  4WWS A;  1WC3 A;  2XS5 A;  3KNG A;  5ETV A;  3HOU K;  2FDN A;  1D0E A;  4HTJ A;  4N56 A;  4XO0 A;  2D1C A;  4DOZ A;  3DN9 A;  2R8K A;  3G86 A;  4OJH A;  3IG1 A;  4OIQ A;  1U0S A;  5CYQ B;  3TEG A;  2IMW P;  4BBY A;  4LRD A;  3T02 A;  3CD0 A;  2IJR A;  5KFJ A;  2OJ3 A;  5A8K B;  5B0A A;  3AHP A;  3LPE A;  3KJF B;  1BMQ B;  2GHW A;  3R5C A;  3O3L A;  3GJS B;  2CQ4 A;  1HNI A;  3I56 S;  1U47 A;  3L7U A;  5HMZ A;  3MEC A;  2LEC A;  3W2V B;  4LSN B;  4B9U A;  3C6T B;  1FD8 A;  1SB6 A;  1FRM A;  3T00 A;  4MT1 A;  2YNF B;  4KHR A;  2V5H G;  4MYT A;  2NVY A;  1U45 A;  3KUG A;  3SYZ A;  2HS0 A;  1J6V A;  3HHL D;  4IYQ A;  3E51 A;  4OYB A;  3NRB A;  2QG9 B;  1L3V A;  2R7Z A;  4DR1 J;  3UN2 A;  3KDO A;  4C97 A;  2JX2 A;  1HHS A;  1HQE B;  3MML B;  5E33 A;  3SCL E;  1AFI A;  3RGI A;  3L95 X;  3RZA A;  4LIR A;  1KQG B;  1WC6 A;  2VKR A;  1RSC A;  3N6N A;  3VZH A;  2DR6 A;  4LF9 J;  4ZLL A;  2E5J A;  3ZNU A;  4DDF A;  2ZVS A;  3PW7 A;  4OI1 A;  2Y0B B;  4DR4 F;  5C44 C;  2XO6 A;  4C3I K;  4X64 J;  3Q3Q A;  3BJY A;  5L1I A;  5K14 A;  4UT4 A;  4ZLP A;  3IO1 A;  3HHL B;  3SQO P;  1W26 A;  4M5L A;  1CLF A;  4WTO B;  1Q95 G;  4TKT A;  2XQC A;  4P7V A;  1RTI B;  2YNH A;  5CQG A;  3FQL A;  4AXJ A;  4LFC J;  5CHP A;  2IBO A;  4PEO A;  2NRE A;  3KG0 A;  1CPZ A;  2XLK A;  1FRL A;  4JV5 F;  2JLF A;  3T5L A;  3TAM B;  1TUV A;  3C66 A;  4NLV A;  2GO9 A;  1JX4 A;  3QJP A;  1O51 A;  4C2M K;  2BAC A;  3MR2 A;  4ZJO A;  3VGS A;  3L4B C;  3HOV C;  1JXV A;  4HDG A;  3C15 B;  2VIH A;  4F4W A;  2BAN A;  4JI3 F;  4KAR A;  3S2H K;  4KHP J;  3HT0 A;  1VRU A;  5IWA F;  4TU8 A;  3I32 A;  1U1L A;  3BYP A;  1EQ0 A;  3NS7 B;  2F8H A;  4TU9 A;  3H2U B;  5BYS A;  3TUI C;  3M9M B;  2EG1 A;  3QZ8 A;  2FPH X;  5HRO B;  5CD4 A;  2G2Y A;  2EBE A;  2EVZ A;  2J8S A;  3DI6 B;  1KFD A;  3K7R A;  1SCJ B;  2XHW A;  3KTQ A;  3OBI A;  2DKO B;  2RF2 A;  4LF9 F;  1RIS A;  5C4X C;  2LQ9 A;  3VF0 B;  2U1A A;  1GK8 A;  4A8F A;  4YHH F;  2L08 A;  2M0G B;  3OFH A;  4RBV A;  4KIA A;  1NHK L;  4XIU A;  2LDY A;  4NCA A;  5TJ3 A;  2XWX A;  1CG2 A;  2XG8 A;  4XCH A;  2ZBI A;  2E1R A;  3BQ2 A;  1TUW A;  2WRM A; 
#chains in the Genus database with same CATH homology
 1WOR A;  1XZQ B;  1YX2 A;  3A8J A;  3GEI A;  3AD9 C;  3GEH A;  1VRQ C;  1PJ7 A;  1WOO A;  4PAA A;  1PJ6 A;  3A8I A;  3TFI A;  3GSI A;  1X31 C;  3AD8 C;  3A8K A;  3ADA C;  2GAH C;  1V5V A;  3TFH A;  3TFJ A;  1XZQ A;  1WSV A;  4P9S A;  3AD7 C;  1WSR A;  3GEE A;  1WOS A;  3GIR A;  1XZP A;  3TTG A;  1WOP A;  1XZP B;  4PAB A;  2GAG C;  1PJ5 A;  1VLO A;  5L46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...