1VRQC

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcosine oxidase alpha subunit
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 50
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1vrqC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1vrqC01
1WSRA 3A8KA 4PAAA 3GEHA 3TTGA 1XZQB 5L46A 4PABA 1WOPA 1PJ6A 1WORA 3A8IA 1WSVA 3A8JA 1PJ7A 3GEEA 3GEIA 1V5VA 1WOOA 1XZPA 3GIRA 3TFIA 3TFJA 2GAGC 1YX2A 4P9SA 1WOSA 1XZPB 3AD7C 3GSIA 3TFHA 3ADAC 1VLOA 1X31C 2GAHC 3AD9C 1VRQC 1XZQA 3AD8C 1PJ5A
chains in the Genus database with same CATH superfamily
4O3QA 1T02A 2EK1A 1A9NB 2HGLA 4ILLA 2ZNYA 2Y1IA 4K5RA 1NH7A 3PR5B 2DHAA 1SH0A 2O66A 4FF1A 4P74A 4ANEA 1W2BR 1LFWA 2VICA 3FKIK 1X0FA 1Q5YA 5DG9A 2HGNA 2W7PA 1ICEB 1WORA 2B51A 3Q2SC 4F25A 2W01A 2CPFA 3W9JA 4JK1A 3ITHB 4GFQA 4DSJA 4TYBA 4M5DA 1BE4A 4DWIA 2FGCA 1C0TA 4V19J 1TKZB 2YKAA 5KT2A 4DQPA 4ZJQA 2G0CA 4WKYA 2DCUB 2MQ8A 3MHYA 4NLDA 2V6TA 4C48A 3H3VL 4LQYA 6AT1B 3I0SA 2KXHA 2CPXA 3F0NA 4DL2A 4Y2AA 4F3OA 2KM8B 1T9WA 5GMDA 3GTKA 3S1NK 4OLOA 1SKRA 3H7HB 2B43A 3H59A 1U24A 1VQ8S 5JFEA 1C1CA 3FQKA 3C6UA 1MWZA 2F1FA 3P3DA 2E2HA 1U6BA 4YEAA 2IJNA 4A8KA 1VGYA 3TVKA 4N41A 1YQHA 2DGSA 2OEJA 1PJ7A 4OYZA 1WNEA 2OKQA 3DU6A 1USMA 4DV0J 5L38A 2IVFB 3H20A 1XR7A 3NRBA 2UUCF 2A18A 2HK3A 1F7UA 2RHSB 3MPUB 4ZOSA 2IDEA 4EBEA 1H3DA 3CE8A 1TL3A 5L46A 3HJVA 2Y1JA 1SKWA 3CMES 3OPKA 4A3DK 2EG2A 1S1VB 1H6KX 2ZITA 2L3MA 4O4RA 2WCXA 2GCFA 2C42A 2MPUA 3HD1A 2L08A 2CFAB 2UZAA 4CRJA 3S2HC 3OXFA 1TKDA 2JSXA 4WZQA 1HBMB 3M2VB 1IQTA 1KS2A 5LL6d 4WYWA 5A8KB 5JVHQ 2ZD1A 3J81Y 3KK3A 4RLEA 5KFWA 2J7WA 3T6JA 1EB0A 5GAEI 2Y0BB 1Y9OA 1W25A 3M8QA 1VOMA 2ZJRQ 2YQ3A 5HMYA 1WOPA 1SC3B 3Q8PB 1RHMB 4U8YA 1QAYA 3MR2A 1SL1A 2HHUA 2W4CA 2FJVA 4Q2LA 1Q4RA 1IXKA 3NCQA 2EBGA 1W7WA 1PKUA 3CJQA 4MYUA 3EZ5A 4ED1A 1O27A 3HOUC 1HQEA 1IKYA 4U9RA 3WIVA 2E2HK 3KFWX 1DD5A 4XPCA 4OYMA 5FD1A 3QLHB 2ATCB 1UEVA 1SH3A 5KFDA 2MQLA 2G4BA 3TAMB 1MMDA 4ZCMA 3QRRA 2J9DE 3NLCA 2OHDA 2WW8A 1RBAA 2BQRA 2BXJA 2IBOA 4GTFA 4P7VA 1Y1WK 1V9OA 1CBKA 2BE2A 2I8EA 5EGYA 3A12A 4NOHA 2YKMB 4CO1A 2A6HA 5JJBA 2NVQK 1FDBA 1CQMA 1TL7A 3L4KA 3GTGK 3ULHA 3AAWB 1XXBA 3GTPK 1BQMB 1T03B 1R0AB 4E0DA 3OFGA 4AUKA 3M4OK 5LSLA 4J90A 5A2QU 4IFVB 2C28A 1WEYA 5IQ6A 3G96A 1MG7A 3CQZA 2D3O1 3NS6A 3OR2B 2BZ2A 3KJQB 4N7TA 2M0GB 5CYQA 3K7RA 2E9RX 5HP1B 2FGOA 2UUCJ 3G4AA 2B6AA 3D6HB 3ZZOA 1ZH5A 3QWPA 1NSPA 2A69A 2B9WA 1XXAA 2DTJA 1FX4A 5K8NA 2MQMA 5LJ5Y 1H73A 1FE4A 4PG5A 3N0BA 4B3MF 3AA9A 4J7CA 3PRVA 1DFDA 1EARA 2R8JA 1Z1ZA 5A8RA 4ZCLA 2LQJA 1T9YA 5IYBK 1SC4B 1SUQA 4Y52C 2BANB 3V2UC 3BDPA 2P6SA 3BR9A 3PO3K 4HVZA 2L9NA 3D0HE 3K5NA 5L9NA 4GTLA 3M9MB 1JOEA 3K5OA 1RJJA 3PEHA 4BC7A 3IO1A 4DV1F 4CT9A 3LUYA 5FDLB 1F3VA 3GTJC 1SFOC 1R3NA 2XMJA 4OIPA 5HJXA 3MEDB 5AE3A 2DGWA 1CULB 1AFJA 1IWAA 2D3ZA 3FK4A 3ZZZA 2OAUA 3GTOC 2BEFA 3BN7A 3GTQA 1CJUA 3OT9A 4HI2A 1S1WA 2BOPA 3HFKA 5KT7A 4OZ5A 3GV5B 2D6FC 2V6SA 4ZKAA 4C8NA 3FKBA 4A3MK 2XHWA 4ZVPB 5J2QA 4Y0FA 4FBUA 1GX5A 1VK3A 4X4NA 1EKSA 4OINA 3DLEA 1RWOB 3VA7A 3B4MA 3IFEA 1P9QC 1FCAA 1UA1A 4WBFA 3CXCR 1XR6A 1GXLA 2KB2A 1RP5A 1RAFB 5HO4A 1Q82T 3CF5Q 3K58A 1YVFA 1KKHA 2JNJA 4R25A 1NJWA 1NB2A 3UCGA 4NCGB 4ZITA 1RCXB 3NNHA 3IS9A 2FHJD 2QA1A 1X60A 1PSDA 2QLJB 1IS1A 1KONA 1S9GB 3V4IA 2AYBA 3ZXWA 2JEJA 3TUZC 4JI8F 1TWFK 1FNMA 1RDRA 2DO4A 1UZDA 3MM9B 2LU2A 4KR0B 1M5HA 4ETXA 1FKPA 2VG5A 4X4SA 2KT3A 2OEMA 1M5OC 2DNLA 1GEHA 1XMBA 3QT6A 1QAIA 1JLGB 4FVCA 5L9XA 2B9YA 2HRUA 5IM0B 4EBDA 3SSSA 5C44K 3US5A 2V50A 1U0HA 5E3QA 3R5AA 2NLWA 5DS7A 3NOGA 2VBZA 5IC6B 3PKYA 1RAAB 4USUA 3BO3A 2FJXA 2QYCA 4UY8T 4B08A 1FD8A 1WQFA 1B0VA 3M8PA 4B3MJ 1MROB 3HOWK 4ZH4A 1RWVB 5D3GA 3IWXA 3M6XA 2YNGA 4XCHA 4QIVA 2ZC3A 4F0MA 3GG0A 2XYHB 1NRKA 3GTQK 2AYMA 1RBOB 2FZCB 4YB5A 3BSCA 3BF4A 3GV8B 3QRPA 3UR3C 4ZPCA 3IR6B 4K59A 4C98A 4DV1J 3NGKA 4XPEA 3V4GA 4C8YA 3TJ9A 3T5HA 2Q6CA 4N76A 3T02A 3MM5B 3L95X 2VB6A 3THVA 3BGRA 4RNHA 4C3JC 1SQEA 4NLXA 3MUMP 3PEJA 4Z37A 4ECXA 2NVYC 1LWCA 4FVMA 5DRKA 1SKSA 2UV8A 1A6LA 1GFWB 5MLCV 5FLMK 2K3KA 3BPSP 4I6WA 3LPYA 3UVJA 1IN0A 4P75A 2K1RB 2OO4A 3CCWA 1O51A 2EFQA 5ETKA 3I4PA 1U49A 2H5JB 5ETOA 3O5TB 4Q5VA 3SZ2A 2HBQB 1CJTB 3BBCA 1IR0A 1X5PA 4IUFA 3MEEA 1Q53A 3WBZA 3OJSA 3ZZYA 3BB5A 3ET6B 4YFXA 4ZP7A 4AL5A 5HLFB 4YR3A 3HOYC 4ZVOB 3S1QK 3TNVA 4KGVB 3H5UA 3W8PA 5D4PA 4RW9A 5I3PA 2PIIA 3B8HA 3R5DA 4JI8J 4GTDA 2KFNA 1U7LA 4WKRA 5F3ZA 2JH3A 2GAHC 2HFSA 2GHPA 2GHWA 2DR6A 3M2UA 5J2PB 4JI0F 4XDCA 4HH1A 4LBIA 5ETRA 2ZDPA 1RTHA 1C1BB 1Q5VA 5AXMA 5LMUF 4ZS6A 4H4OB 4KN4A 4EO8A 3L4BC 1J2VA 1TK5A 4I2PB 2AD9A 4TN2A 2R8HA 3FZ2A 3CC4S 2HNDB 3BQ0A 4AYBL 1AT1B 1LOUA 4WILA 4BY1C 2R7RA 4W92B 4LIRA 5DO2A 4CP5A 2HVHA 5KT3A 3JSMB 2JC1A 3H0GA 3Q23A 1TWHA 4DFPA 5DM7Q 2XCRB 3MPWA 1L3KA 4ELTA 2Y8WA 5IOTA 2AWZA 1GMWA 3IBCB 2V4QA 3RW6A 2VPYB 4ZPTR 3DGVA 1NPRA 2H51B 3OTEA 2DNZA 3AJ1A 1FDAA 2CJBA 2DNHA 1VRTA 2BJDA 2IMOA 1A7GE 2IVYA 1N54B 2DH9A 1HLWA 3WHIA 2QZ8A 4F26A 2ASYA 4KAIA 4G1QA 4OZJA 4ZJLA 3QJLA 4UOFA 5G4DA 1R8HA 5HJYA 1VR6A 5F8HA 2Z56B 3S17K 1F1BB 2BE9B 1S6UA 2XYGB 2BUNA 2B7BB 4UZBA 2GGPA 4QQBA 1R0CB 4IH7A 2MKYA 4U8VA 5KFRA 3EPGA 1WOSA 3W9IA 2ZH1A 4O2DA 3R8YA 4JUZA 3G86A 3CCQS 4M5DB 5KFTA 4ECTA 1R6YA 5C7PA 1JJCB 3RUBL 2GC8A 3GYNA 4UW2A 4CI0B 5HQLA 2XY7A 1GTEA 2VFVA 2RT3A 1SCJB 2OPPA 1NZ8A 3QGHA 4MK8A 1XNRF 4OLPA 2UUBF 3CC2S 5F41A 5DDRC 2CPHA 1R8PA 3GONA 3I0SB 4TXSA 1DARA 4GRSA 1S0VA 3MMAA 4CLPA 5F8LA 1SMYA 2ZKTA 3EMTA 1JX4A 4M95A 3JQJA 4J9KA 1UA0A 4K4WA 5IP7C 3MTKA 1C1CB 5ITHA 1I3QC 3C6UB 5EWFA 2KJWA 4USKA 1JKHA 2KO1A 3H0GK 1TWHK 3CCRS 4UOHA 1Y1VA 2NXNA 1IBAA 2OTJS 4JI0J 4FYYB 2HVZA 3ZNJ1 3SEOA 3UNYA 9RUBA 1TL3B 4B3SF 1VHFA 1FXRA 2YU9K 1GK8A 4TYAA 2N4CA 3AQOA 3HKWA 3MD1A 5CYMA 4WXWA 1G3OA 4LF4F 4P72A 4A3KC 3BBFA 3LGMA 2J6SA 2E5GA 4KTQA 4YFKA 1SQFA 2IM0A 3GIMA 3EVWA 4MIAA 2V6UA 2DY1A 5BYRA 3IRXA 3TI0A 4KBIA 3DOMA 5KT4A 5KFCA 1BWEA 4ZLJA 4UQTA 3PW5A 7AT1B 4ES3A 2C22A 1RAGB 5IORA 2HQGA 1RKIA 3DRSA 5ETVA 4WP8A 3A8EA 3TQ1A 2ZD1B 2HHTA 3KK3B 2IM3A 3POTA 3RZAA 3C19A 4DU8A 2M8HA 1L3SA 2LEPA 3J7A1 4PKDB 3MMCA 4X4RA 3M8QB 3GEHA 5F0WA 2HRTA 2E66A 4DCJB 3AOAA 2ZDOA 3GJRB 1UVNA 2MZ1A 3MD3A 3SCLE 2OPSA 2Y9HA 2KFZA 4I64A 3MECA 1BXNA 1XNQF 4NRTA 3AB2B 2RS2A 2CXEA 4Q0BA 1KHWA 3M8SA 4RW7A 1RU0A 2WAQL 2V8VA 4Q2MA 5E7OB 2XM3A 3KJFB 2XMWA 4K0KF 5E41A 1HQEB 1IKYB 4H4KA 3A3NB 2CQPA 1G4CA 2E1PA 2XZTB 3PYGA 5GADU 4OHYA 2A6MA 4LF2A 2AJ0A 3Q0AA 4QWDA 1P1TA 1XNRJ 3IM8A 5BJRA 1Q7YT 1LWFA 3D4JA 5GAGU 2MQQA 1YCLA 2BE2B 1P27B 3S1MC 5A76A 1TL7B 2WOMA 2GFFA 4O44A 3BGUA 1YRXA 3C3LA 3R7SB 2MZQA 4RUAA 1U6ZA 3VCDA 3EGZA 4JP8A 1VC5A 4M5HA 5CYQB 4RKUC 1WKKA 5HANA 2B6AB 3KG0A 2ZH2A 2YWHA 5K5MA 3M8RA 3NS7B 3S1RK 2H48B 2E44A 4B3SJ 4OHXA 5F9LA 2V68A 1UPPA 4TQSA 1U1RA 1RWMB 1ULRA 3DLGA 1DCOA 2EXUA 1TWGK 4Y7NK 4A93K 2K2PA 3E3XA 2KJVA 2R93K 4LF4J 1DLOA 4KASA 3QQCD 1MU2B 5A8RB 3SXLA 2BE5A 4L75A 2N82B 3SI8A 4CO4A 1K73T 2FC9A 1SUQB 3D66A 3B82A 1NK4A 2EPIA 3OLAA 4I6YA 2QA4S 2CUYA 1NSAA 4HHJA 2YKPA 3LAKA 1NK9A 2H4YB 4TKTA 2CVEA 3J80Y 2ZUEA 4H54A 2UP1A 3ONQA 3ZO7A 2DO0A 2IYGA 2RUGA 2EW9A 5A6PA 4EWTA 4I2QA 3W61A 3KNGA 2OSQA 1UZHA 3DRPA 2G0IA 1WHYA 2A10A 1VJWA 2CQDA 3M8WA 1CJUB 1S1WB 1XNQJ 5IFMA 3MUTP 2XGQA 4R8UA 5D8HB 2LDIA 3UD3P 5J1EA 4YP3A 5CD4H 3UI3A 1RT5A 2QL5B 5J2QB 2KT2A 2O1PA 3IA0A 4K0KJ 4OFZA 4K2XA 2IIHA 4C3IK 3BGLA 2MTLA 3DLEB 2XZWA 1YK9A 5RUBA 2DEIA 3OUYA 1O29A 4CM2A 2BM1A 3HOXK 4KARA 4PEOA 1H74A 3SZZA 3CIMA 3KOAA 1SJ1A 3S15C 1QDUB 4QIGA 2ZUAA 3NGDA 4EUVA 3O1LA 3EGNA 4AXJA 4C2MA 2KFYA 4I0WA 3IS9B 1F9FA 3RZOK 2AYGA 3WDOA 2ZH4A 5HQ8A 3C14B 1WHXA 3I96A 5KFSA 3WZ0A 3HPOA 4J9PA 4PUOA 3CJKA 1EQ0A 4PPDA 2C2ZB 3DC2A 1NKEA 4NCAA 2NVTK 2NXJA 3EE3A 1U1NA 3RZDC 3BGFA 1F9NA 2C2KB 1FKPB 2VG5B 2NREA 3Q3QA 1DY3A 3S2DC 1U0HB 4V19X 1SQGA 3I6PA 2AT1B 3FUYA 2OEKA 4Q4ZA 1SXLA 2D3OR 1G6BA 1S1UA 2A2DA 3K7AC 4C3KA 4RX6A 2VG7A 1B99A 4F4XA 4FM9A 2X1FA 2KI2A 1QVGR 5D3GB 1FESA 2YNGB 2KT5A 2L9DA 5KFQA 2V4RA 1CPZA 2JVOA 1U02A 2FHJA 4YB6A 2CDQA 3TYTA 2MLXA 3TX8A 2DGOA 1TVRB 2R9LA 5IP9K 3CO9A 2CQ3A 5GADI 4KRWA 4JV5F 2QG9B 2EI5A 4WTOB 2UUWA 2GSUA 2GSOA 4XAKA 3PG9A 5DLFA 3H40A 1J6WA 3BM7A 3BGRB 4GKKF 2CPEA 1VQYA 2C3YA 2JVRA 2HQDA 2GJIA 3A8IA 3DI6A 1J98A 4C2MK 1AUSL 1LWCB 3PJWA 2VDHA 2F65A 2JA6K 1M5KC 4QPTA 4OI2A 1KQGB 2ZOGA 2VUMA 3CJSA 4AL7A 4ZLLA 3P5BP 2HQFA 1YKWA 4IG3A 5M3FK 4C97A 3G6VA 1HI1A 1UFKA 1YSJA 4MKBA 2U1AA 1FFWB 3GG1A 4LF6F 4J91A 5HL8A 5CA5A 1NCLA 1B64A 2LXIA 3TEHB 4GT9A 4PXEA 1KQKA 1HR0F 4TY8A 4JBCA 1YI2S 2E5HA 3BPDA 3I32A 4F04B 1EZZB 1NJXA 3QX3A 4LF9F 2N7YA 4M63A 2EC0A 3S14K 4RW9B 3W64A 2C2EA 2LXFA 2WVEA 1AYEA 4C7QA 2B7CB 1VQPS 2HS4A 2VG6A 3W2VA 2AX0A 1Y1VC 3M2UB 5DM6Q 1Y3KA 3VALA 1ZS6A 1YGYA 2DRDA 2QTWA 4LOWA 3T1AA 1RTHB 3CJ3A 4ED4A 2XNQA 4DCPB 3BQ2A 2IAJA 2NZCA 1Y10A 1NH8A 2YY3A 1D3WA 2BKNA 2XSFA 3IBFB 2YXLA 1FK9A 4RO0A 2H5IB 4C45A 3PXGa 1UTAA 4LSZB 4ILRA 5D0EA 3KMQA 3CJ0A 3KG1A 3OL8A 1U47A 3FKIC 1XMQF 1TR0A 3NP5A 4RW4A 1XIQA 2GMJA 3FOEA 5A6WA 2H54B 3TTGA 4IFYA 2AGPA 3QGIA 4KHMA 3QT8A 1QSLA 4EU0A 2XMMA 4LRAA 2RH6A 5KOWA 4FYDA 3CCTA 1FDDA 4NA2A 2EVZA 4WFZA 1JK9B 1O8BA 4LQ3A 2AJ2A 4KO0A 4M5KA 2GMHA 4JV5J 5D0HA 3V4MA 1WC4A 2YQ1A 3DLLQ 3LP1A 4NLOA 2OIHA 3M1VA 2ZH6A 4ED7A 2NYHA 4NLWA 1CS4A 2VBYA 5CABA 4A47A 4R0JA 4OIRA 4GKKJ 5I4MA 3J7Z5 2R4FA 4USJC 1ZOTA 4N47A 4QR2A 2A3JA 1KVJA 1WWHA 3RU0A 2JEFA 2XNRA 5GVQA 2VC1A 1FT8A 2RE1A 4IR1A 5E0OA 1U25A 1TKTA 3PO2K 1K8AT 3KWMA 5IWAF 4HTJA 3W9HA 2PC6A 3AD7C 4B3RF 1RK8A 3A4TA 1X9SA 2OPPB 4LF6J 4NWBA 1RACB 3P5TL 1AUDA 4IO1A 3MMJA 2YX1A 3KDNA 4A3DC 5IT0A 2RRBA 2BABA 2PA8D 1HR0J 4J9NA 1RU1A 4G65A 3HF5A 3C15B 4DI6A 3I55S 2ZEJA 1WC6A 2QE5A 2KTQA 1F9EB 2XO6A 1X4AA 3GTYX 2EFNA 4LF9J 3BSAA 3IAS9 1B4BA 2R7SA 5I42A 4EYHB 1JKHB 4GTAA 2UVUA 3L09A 2FY8A 4BWJA 3DDKA 2BJ1A 4BCAA 3I56S 4OHVA 4FYWB 2E9TA 2FJWA 1KN6A 1UWBB 1GH8A 3MM7B 2GW8A 2V8GA 1NAQA 2D7SA 4BXXC 1UEUA 1HARA 1X31C 1I51B 3AOCA 5CYMB 3G71S 2R92K 4J9UE 2QLWA 2G13A 2QA4G 1Q78A 3DHXA 1UPMB 4EGLA 3NUHA 4FZVA 3UN2A 3LWLA 5D0RA 4KMHA 3CGIA 2F5GA 1WQGA 3R2CJ 1XMQJ 4N77A 1REGX 3IRXB 3DOMB 1O2FB 4RWXA 1HWJA 1RAHB 3T5LA 2VOPA 4NYPA 3V6DA 2RU3A 2B8QA 1KHVA 4NEZA 3DRSB 1G51A 1TUVA 1AA1B 1XERA 3H2LA 5DDQC 5E3CA 5T41A 3POTB 4GVBA 4ILMA 2COLA 2MYFA 3KJNB 4JOUA 3D6MB 5THWA 1RHJB 4JI3F 1VRUA 2IFXA 1AROP 2LDYA 1G2EA 1MNEA 3MMCB 4RBTA 3CD0A 1WEZA 2HLUA 1VIXA 4MAKA 3VGVA 3SQOP 1Q7LB 2XLKA 2OPSB 4LRBA 1TV6A 1S4EA 3MECB 3HD2A 3MEGA 2W7VA 1U4BA 2ROEA 4OV1A 1VBYA 4Q0BB 4XSZA 3BH6B 2V9KA 1BUXA 2JFDA 2NCKL 1RLCL 5IYCC 3G6ES 4DPXA 3MAAA 2UVWA 4K4ZA 1M0SA 3AH5A 4RBVA 4ZK7M 4AXIA 3AXMA 3M05A 2DY9A 5IWAJ 3MF5A 1ZTTA 5HMZA 3T6BA 4B3RJ 3OVBA 2E1AA 1R8BA 2QLXA 1LWFB 2XLJA 3G82A 2E2JK 2BW2A 4HH0A 1RWXB 4Z7YA 2R7ZA 2AIRB 2CVIA 3K5LA 2IHR1 3FVYA 4KGZB 4TNOA 3SV3A 5K20B 1HQUA 5CHCB 2ZBQA 4LK0A 2DVIA 3OD2A 4P7TA 1WG1A 3MPVA 4WWSA 2PMHA 2WOMB 1MLAA 4DV2F 1WHWA 2VBWA 3OTOF 1K83A 4O44B 3KUHA 2FD2A 3RBZA 3E2EA 1MWYA 1LFPA 2PFDA 2DH7A 4KMUA 3PO3C 1MMNA 3K2YA 4JI6F 4QZVB 2XQCA 4CLKA 2HNZA 3CNQP 2ZZMA 3DYAB 1SJQA 3R7NB 5KFZA 2CJYB 3IAM9 4Y6IA 2E1RA 4M5JA 3DLGB 5K14A 3HX9A 3BV8A 4NYZA 2VJUA 2HW3A 1WI8A 2DHXA 4LK1A 1NHKL 1FA0A 1FVSA 2LFVA 1DLOB 3KNAA 3QAUA 1FRHA 4IRCA 3KLFA 1RADB 2XGPA 1ZM4A 2V94A 4A3MC 4KC6A 1RE1B 1FXDA 2D9PA 2DGXA 3M32A 5E68A 2YVSA 1TUWA 2XTJP 1K1QA 3HSJA 3DM2A 4KY3A 5KFXA 1EH1A 3HOZK 1GAOA 3VAKA 2FLPA 1QSSA 3W2WA 4YS2A 3FEXB 4J3NA 2NPFA 1RWUA 1LW2B 3MAQA 2UU9F 2J0WA 2DB1A 3W1YC 1G1XA 4LF1A 3UD4P 2DNKA 4JI3J 4A3IC 4I2QB 4ANCA 2CRLA 2RH3A 1X4BA 3TZXA 2D1CA 2QSFA 3DRPB 3FCVA 5KFFA 3UW1A 4B9TA 1DQAA 4P10A 5K8MA 3HVWA 1CEZA 3H3VD 5KFMA 1ROFA 2I0XA 2MB0B 1RT6A 2HBYB 2ZBPA 3VAJA 4DPOA 2VUMC 1GNKA 1ZZNA 2NYIA 1RT5B 1YWXA 2RD5C 1K83K 5C4JK 3QIPB 3X1LB 5E3PA 1N34F 3BBBA 4FXDA 3H4DA 4WP3A 3LWMA 3OUYB 1E6YA 3DNCA 4LF5F 1JXVA 3AOBA 3OHBA 4YFUA 2KVIA 1FJ7A 3EZOA 3ILJA 1V3SA 4ZMMA 2PA3A 2MJUA 2GX8A 4AFFA 4P73A 5B0AA 2W9AA 2WVCA 1VS3A 3D5MA 3KLIB 4TY9A 4MFBA 1RWNB 4U96A 1DCPA 2XULA 4Y2IA 1I94F 1EHWA 4ZN3A 3OFHA 4K4SA 1RT2A 3I4NK 1U26A 2MDAA 3W5XA 5F9NA 4DV2J 4PUOB 3OTOJ 3UN3A 3CJKB 1SI9A 2MKHA 1S97A 1J27A 1CSJA 2W7OA 4IOBA 4XO0A 1XXCA 3IM9A 4JI6J 5B0CA 2DGTA 4FPIA 4DLEA 5DZ7A 3T19A 1RT7A 2W2NP 3O6QA 2JEIA 3DDNA 2XYPB 3G87A 4UF4A 4LVOP 1FWLA 1S1UB 1PCAA 4MQ9A 2VFTA 3HFVA 5G0RA 5C4XK 1FJEB 2VF3A 3VWSA 1R27B 2GJFA 4DR6F 3HCXA 4LSLA 3OR1A 2YWFA 3SDEB 1LK7A 4HT7A 2V8HA 5C2GA 7FD1A 1WG5A 4G6VB 1VYAA 4ITSA 3LAJA 1I50A 1KC8T 2MXYA 3THPA 4Y28C 2R7TA 2A2CA 4XSXA 3Q8YA 4Y2CA 3Q89A 1KOHA 3LALA 1U1LA 2DNNA 2L48A 4DL6A 3KK2B 1RB0A 4LJZA 1V3ZA 3IR5B 4USMA 2UU9J 1AXQA 4X84A 2F9JA 3WX8A 3W8GA 3LP2A 3ZTPA 1HNVA 3OSNA 2KWAA 1SJRA 4JI4F 3BKTA 3MWBA 3NKYA 3S1TA 1RAJA 3OTCA 4I1TA 5HN0A 2MKCA 4K4XA 3MCOA 1QJHA 1YITS 4MJKA 3I4MK 4UZCA 3WODA 2GQCA 4PYDA 3KHHA 4NLYA 1AW0A 1JLEA 3HSGA 2CZVC 1FI4A 1HNWF 1P9YA 2NXUA 5GAHU 3GB0A 3NNAA 4PQUA 2KVQE 4IG3B 1Q8BA 2WHOA 3AT1B 4HL9A 1S0NA 3TARA 3HZEA 3JSTA 1N34J 2VFUA 4ELVA 4RUBA 3BO4A 4LF5J 2CNKB 3FJ2A 3U7JA 3LW5C 2VUGA 4MKYA 3MMBA 3HHNB 1R7IA 1S79A 1QTNB 4TY8B 2ATLA 2BACA 2B8PA 4NLPA 3UO0A 4ECYA 2VONA 5F8NA 4V1Ak 1YJTA 4W4MA 5KFPA 3WC0A 1MSWD 2I38A 2BQ3A 1I94J 1NSQA 3ZZTA 3KK1A 3Q8RB 2PGCA 4Y2KA 4HEA9 2FHMA 2ZM6F 2PI4A 1DURA 3BH7B 1BY9A 1N48A 4CO5A 3V6KA 4Q44A 2VG6B 4J9LA 3W2VB 1O24A 2XMKA 4ZVEA 1YRTA 1IE0A 2FUG9 4U95A 1NHUA 3BDEA 3UN5A 1K0VA 4Z2XA 2IAJB 1I6JA 3V81A 2MKSA 1M5SA 3BUEA 5M2PA 2MSTA 5F8JA 2DEJA 1FK9B 2AEFA 1RU2A 1WTBA 2JJ4D 2E2IK 4E2FB 2ZUGA 4ED5A 1GMUA 2ADCA 3Q8VA 4RUCA 2HFVA 4RW4B 4A46A 4IFYB 1WOOA 4A8MP 1U0SA 2DH8A 5C2CA 1S77D 2JA5K 2RHQB 1U1PA 1N5SA 3K5PA 3VZHA 3CVKA 3G9CA 1IQ0A 1NU4A 4F2RA 1HD0A 4D3GA 4OJ1A 4P2FA 4KO0B 5D0GA 2VOOA 3PFOA 1X0PA 3TJ8A 2OUGA 2KZMA 4FZBA 3LP1B 5J1NA 3M1VB 2RKIA 2YNFB 1KBRA 2LVWA 3GV7B 3PW7A 4JI4J 4ECVA 1CS4B 4JB8B 1VI7A 3MM8A 1QUPA 2GNKA 3QMQA 1UVLA 3MPDA 3IWNC 5HROA 4IH6A 1HD1A 1UWAA 4IO9Q 3LAMA 2XCOA 1IBKF 1SC6A 2F8MA 2BE7D 3R9LA 2ASJA 1VQKS 1RHQB 5EGHA 1NBEB 4B17A 1HNWJ 1WCMA 2P5MA 4LUBA 3S2HK 3QZ7A 2QMUB 2QX0A 1TKTB 1TWAA 3KHLA 2I5JA 1DBDA 5KFBA 3PIPQ 1D09B 3FZBA 5M5XK 1XWLA 2GVZA 4HHHA 4DSLA 1VQ7S 2XBPA 2R7ZC 4UUWA 3CCES 4IRDA 4I56A 4F4WA 4ZCIA 4USWA 4WYLA 2HIQA 3JTNA 3BZQA 2AEMA 4QBUA 5I42B 2JHEA 3UD5A 4ZVHA 3VQSA 3NGRA 2ZM6J 2EK6A 3CO0P 2RDJA 2VHGA 2BW7A 2M8DB 4QYRA 1RTIB 2YWGA 3I31A 2GV1A 1B70B 3N3YA 3P4UB 3HOUK 3GDZA 2YNIA 2W8KA 1FRXA 3GTJA 3B6BA 2ROPA 1UMJA 4NA1A 2QV6A 3ENVA 4H4MA 4OHWA 4KHRA 3M8ZA 3QFWA 4DQSA 5IXUA 3OSPA 2ZH9A 3GTOA 3T9NA 4UY85 2CQHA 3M3YC 3DRXA 4YUDA 2G2OA 2B63A 4ZP6A 1FJCA 3HXAA 3UDVA 3V6DB 5IS2A 5GAHI 4U7UD 4LREA 2FLOA 2ZZNA 5LXYA 4I6AA 3A3OB 4I68A 3HLUA 2VH7A 3HO1A 4J37A 2LA6A 1S0OA 1T05A 4GVBB 4WU2A 4WFYA 3CMAS 3NCRA 1Y7PA 1VRUB 3FOFA 3T1YF 2JA7K 5J2MB 4DDQA 1KQ4A 1BC6A 3SIPB 1ZA2B 1BLUA 2DBBA 3D68A 5GMKa 2J5AA 2ZBIA 4ID8A 3Q83A 4X4VA 1S7IA 2HFUA 1R9TA 3DGPB 1N32F 2E1CA 1TV6B 5I3UA 3MEGB 1U09A 3HT3A 2BOAA 5DETA 1IBKJ 4F2SA 4G1PA 3QAEA 2XLIA 2HVEA 2LQ9A 2W2MP 4Y52K 2N3LA 4NPOA 3EXYA 4ZVSB 2AZ1A 2A1BA 3GP9A 4JI1F 1Q79A 1SKUB 2WVFA 2B9EA 3QPIA 4XLPA 4OZ0A 3SCKE 3S16C 3NY0A 2G2ZA 1NK6A 3VHQA 3G82B 5DG7A 4Y7NC 4IOAQ 1SFOK 2YQ0A 2AQ4A 2J0QD 1FO1A 1KP6A 2ZH3A 1OS5A 1HQUB 3EZUA 1HFEL 3QYYA 3LPXA 3SSQA 4YB7A 2W8LA 3CAGA 2HKEA 2X1BA 3AQPA 3GTOK 3AJ2A 3JS9A 4WXOA 3QSYB 3NWRA 2JL9A 4CLZA 3O2IA 2XCAA 1DTTA 3N6LA 2QL9B 4ED3A 4TLRA 3RW7A 5KG7A 1FERA 4DG1A 4ZA1A 1X4GA 2RRNA 2HNZB 2NR0A 2UXDF 3EQLA 4DSKA 1C4CA 1SV5A 4J9QA 5B08A 3VGSA 3MR5A 2DPJA 1UJ6A 5ETQA 2ZJQQ 3OW2R 2ZHOA 4A3EC 5K14B 3PTWA 1UV7A 4NLQA 2XY5A 2O5IA 4MKAA 2VL1A 1PC5A 3LGHA 2NVYA 1SJ3P 1OQ6A 3KLFB 5LM7E 3MURP 4DUYF 1EIYB 3GFYA 1TK0A 2QLBB 1IKXA 1NK7A 2BDPA 3HMJG 3HVRA 1I50C 3M32B 2MGZA 1W2IA 3X3UA 3FSYA 1VBKA 4KMAA 4FNHA 5LMNF 3LGNA 2V8PA 4EZ6A 3W2WB 3D1HA 1NPPA 3EXCX 1ZM3A 4PWWA 2B56A 3DLJA 1ZYQA 4UQGA 2E29A 3G8SA 3T1YJ 3GTLA 4MK9A 2R3VA 4RUHA 4G7ZA 4OX7A 2RIJA 4QYZK 2HHVA 4DQQA 3H98A 4LIWA 3EUNA 4OQJA 5J2NA 2F3JA 2FVRA 2CPJA 2LA4A 2W9BB 1QVFR 1N32J 2Q1LA 4WFBQ 4DQIA 3L9ZA 1FNXH 2BV3A 3NMRA 2MLYA 1RT6B 4OI6A 1FVQA 1SJ4P 3THTA 1BQXA 1ZZFA 2CPYA 3JXOA 2F4FA 2DNRA 1WD6A 3T3FA 2RF2B 3VTIA 4ZVRB 4WP9A 2WONA 4NE9C 4MMOA 1SIZA 4L72B 1RTJA 3BSOA 3RGIA 3KG4A 3HJFA 3ZTQA 1ZAXA 4JI1J 1HW8A 3KLVA 2HMIA 2HHQA 1B3TA 1ZYRA 2BJ3A 2QRRA 4NCBA 3GLJA 4GKJF 3HDSA 2Z4PA 1TZ0A 1U1OA 4MFBB 3HK2A 1LXNA 5K8OA 1KFSA 2OELA 3V6HA 1RT2B 4C3JK 4F50A 1A0OB 2HNYB 2EFOA 1F2GA 2NVYK 3GIRA 4K7QA 2Z8QA 4A3JC 1QE1A 1RT4A 2QFIA 2CZ4A 4M1XA 1O2AA 1KVKA 2XC9A 4CLLA 4G0WA 1RT7B 4MYTA 2UXDJ 2H65B 1UJ5A 4AL6A 5DGBA 5J1PA 3CSKA 5HBMB 1JXLA 2VBXA 4TLQA 1RAIB 3JB9k 1VQ9S 3PHEA 3DOLA 5G0RB 5DJBA 1JLAA 2JLEA 4LLGA 2BKPA 4LSLB 1XBWA 2RNEA 3HOVK 1TKXA 4OZNA 1WKJA 7FDRA 1KQSR 4KV8A 2C3OA 1RA6A 2JA6C 4B9SA 2LXUA 4DUYJ 4WPAA 3GTKK 4Q8EA 5D4LA 1RLDA 1U2FA 5IC4B 1CJKA 2K8GA 1K1SA 2WAQD 5LMNJ 2RQCA 5D4NA 2ZZTA 3TO8A 3VZIA 1RAEB 1IBLF 1NKBA 4K4UA 4MTPA 2LQ5A 2KXNB 1FRJA 3LP2B 1HNVB 3Q2TC 4FP9A 2UVVA 2DD8S 2X51A 3J7YU 2FJEB 2HRYA 2X1GA 1N36F 4FF2A 4DN9A 2M52A 3GZ7A 1PYSB 3QO9A 3CT9A 1VK8A 2ZFHA 4KGKA 2KXFA 3GFZA 4BY1K 2CNNB 1JLEB 1Z2ZA 2CQ0A 4PR6A 1S1TA 4ATNA 1HWIA 1I3QA 5KAKA 4NZ0A 5AXKA 3J80U 4RW6A 2OLWA 4PQUB 2XCQA 3N6MA 1WCMC 4GC7A 1WSRA 3O8WA 3G6YA 1UVIA 2JLFA 4BY7C 2C3UA 1MW7A 4D3HA 4BDPA 1TWAC 1IUJA 4PXBA 4OI4A 3PFEA 2C2RA 3RAXA 2QMXA 5M5YK 4JYAF 3HHEA 2DXDA 3MMBB 2MKIA 3DXJA 2D41A 5L1KA 4GKJJ 1CG2A 3QJJA 2G0JA 1X4FA 2XO7A 2PMZL 3EM1A 1CC8A 2FVSA 2V4JA 1NNDA 3TA0A 2JDJA 3OV7A 4TU8A 3J7AN 4QW9A 3ZZUA 3KK1B 5FJ4A 4A3FC 1BD6A 1J5OA 1ZPWX 2CQ4A 3OHAA 2CJXB 4DV4F 3CJ2A 4PPZA 1PBAA 3GIJA 3QT5A 4BBSK 2GIQA 4R5PA 4A8FA 1O5JA 4NZ7A 4XLNA 4LBHA 3R1HA 1EAYC 4NL5A 4OYOA 4XTTA 2PPBA 1Q8KA 4Y34A 3CIZA 1S1XA 2O5JA 2HK2A 4WJBA 5H1SV 4QIWD 5IT4A 3CD7A 4A8WA 3R97A 1OY8A 2IMWP 2ADBA 1GMVA 1S1VA 4YOEA 4U67Q 2B63C 4ZPVR 3U1LA 4QOTA 4DS5A 1WF0A 1HNZF 4LVNP 1U2RA 2YTCA 5DQGA 4ZN1A 1UKUA 4YFNA 4N56A 5IP7K 4CQ1A 4E98A 4L76A 1I3QK 5D78A 2RSQA 4C3MA 1RYRA 1O2BA 5KT6A 1UETA 2H5EA 3EJMA 2GZOA 5I3QA 2FB0A 2QJ3A 2OP5A 1BGWA 1IBLJ 1JNZB 3CQZK 2LQ8A 4ZVGA 2AF6A 4LSNA 2RKIB 5K9FA 3VAIA 5EUHA 4CZCA 4I7FA 3E01A 2CJ9A 2HWIA 2R7WA 1Z2LA 1R9TC 3MM6A 2AGQA 1N36J 3MM8B 3N5BA 3M6VA 4KSEB 1Y00A 2R8KA 4C0HA 5T7LA 2QGFB 1WELA 4A3KK 1NM2A 3T9ZA 4OYXA 2IJRA 1SBRA 2ALZA 3P8BB 1RGVA 5KOXA 4CO0A 3QGGA 2PEBA 2DXFA 4F4ZA 5TMCA 4ZPAA 2RAQA 1WACA 1FRLA 2I5JB 2YPZA 3N0VA 4OI0A 3W3SA 4ZIWA 4UT4A 4X6AC 4JYAJ 2CZ9A 4GO7X 2R92C 2GVZB 3UDCA 3CEDA 4F4AA 3TAMA 2R7QA 1K47A 3KMSA 3R7BB 1XMOF 3OVAA 3BKUA 3RB6A 4FF3A 2SXLA 1HNXF 1U8SA 2HHHF 4F3QA 1S6PA 4OI3A 3ZTRA 1C0UA 2C2MB 1N5YA 3DLBA 2CA9A 5CYJA 4Q45A 2W24A 3CCLS 4X65F 2NUUG 2ZHBA 3U02A 4DSFA 2OPRB 4O4GA 2EWHA 1XZQA 2YNIB 1S6QA 2D74B 3CDEA 2F4VF 1FRMA 1Z4UA 4DL0C 3J7YI 4YR2A 4H4MB 4DL5A 3JSRA 5EX3A 1IWGA 4EK2A 1XPPA 4YHHF 3HM9A 2C3MA 4CH0S 3GCXP 1U1KA 2AMCB 6FD1A 2RRAA 3TUJC 4LMZA 2E5LF 2KG1A 2R2UA 1EI6A 5LJ3Y 3S1MK 4XIUA 4DX8H 4BC9A 1RTZA 1WKLA 1HNZJ 3HKZD 2HVDA 4LRCA 3TZYA 3DKDA 4S0MA 4JI2F 1ZA1B 4A8SA 3FRYA 2V2ZA 1U2CA 4KIAA 3MUVP 5B7WA 3GCWP 2W4PA 1T05B 3OLBA 4A3GC 1IBCB 3NCPA 3MEKA 1OYDA 3GTLC 4RNNA 4QU7A 1YTYA 1WEXA 3RTVA 2PHCB 3L3CA 3D6FB 3MEDA 1IKWA 4C8LA 3TFIA 3TZZA 2EG1A 1CULA 1WF1A 1GTHA 5E3RA 4HLBA 1VC0A 3CJ4A 3KJVA 5AE1A 3B78A 1HKAA 4A8XA 4GMKA 1I6HC 3TA2A 3R6LB 5AXLA 4X4PA 4BHQA 4DF4A 1VJEA 2UUAF 4EZ9A 4PXDA 3SQGA 1S6OA 1JMTA 1KOOA 2FJBB 3ERED 1T3NA 4FBTA 3C2PA 4YDDB 2ZNZA 4MIBA 1FKAF 1L0WA 2OGUA 4QWEA 5A0YA 3GSIA 3KKFA 2YKNA 2FIUA 4ZP9A 3CPWR 3DDIA 4KPYA 1C2PA 1XMOJ 3GWCA 5D15A 5FLXY 1T9TA 1OPZA 1RAOA 1HNXJ 1VBXA 2EFVA 3RG6A 2HHHJ 3ADAC 2ZWPA 3AA8A 1KTVA 1KD1T 3SFUA 1SB6A 1SJFA 1DTTB 2UVRA 1YG0A 3NAIA 3HOZC 4DG1B 1OY6A 4DZDA 4X65J 1UFWA 5AXNA 2H1YA 4XDDA 2ZVIA 3OFFA 2C2DA 4O3RA 2VASA 1SV5B 2V34A 1EKRA 1J6XA 2ZH7A 2HFOA 2MQPA 2M7SA 2CDRB 1U8WA 2PN6A 3ZTOA 1JLGA 2F4VJ 5H9EJ 4KC5A 5CZVA 4ENOA 2PA8L 5CQGA 2DR7A 2W1BA 1KLNA 3SSRA 1FRKA 4YHHJ 3HHLC 4DX5A 1EQMA 5CJ9A 1IKXB 4OYIA 1XJWB 1TL4A 1MROA 3FBCA 2MGZB 3G4CA 5AJ3F 3EICA 3FBBA 1E6VA 3VAGA 2JRSA 4JI2J 3OTDA 4RMFA 1H72C 4HT5A 1C0TB 1ZVUA 2NVXC 1YRUA 1WHVA 1KLMA 1M1HA 4DDFA 2BA9A 5FIIA 2PI5A 3NAHA 1XQIA 2EBEA 4I67A 1R31A 4U7UK 3S2DK 1S9EA 5J2NB 4J9RA 4QU6A 1V5IB 3GSDA 3MM5A 2OFHX 3HFZB 1XK8A 3GR0A 3K7AK 4USHA 5C24A 5F8MA 4NZ6A 2ZOFA 1V3RA 2KKHA 3WX4A 2HQ3A 4JI7F 1RQ0A 2KRRA 2DISA 3JSYA 3KLHA 2WONB 2CW0A 4B9NA 1RTJB 1S59A 1T11A 2PO4A 5C42A 5IOLA 2V69A 5HSPA 1JXEA 3ZNUA 4C8MA 1XC9A 2YKOA 2HMIB 4ZIVA 3CCUS 2P9CA 5LMUJ 5JMNA 3GTMC 3C46A 4BKWA 3FFIA 4Y3CA 3UFCX 3ZC4A 1CVJA 5EWEA 3W5YA 2J7KA 4L3NA 4WJ3M 4ZVQB 3B4DA 4DN0A 1RWKB 3K57A 3FKIA 3TOQA 1XZPA 2KM8C 1JB0C 1GT8A 2DIVA 1B4SA 1FHTA 3Q8UA 4K50A 5KFHA 1QE1B 1RT4B 2FQQB 1VIOA 1VDHA 1BMQB 3EWGA 4OIQA 5HQMA 5HK4A 4DF8A 4NMLA 4ECQA 1Y4ZB 4C9DA 5HVFA 4UOGA 4K8RA 3TJAA 3CB4A 2JLGA 5J2PA 3BREA 2AYEA 2W2PP 4WIQA 1UEKA 4KYZA 4IG0A 3DOLB 2JZ5A 1J5EF 4ANDA 1H38A 4H4OA 1JLAB 3PKMA 4CNZA 4U6PA 3I5AA 4I2PA 4ETZA 1TKXB 3IC1A 1T3OA 4CIOA 5A8WA 5IOSA 2MZRA 3QT7A 4KV8B 5BYQA 3IG1A 4N8OA 3LP0A 3PRDA 2CNLB 1NEEA 4URGA 4ILDA 3D67A 2M3DA 1BJTA 4M94A 4NA3A 4A3BC 1JLCA 3PR4A 3W66A 1CJKB 5AJ3J 3AJDA 2XI2A 2AHOB 4YMEA 2ZH8A 3ZZRA 3N79A 2DYAA 5C3EC 2CQBA 3BEGB 4DU7A 1N4LA 5E2QA 1HNIA 4OZLA 1Y1VK 2F8EX 4AQYF 1H7XA 2UXCF 2DHGA 3FQLA 2M9KA 5KFYA 2Q66A 4LR9A 2UUBJ 2FHOB 4DEZA 2WRMA 3LQVA 3NL0A 4DX6A 3GIKA 4C8ZA 3QO9B 4OYBA 4HHUA 4RNFA 2DNMA 2MMYA 2ZC4A 4GC6A 1S1TB 4NLUA 3BP3A 5KFVA 2B0GA 4RW6B 1ZTWA 2CWKA 4JI7J 1P6TA 2H9ZA 3PX6A 1S57A 3MOJB 1IKVA 4HI1A 2R8GA 2E5JA 1YNNA 4WJ4A 3P6YC 1N6QA 4DV6F 4DR2F 1F5BA 4LR7A 1PO6A 4RZRA 2DKOB 3DMJA 5LXRA 2E2IC 1D9DA 1NJYA 1F7VA 2V4JB 2EEYA 2Z2YB 2DR5A 5B09A 1J5OB 1FD2A 4AH6A 3BO2A 2JA5C 1RWWB 3QIDA 3K59A 3UQSA 4A4JA 3JSBA 2QSWA 4R5PB 5KFUA 3ILOA 4IQMA 4A3LC 2MKJA 2YX7A 1T95A 2YH0A 2PE8A 5M3MK 2CQGA 4DV3F 1S1XB 4KB4A 2IRYA 3GE9A 2IA6A 1YIJS 3T00A 4PCQA 1J5EJ 1N8RT 1Y1WA 1L3UA 1X5SA 2B4VA 5ETLA 3UDLA 4LF7F 4B3TF 2A6OA 1TWCC 3S7RA 5D4DA 2JWNA 3GTGA 1YBTA 1VH2A 3GTPA 2HS0A 2DNYA 1NKCA 1C4AA 2J9DA 2I2YA 4GTBA 5HAOA 2GA7A 1Q95G 1UP1A 3HULA 2VKRA 3R5CA 1FDNA 4NMXA 5KG4A 1IM4A 2M5YA 2W2OP 2IJFA 4MEXA 2E7VA 1KR4A 3UDEA 3KLEA 4YDXA 4C8KA 4AQYJ 4LSNB 1S7HA 3BR8A 2UXCJ 1JJ4A 3R3TA 1UCNA 4I7FB 4K2JA 3H90A 3E01B 2VA2A 4BXXK 3L7UA 3MM6B 4ZPDA 4JI5F 3OL9A 5T7LB 3V4IB 2YH1A 3EVOA 4AT1B 2X7IA 1YJ9S 4EBCA 3FMBA 1O28A 1LW0A 4WTYA 2RMLA 4CLFA 3E8OA 1DZ5A 1Q8LA 3BP8C 3KTQA 2N4DA 1F3FA 3ISNC 1REVA 4DR5F 2QIFA 5K8PA 4DV6J 2WVDA 4DR2J 1F6TA 3PCOB 2A6EA 2Y8YA 2O01C 2QYGA 4CYUA 2KYXA 4ELUA 3NGTA 2DJWA 2DNPA 3M8PB 3BN4A 1LNQA 2E7XA 2ALYB 4P5AA 4OIXA 4FYXB 4C3HC 2CAJA 5DLGA 4JV1A 1S6PB 3TANA 3RBEA 1C0UB 1N5YB 2V2VA 1R43A 2VC0A 1B4AA 4M5IA 4QYZJ 1VQ4S 4C6AA 1PILA 2Y0SD 5IYCK 4W98A 1X5TA 1USOA 4O4GB 1XZQB 1N5QA 1S6QB 1BQNA 4O3OA 2JA7C 4GO5X 3D1OA 5M2UA 1U48A 1NDPA 4DV3J 4ERDA 2LEAA 2HHPA 4EFAC 1UW9A 3A8KA 4NOIA 2HZAA 2MY8A 2J9CA 4ECUA 3CCVS 2YBVA 5F3TA 2N7CA 4LF7J 2HAFA 4B3TJ 4WCEQ 2E5IA 1TWFA 5KG0A 3U27A 4X4OA 4LBPA 3GYGA 1MU2A 3D3CJ 2HQCA 4BBRK 2E7WA 3UVJB 4LR8A 4CLTA 3RRKA 2G2YA 2KHCA 3DCAA 2ZWOA 4IH5A 4C0BA 2BJEA 2C1EB 2HS3A 2R2RA 5U47A 4M5LA 4I69A 2ZBCA 4DFKA 1YNJA 3OL6A 1FFSB 3MEEB 4P2MA 2VU5A 3QJPA 4QR0A 3QWUA 3ZZPA 4K4VA 3HHDA 3VQTA 3UCZP 1RISA 4GTEA 5IYDK 1IKWB 2DK2A 4A3CK 3DHWC 1QD1A 3KJVB 4JI5J 2CJQA 3PO4A 1WC5A 1XR5A 2FTRA 1O26A 2WBMA 1D1UA 3KDOA 1G7CB 1MN7A 1ZM9A 2F9DA 2XSJA 1OSDA 1ZAVA 2XMAA 5H9FK 1H2VZ 3SQGB 4ED6A 4QIFA 2IA0A 3VV2B 2YWKA 4AE5A 5FJ8K 2HWHA 1J6VA 4ZPWR 3TRGA 3RBXA 1HBUA 4DR5J 5A0YB 4PAAA 2ZUFA 5E33A 2YKNB 1DCHA 3Q8QB 4IOCQ 3NOCA 4A3IK 1V5VA 4KFBA 3D1QA 1S0MA 1NDKA 3CCZA 2KN4A 4WE1A 4KJIA 2W9CA 1RKJA 3HSDA 2MEWA 2Y1RI 3C14A 3M2RA 4CDIA 1JLBA 4X62F 2F40A 3EDQB 2R2SA 3SCJE 3NGSA 2VUMK 4OZ1A 1HMVA 1Q81T 2HURA 2L9WA 1VRTB 2ACYA 1NJIT 2K06A 2NPIA 2R8IA 1IR2A 1RSCA 1EP4A 4BBYA 3GMGA 1MN9A 2GQ2A 1NDLA 1SL2A 1WSVA 4CNYA 3TP2A 3N01A 3CW2C 4KH1B 1O6XA 4G1QB 2IC3A 2DGQA 3CCSS 2Z2MA 3PX4A 1NXIA 3TR5A 1LQ9A 3W60A 3I87A 3S1NC 1D0EA 1B0TA 2GGPB 2W25A 1T8EA 3AH6A 1TMMA 2F8HA 3FMWA 4YY3F 2LKZA 3SFGA 2DITA 1T0TV 2E1MC 2CQ1A 1E6VB 5JXSA 2MLZA 1O25A 1LK5A 1U1QA 3AY0A 5M5WK 3SZYA 4OIOA 1KEKA 1TVRA 1BHNA 4X64F 1KLMB 2YKQA 2J9EA 1IL2A 3T01A 3VGTA 1JQWA 1RABB 3JYTA 1HHTP 1S9EB 4NX9A 2HIYA 3TEGA 1INNA 3MMAB 1Q86T 1N0VC 3MXHP 1WF2A 5C24B 3M8YA 2WB1D 5KFIA 1R8AA 1UVJA 2MZSA 4U7CA 3UE2A 1YJUA 1X4EA 3LH2S 5B0GA 1R6VA 2J7UA 3KLHB 1BGXT 3AB4B 4WFXA 3RB0A 3TUPA 1BWVA 5C42B 2XWXA 4BLBA 2RUSA 3IXQA 2FQOA 3MCNA 2LMIA 5CAAA 3QZ8A 1D8YA 3OREA 2X3DA 4L3KA 1HBNA 4FS2A 3AHPA 2K7KA 4CWBA 3FFIB 4G3IA 3HOVC 3GFXA 4X66F 3MDFA 5BXIA 3LOUA 3BS9A 4RW8A 4Y2MA 4F4KA 4P9SA 1XZPB 2V9WA 1HBOA 3GTKC 3H8YA 2FDNA 2GVDA 4Z7CA 4P2SA 2HBZB 1S9FA 2IY5B 1DAXA 3O3LA 1BS2A 2PEHA 4X62J 4MT1A 2XEXA 2E2HC 2PD1A 3VVTA 1N0UA 3PJXA 2HWTA 4ES1A 2WSEC 3FNNA 1V6HA 1DQ9A 1UJ4A 1ZBSA 1YLXA 4KHPF 4URQU 2GHVC 5L1LA 5DG8A 1Q16B 2RQMA 3JAMY 4IG0B 4ZLNA 2NXCA 1X5OA 1SL0A 3R5JB 2KRBA 1Y1WC 1VLOA 4F8RA 3FSXA 3D3BJ 2J6UA 3PZPA 5A8WB 2NVQC 2AX1A 3FEZA 4TQRA 3SCIE 1JJ2R 3IG1B 3GTGC 3LP0B 1GXTA 3EGWB 3GTPC 3H2VE 4RW7B 2CKWA 3M30A 4NLTA 4YY3J 1JLCB 2UXBF 3M4OC 1TELA 3TX0A 2YPYA 3PRBA 2BR0A 2Q3PA 4KM8A 2IBKA 2DNGA 1KSPA 2DRAA 1X9WA 3K89A 1HNIB 4X64J 2YU9A 1OY9A 3GJTB 1Y3JA 2Z0GA 1O0PA 5E3AA 4DX7A 1YHQS 2EFPA 1T9UA 4R0EA 3DRYA 4QR1A 4OJGA 1FJGF 3SYZA 4XK8C 3F73A 1APSA 2IVMA 3W5ZA 5KG5A 1S12A 4WU3A 2VJVA 5IYBC 3QBCA 2P8IA 4F7VA 4USTA 2HPUA 2B4PA 5C25A 4F4YA 4B9VA 3HHKA 5EGEA 1N5VA 4BBSC 2AJ4A 2HAIA 2BRKA 1IKVB 4EYIB 2JA8K 2Z2LA 4B9LA 1XTZA 1NK5A 4N5SA 1YBUA 4NEYA 1N6QB 2VDIA 2MY7A 3D7SB 4MIWA 3FSIA 1YJNS 2B4UA 3A1YG 4KAWX 3DMJB 3H42A 1QAJA 2QMWA 3M4XA 3TUIC 1BDFA 1LKZA 2NZ4A 4ES2A 1DJ0A 2A68A 4X66J 3D0GE 2JEGA 2KU7A 3G2XA 1VBZA 3C15A 1RT1A 1NK8A 4A48A 1LEOA 4OZ2A 3KHRA 2MQNA 4FXWA 3MR6A 1M90T 3BSNA 3CD5A 3IR7B 5CCLA 2VD3A 2RDDA 1T9XA 1D9AA 2FJDB 4O3NA 3OXGA 5DDOC 1S99A 3CQZC 2B9XA 1GQEA 1R89A 4KHPJ 2ZOMA 2RJZA 1UWBA 2KL8A 3MM7A 1UAWA 3KUEA 3Q86A 3QNWB 4ZVTB 2ZKUA 5HI7A 2CFXA 1EETA 3FHZA 3OJUA 4K4YA 2G1DA 2ZFZA 1QSYA 2R7ZK 4KM9A 4R8UB 1M1GA 5HVHA 1TWFC 2QC3A 4TU7A 4CLWA 2CNOB 2PSZA 4IKAA 5J1EB 4MEYA 1PYOB 3A3PB 5IOQA 3IGVA 2XHCA 2UXBJ 4FS1A 2HHWA 4P71A 2BVZA 2NQPA 2MSSA 4OMFG 3HXMA 1EK8A 1CLFA 2CJKA 5DQHA 5C44C 3HHLD 3KLEB 2VFSA 1CC7A 3QSIA 3DLHA 5B0DA 1NUEA 4Q8FA 2Y3PA 1FEEA 1HHSA 3W65A 1TWGA 2MKKA 4DOZA 2V2KA 2FVPA 3MOZA 2R93A 1YJVA 2DHHA 1FJGJ 1Q8IA 4ZCKA 2MZTA 4J5OA 3R1LA 3HOWC 4K5SA 4BLAA 1FNOA 3GJQB 1Y11A 5DGAA 3GTQC 3O44A 4DQRA 1SVDA 1H7WA 3EDRB 3NXZA 5E5NA 1VCTA 3SMZA 1HW9A 3M3YK 4DL4A 1LW0B 3UR0A 2KHDA 2POKA 1F2HA 3FDSA 3HSZA 4FN5A 1WIHA 4YG2A 1REVB 4L74A 2M88A 3ELHA 1HI0P 4CO2A 1K0TA 2Y3YA 3K8VA 4CYUB 1H98A 3JTPA 1F0XA 3BGOP 1YJ7A 2VG7B 2IM1A 4CLUA 4KDDA 3RR8A 4C11A 4ZHRA 1RHUB 5FLMC 2CPIA 5DZ6A 2HHXA 3MPYA 1RBLA 2KH9A 2Z2ZA 2CADA 5KFJA 2ZE2A 3NS5A 1WDTA 4NRUA 1M5VC 4ZDNA 4RR5A 1PAUB 1BQNB 1EJ7L 2KDOA 2FY1A 3C16A 4AD6A 4OL8A 3DYAA 4G7HA 4RPFA 3DFEA 2EBBA 1Y5LB 1FF2A 2WSFC 4QJVA 4G0UA 3S16K 4X4QA 1YJWS 3S1QC 2GSNA 5ETTA 3DI6B 1OJ4A 3RRGA 2OD4A 4NXNF 3WIUA 4OJ3A 3RAQA 4O0IA 3EGVA 5C5JA 1NHVA 1EFWA 5B0FA 1F5AA 3L7PA 2CPDA 3DXBA 1FXLA 1TMJA 2EKNA 4RBUA 2D3UA 4C4WA 1AB8A 2ILZA 1SC1B 3R5BA 4HYKA 3KLGA 3TWZA 4QIWL 5A2QY 2UV8G 1LW2A 4DV7F 4ER8A 4Q7AA 2BX6A 2ASLA 3VGUA 1VQ5S 2B3TB 1TTHB 1RT3A 4UUXA 3ILIA 4ID5A 4A3EK 4HDGA 2PMZD 1T7PA 2RGRA 5D4OA 3AXKA 2GJ2A 5JVOA 1H2TZ 1HQMA 4ALZA 3IP0A 2XSJB 2OD6A 5L1JA 1QUVA 1I50K 1CJVA 2XWYA 1HWLA 1N52B 1NDCA 2LP4A 2BQUA 2RVJA 1R0BG 3T5KA 3QIPA 4DL3A 4QWAA 2V2QA 1JLFA 3DLKA 4DR4F 1IQZA 2NSCA 4JV0A 1HBUB 3I0RA 4LFAF 1OPIA 1KNZA 4IDKA 4KATA 4F36A 2M70A 8ATCB 3K8WA 3S17C 2GIFA 4LF8F 4DR6J 4KFBB 3GJSB 4DXLA 2VV5A 4CH7A 3I5BA 4LJMA 3MFHA 2VQFF 2BJ9A 3KLIA 4WE1B 2P9EA 5LSOA 1HPZA 5IT9U 2W9CB 3MI7X 2JA6A 1LWEA 2D9OA 5CCMA 2C2NA 4HACA 2M4MA 3M2RB 5JUMA 1JLBB 1DTQA 3PDNA 2W4DA 2XS7A 2MHNA 2DRBA 3ZTSA 3CD6S 4RU9A 2FVQA 4CO3A 1HMVB 1FEHA 1RUSA 4CCHA 5F8GA 4Q43A 1HHQA 5KFGA 3CC7S 1PGZA 1EP4B 2X1AA 1FWPA 4F0HA 1VHIA 5SUHA 3RRHA 2XMVA 3CDBA 2IC3B 2APOA 1D8ZA 5AT1B 4ZJOA 2XS5A 4ZVFA 3G8TA 5F0UA 3DOKA 4FDFA 4EMDA 1OMSA 4NXNJ 3SDEA 3FGVA 1L3TA 2IDLA 3F44A 2HQIA 3U1MA 3B54A 4PABA 3H0GC 4MKVA 3QFHA 1H2UX 3ETMA 2QLFB 1TWHC 1NO8A 4Y65A 1JNRB 2OTLS 4LRDA 2CQ2A 3EVMA 4DFJA 2ZJPQ 4A3JK 3CJRA 4USIA 1VLYA 1X7VA 2Q43A 1NB7A 2KZZA 3R2DJ 8AT1B 4KKOA 5JVGQ 1JQGA 3KK2A 2YU9C 3GU0A 4B3OA 4KH0B 1CQNA 3JYTB 3WQPA 4F02A 4BWMA 5BR8F 3CULA 4DV7J 4PG8A 1UW4A 3MCSA 2NS1B 1KTQA 4ED0A 4PWDA 4DR1F 5GAGI 5B0BA 2EFGA 1RZMA 3UWTA 2CIMA 3W63A 5KFLA 5M2RA 2QA2A 3IBWA 3HKZL 2O67A 1VGXA 2CG4A 1RTDA 2V6AA 1KQFB 3HP6A 1ZAWA 4OV6A 4Q5SA 3T1HF 2HLTA 5MAOA 2FLNA 3LPEA 1XN9A 2H3EB 2N3OA 4DR4J 1OWXA 4HR2A 2FZGB 1HBNB 4LFAJ 4J9OA 5ADZA 1QM9A 4DUZF 3NBPA 2CPZA 3I9ZA 3CCJS 2GIRA 1VQNS 2PMWA 2VQEF 4LF8J 2YNHA 4PG7A 3FEYB 4RW8B 2ZH5A 2VQFJ 3LAPA 3C6TA 4M8LA 1HBOB 2GVDB 1TU0B 3ISND 2AGOA 3PJ9A 1RI7A 2HVIA 4X4UA 5CHPA 3TFJA 2CQIA 2OPQA 1HIYA 3PYFA 2LCWA 3CUNA 1WCMK 1I1GA 3PYEA 4ZPBA 4OX9F 1ZETA 4BY7K 3ENQA 4OX8A 4DFMA 3JTOA 1TWAK 3M9NB 3E51A 4ECSA 1PAEX 3LO3A 1TP7A 4KGXB 4ICLA 4DUTA 5FLXU 2B4OA 4PRFA 4DJBA 5IQQA 4DLGA 2ILYA 2WW4A 1WC0A 1D9FA 1FWKA 4NXMF 1ZXOA 1HYSA 3M30B 1NJZA 2AV5A 3D54A 5BYSA 3ZFVA 2HGMA 2I1RA 4A3FK 5HMXA 4QWBA 3MAAB 5EN1A 2FYXA 3R6GB 4CM0A 4W90B 3FRZA 2BRLA 2ZVSA 4ED2A 3CJ5A 1FTCA 5DQIA 3N4WA 2DGUA 2DCLA 3S1RC 2BMBA 2KYZA 5IZHA 5KFAA 2RS8A 1HI9A 1N33F 4OJHA 2R92A 1TL1A 4OYAA 2CJAA 1RA7A 5BR8J 1TWGC 3GTJK 4A93C 2YNFA 1UVMA 3Q22A 2R93C 4LFBF 3M7VA 3N6NA 2A0FB 2RB7A 4EEYA 4GVLA 5KG1A 4DR1J 4AYBD 1PJ6A 3PW4A 1IJEB 1IBMF 2IYIA 3VR1A 3N5FA 4M5GA 5C25B 4ECZA 1YZ6A 3VAMA 2B63K 8RUCA 3MTJA 2VKZG 1OIAA 1PJ5A 1U1MA 3P49B 2HBRB 3ISZA 1I3OB 3VVUA 4FXVA 4CLYA 4NI2A 4H4KC 3MGJA 4OI1A 1YZ7A 1U6FA 1VQMS 3T1HJ 4DPUA 5D77A 4J9SA 2QFJA 4WIIA 2PFFB 2BM0A 3MCMA 2MHEA 3T41A 4DUZJ 3GR1A 2W2QP 3S0XA 4IRKA 3OPFA 2DXEA 3HVTA 2VQEJ 5B0EA 1AZSA 4LR2A 2NXEA 1RT1B 1Y5IB 4RNMA 4DL7A 1FKOA 1R9TK 2HZVA 3K0JA 2ACMA 5D6GA 1KDNA 2OH2A 1TQLA 3VAHA 5KG3A 3DM2B 3FBFA 2VFRA 4C3IC 2YWWA 3PHTA 4YR0A 1F9HA 1WQHA 2BJ7A 2JFKA 1HA1A 3F56A 2RQKA 3HOXC 1RTIA 1RXOB 1S10A 4G0VA 2Q79A 4OX9J 1FTRA 1EQRA 3PW0A 4UOCA 1GXUA 4WK1A 1R8CA 4WFNQ 2MQOA 1VQSA 4X6AK 1EETB 4KGMA 1DQ8A 3RZOC 2Y1LB 5H9FJ 4GZYA 2PDAA 5IV4A 3G6XA 3JQKA 2ASDA 3PV8A 5SZTA 4NXMJ 1JLQA 1F93A 2X3GA 1FX2A 3D9BA 2NVTC 2LYVA 1X4DA 4FKXA 4ECWA 2R7XA 5KFKA 1FE0A 3MR3A 3D28A 2VPWB 1E6YB 1TAUA 2XMUA 2P9GA 1TAQA 4B9MA 4LFCF 2FJAB 2O5DA 4LRFA 4WFAQ 1YBAA 5L1IA 4MH8A 3PM9A 4WZMA 1N33J 5J2MA 3H4BA 3GEIA 3TA1A 5KTQA 3OQ2A 2XG8A 3DRRA 4LFBJ 2AU0A 4ZVUB 2AEJA 2FQTA 3DGPA 4NLGA 3NNCA 3M6WA 1FFGB 2C3PA 1AFIA 4B9UA 5KFEA 3IPJA 1IBMJ 1B0PA 3M6UA 5L39A 4J9VA 1VQ6S 1HWUA 2AJFE 5IP9C 2VA3A 1VQLS 2V67A 2XB2D 2YWEA 3OBIA 2G1HA 5CH7B 2J76E 4P5BA 1RWPB 4CLSA 2ERRA 4P2XA 2ABYA 4DMZA 1MMLA 4A3GK 6FDRA 4X4TA 3RBDA 2WBRA 4CTAA 1UVKA 4RL1A 4DSIA 3GTLK 3H5YA 1JJHA 3OR1B 2U2FA 3HHLA 3A8JA 4C2MC 1NMEB 3NMAA 2BBEA 2UUTA 4FNIA 2QN6B 4C11B 4ZHRB 3HOYK 2GQQA 1X4CA 4KN7A 4BBRC 2QEXS 4RWWA 2HZCA 3ENAA 2P2CB 2BKOA 1I6HK 4BLGA 1Y5NB 1U45A 3MAHA 1M5PC 4DHVA 2J8SA 4PQAA 2QO3A 2AP6A 2ZE2B 3IGNA 5ETSA 3EYZA 2NVXA 3LTOA 1DRZA 3J81j 3C16B 3R27A 2B5JA 5CXTA 4KE5A 3TAPA 4RU2A 4QCLA 1TK8A 4QPXA 3BYPA 2AJ1A 1YJRA 1YX2A 3K17A 5IYDC 4QJVB 2NUHA 1S5ZA 3OFEA 4A3CC 1VFJA 1VISA 3AD9C 1RHRB 1UL3A 3H5SA 3S14C 4JV2A 2JX2A 1S4FA 4NLSA 3I5CA 1VMBA 4A8OA 2WZ1A 2R7VA 2ZBRA 3OL7A 3CTRA 4K4TA 3A13A 1IM6A 2Z57B 4I4BA 4PG4A 4DCOB 4RJVA 5IV3A 2XCPA 3ITHA 5TMFA 5HMWA 4MK7A 4NYOA 2O3DA 2R7OA 3KLGB 3TFHA 4UTGA 4LFCJ 1TKZA 3GTMA 5ETMA 4NLVA 4URSA 2LLZA 4BS2A 1X8DA 1RT3B 2R42A 5LSRA 1WDDA 4ID5B 3CMQA 1RHKB 2VPZB 1LV5A 1DHMA 1WUUA 2W9BA 5KG6A 1KRPA 3I82A 2GMLA 3KUGA 1H0HB 2CG8A 4G7OA 4PXCA 1HI8A 1MWQA 2V5HG 1ITPA 3ICLA 3J81U 3T5JA 1CJVB 3ENWA 2GO8A 2RF2A 1C0AA 3L7OA 3DLKB 1JLFB 1KFDA 3V81B 3I0RB 4KQZA 3UNGC 5LOQA 2J8AA 3TQEA 2FC8A 1GX6A 4IDKB 2NVXK 1IW7A 4FF4A 3HZGA 1B7YB 2LU1A 1WJ9A 2LEBA 2OMOA 2V8DA 1F60B 2PT0A 2VPXB 2OI2A 1HPZB 1Q0NA 1LWEB 5T14A 2Q6BA 5KFOA 4HACB 1X9MA 1DTQB 4CT8A 1IVZA 2DR8A 2H4WB 2HNYA 2CFAA 3PO2C 1HBMA 4KB7A 3M2VA 2DIUA 1FRIA 2AW0A 3M9OB 3QGPA 5A8KA 2Z30B 4P6QA 3ZZ0A 2HFNA 1SIWB 3PNIA 1Q1KA 1W26A 3EX7B 4O0NA 2I9SA 5F8IA 1ZM2A 4WK3A 5HBMA 3GTMK 2IPOB 3P45B 1HQ2A 3DOKB 3OEPA 2E9ZA 3DN9A 1HL6A 3FC9A 1N88A 3CDWA 3NEKA 5HROB 5EDWA 3CJTA 2NSBA 1K44A 2VODA 5ETPA 3LA0A 5AE2A 4ED8A 2Y0SL 3OXLA 5IT9Y 3AD8C 2G9OA 2K7JA 1YDLA 3N0CA 2GO9A 3FBEA 1OO0B 2P6TA 2IRXA 2IRUA 2XY6A 4WF9Q 2WTFA 1RYSA 3IRWP 1M1KT 4KKOB 4C0OC 2AKWB 3FCWA 2EKYA 4B3OB 1ELOA 1PBUA 2WVBA 2MJNA 3QLHA 3Q24A 2C2OB 2FVCA 4FYVB 2E2IA 2LECA 4HKQA 4PWDB 4DV5F 3H25A 4ECRA 1AB4A 3HT0A 2F7VA 2DGVA 2YKMA 3RR7A 4EI2A 2QL7B 3OTBA 2R7UA 4OHZA 1HWKA 2P8TA 4YB1P 2JA5A 2JOQA 5H9EK 4HDHA 1S76D 1X4HA 4DV4J 1RTDB 1BQMA 1ZPVA 4C8OA 1T03A 1R0AA 4A3BK 3IWLA 4PZVA 4Y00A 4O3SA 1SPBP 2BYCA 4IFVA 3MFIA 3I9V9 4B02A 3OR2A 3RJMB 3SBMA 5HP1A 5C3EK 3I4HX 3NBPB 1PG5B 3S01A 3HI9A 4DZ6A 2YNHB 1NSKL 3C6TB 3EPIA 3PY8A 2WB4A 4PYAA 1TWCA 3BJYA 5KT5A 1K9MT 2BJ8A 3DU5A 2M2BA 2OPQB 2VIHA 2J6TA 2BANA 2FZKB 5KFNA 2CQCA 2YX4A 4OX6A 3N9UC 5DDPC 3R5GA 4LT6A 4YN3B 1JVIA 2EC2A 3PO5A 1VRQC 2AZ3A 5FDLA 4J9MA 1QLNA 3W62A 4DR3F 2E2JC 4ICLB 4M5NA 1QY7A 3S6EA 3TVYA 2J0SD 3LANA 4FKYA 4E8UA 3J7ZT 1KWMA 3UPFA 5I3UB 3CCMS 1PC4A 5LT5A 4IQXA 1HYSB 1GE9A 4HTIA 2RILA 5EHHA 1WI6A 4CH1A 3G4SS 4DSEA 2FLLA 3V6JA 4G1IA 4FPRA 3GILA 2JA8C 3DXSX 1S49A 2DPIA 3RB4A 4NASA 1WG4A 1B7FA 1WTFA 1NLKL 2MZJA 1UFLA 1SH2A 3MR7A 4A3LK 2W7AA 1LWXA 4RNOA 1TL1B 3NGUA 3S8SA 3KXDA 2OFGX 4NCGA 3GFHA 3BKFA 1TFWA 1N5TA 4TVAB 2HFZA 4DV5J 5CD4A 5HATA 2AJQA 1NPKA 4L6V3 2FHKA 4ZLPA 3CDAA 3MMLB 4QWCA 1S9GA 3TW0A 2K3IA 3P96A 2XZDB 1N56A 4A8YA 1TWCK 4C3LA 4DBQA 3N28A 4DR7F 2DNQA 4NI2B 3MM9A 2DT9A 1URRA 3AFGA 5L8RC 1KVIA 2JA7A 4F67A 1L3VA 3PW2A 1ACMB 3H0PA 3NWGA 4PWUA 5EWGA 5IM0A 1T94A 2OSRA 3GIIA 3D0IE 3TVZA 1XEZA 5EX0A 4OZ3A 3CDUA 3S15K 5TJ3A 4DPTA 2OMLA 1EX8A 3HVTB 1AZSB 3GPAA 2HSEB 4KMDA 2WB1L 1FKOB 4F3MA 2E5LJ 3PX0A 3V5RA 2FPHX 2R2TA 3RAMA 1OQ3A 2XI3A 1TUGB 1LXJA 3ILLA 1T9VA 1K83C 5C4JC 3D2WA 2DNOA 2RQ4A 4QW8A 1F5CA 3GQCA 4YQWA 1VC6A 3RZDK 2I6WA 2IM2A 4PG6A 2OPRA 3C66A 3AODA 3PYDA 4ZP8A 4KB2A 2F63A 2CWXA 3LF0A 3KYLA 2CYYA 1SFOA 3Q8SB 4QIEA 4DR3J 1ISEA 3JQMA 2P5VA 3VAFA 3H5XA 2J0XA 3U1NA 3I4NC 2VZ9A 3PACA 2OJ3A 4USVA 3IN5A 1JWWA 1JLQB 3VF0B 2XS2A 4OYPA 3K5MA 4A8QA 2HHSA 1JIHA 1S48A 4NLRA 3PVXA 4C3HK 9ATCB 1QTMA 3QRQA 2KG0A 2UUAJ 3C8YA 3KHGA 2K1RA 3JAMU 3RB3A 1TFYA 5HVGA 1L5UA 5ETNA 4M5MA 1I5OB 3L4JA 1CJTA 3GEEA 4L73A 2V63A 2ROGA 1ZQ1C 4KT0C 5C4XC 2L41A 5GAEU 4O23A 4X2BA 3CWJA 3DRRB 3ET6A 2DR9A 4TU9A 2HEKA 3W7BA 5HLFA 3OVSA 3NG8A 1GMWD 1IR1A 2Z58B 2LQBA 2XMTA 4KPCA 1P8GA 3BQ1A 4DR7J 2WK4A 1IJFB 1RCOB 4DV0F 2GAGC 3GYXB 1WC3A 2HG4A 1PIEA 4M1KA 1PYTA 1OYEA 3MZIA 1I6VA 4GTCA 1VJQA 3G8QA 4DPWA 4N8NA 1C1BA 4DPYA 2DHSA 3QATA 3CJ8A 4CTAB 2QT7A 1ZBTA 1NZAA 1P1LA 5HL7Q 4DS4A 3HHLB 3I4MC 5CZXA 2RDIA 2ZHAA 3RYLA 2HNDA 2WSCC 1Y0HA 3H2UB 3D6TB 3IMQJ 4O3PA 3UCUP 3JSMA 1QAXA 2RU9A 4IR9A 4LQ9A 1TL5A 2HYIB 1VQOS 1WC1A 3BYRA 4EO6A 3TAQA 4OYWA 1OSCA 5GMEA 4F0KA 3HVAA 3TZWA 3ETOA 1NK0A 1URNA 2D69A 2B5JB 2JC0A 2GS8A 3PIOQ 4P52A 2V0NA 4IYQA 3FCHA 1S72S 3SV4A 3F41A 5KG2A 3WC2A
chains in the Genus database with same CATH topology
1WSRA 3A8KA 4PAAA 3GEHA 3TTGA 1XZQB 5L46A 4PABA 1WOPA 1PJ6A 1WORA 3A8IA 1WSVA 3A8JA 1PJ7A 3GEEA 3GEIA 1V5VA 1WOOA 1XZPA 3GIRA 3TFIA 3TFJA 2GAGC 1YX2A 4P9SA 1WOSA 1XZPB 3AD7C 3GSIA 3TFHA 3ADAC 1VLOA 1X31C 2GAHC 3AD9C 1VRQC 1XZQA 3AD8C 1PJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSR A;  3A8K A;  4PAA A;  3GEH A;  3TTG A;  1XZQ B;  5L46 A;  4PAB A;  1WOP A;  1PJ6 A;  1WOR A;  3A8I A;  1WSV A;  3A8J A;  1PJ7 A;  3GEE A;  3GEI A;  1V5V A;  1WOO A;  1XZP A;  3GIR A;  3TFI A;  3TFJ A;  2GAG C;  1YX2 A;  4P9S A;  1WOS A;  1XZP B;  3AD7 C;  3GSI A;  3TFH A;  3ADA C;  1VLO A;  1X31 C;  2GAH C;  3AD9 C;  1VRQ C;  1XZQ A;  3AD8 C;  1PJ5 A; 
#chains in the Genus database with same CATH topology
 4O3Q A;  1T02 A;  2EK1 A;  1A9N B;  2HGL A;  4ILL A;  2ZNY A;  2Y1I A;  4K5R A;  1NH7 A;  3PR5 B;  2DHA A;  1SH0 A;  2O66 A;  4FF1 A;  4P74 A;  4ANE A;  1W2B R;  1LFW A;  2VIC A;  3FKI K;  1X0F A;  1Q5Y A;  5DG9 A;  2HGN A;  2W7P A;  1ICE B;  1WOR A;  2B51 A;  3Q2S C;  4F25 A;  2W01 A;  2CPF A;  3W9J A;  4JK1 A;  3ITH B;  4GFQ A;  4DSJ A;  4TYB A;  4M5D A;  1BE4 A;  4DWI A;  2FGC A;  1C0T A;  4V19 J;  1TKZ B;  2YKA A;  5KT2 A;  4DQP A;  4ZJQ A;  2G0C A;  4WKY A;  2DCU B;  2MQ8 A;  3MHY A;  4NLD A;  2V6T A;  4C48 A;  3H3V L;  4LQY A;  6AT1 B;  3I0S A;  2KXH A;  2CPX A;  3F0N A;  4DL2 A;  4Y2A A;  4F3O A;  2KM8 B;  1T9W A;  5GMD A;  3GTK A;  3S1N K;  4OLO A;  1SKR A;  3H7H B;  2B43 A;  3H59 A;  1U24 A;  1VQ8 S;  5JFE A;  1C1C A;  3FQK A;  3C6U A;  1MWZ A;  2F1F A;  3P3D A;  2E2H A;  1U6B A;  4YEA A;  2IJN A;  4A8K A;  1VGY A;  3TVK A;  4N41 A;  1YQH A;  2DGS A;  2OEJ A;  1PJ7 A;  4OYZ A;  1WNE A;  2OKQ A;  3DU6 A;  1USM A;  4DV0 J;  5L38 A;  2IVF B;  3H20 A;  1XR7 A;  3NRB A;  2UUC F;  2A18 A;  2HK3 A;  1F7U A;  2RHS B;  3MPU B;  4ZOS A;  2IDE A;  4EBE A;  1H3D A;  3CE8 A;  1TL3 A;  5L46 A;  3HJV A;  2Y1J A;  1SKW A;  3CME S;  3OPK A;  4A3D K;  2EG2 A;  1S1V B;  1H6K X;  2ZIT A;  2L3M A;  4O4R A;  2WCX A;  2GCF A;  2C42 A;  2MPU A;  3HD1 A;  2L08 A;  2CFA B;  2UZA A;  4CRJ A;  3S2H C;  3OXF A;  1TKD A;  2JSX A;  4WZQ A;  1HBM B;  3M2V B;  1IQT A;  1KS2 A;  5LL6 d;  4WYW A;  5A8K B;  5JVH Q;  2ZD1 A;  3J81 Y;  3KK3 A;  4RLE A;  5KFW A;  2J7W A;  3T6J A;  1EB0 A;  5GAE I;  2Y0B B;  1Y9O A;  1W25 A;  3M8Q A;  1VOM A;  2ZJR Q;  2YQ3 A;  5HMY A;  1WOP A;  1SC3 B;  3Q8P B;  1RHM B;  4U8Y A;  1QAY A;  3MR2 A;  1SL1 A;  2HHU A;  2W4C A;  2FJV A;  4Q2L A;  1Q4R A;  1IXK A;  3NCQ A;  2EBG A;  1W7W A;  1PKU A;  3CJQ A;  4MYU A;  3EZ5 A;  4ED1 A;  1O27 A;  3HOU C;  1HQE A;  1IKY A;  4U9R A;  3WIV A;  2E2H K;  3KFW X;  1DD5 A;  4XPC A;  4OYM A;  5FD1 A;  3QLH B;  2ATC B;  1UEV A;  1SH3 A;  5KFD A;  2MQL A;  2G4B A;  3TAM B;  1MMD A;  4ZCM A;  3QRR A;  2J9D E;  3NLC A;  2OHD A;  2WW8 A;  1RBA A;  2BQR A;  2BXJ A;  2IBO A;  4GTF A;  4P7V A;  1Y1W K;  1V9O A;  1CBK A;  2BE2 A;  2I8E A;  5EGY A;  3A12 A;  4NOH A;  2YKM B;  4CO1 A;  2A6H A;  5JJB A;  2NVQ K;  1FDB A;  1CQM A;  1TL7 A;  3L4K A;  3GTG K;  3ULH A;  3AAW B;  1XXB A;  3GTP K;  1BQM B;  1T03 B;  1R0A B;  4E0D A;  3OFG A;  4AUK A;  3M4O K;  5LSL A;  4J90 A;  5A2Q U;  4IFV B;  2C28 A;  1WEY A;  5IQ6 A;  3G96 A;  1MG7 A;  3CQZ A;  2D3O 1;  3NS6 A;  3OR2 B;  2BZ2 A;  3KJQ B;  4N7T A;  2M0G B;  5CYQ A;  3K7R A;  2E9R X;  5HP1 B;  2FGO A;  2UUC J;  3G4A A;  2B6A A;  3D6H B;  3ZZO A;  1ZH5 A;  3QWP A;  1NSP A;  2A69 A;  2B9W A;  1XXA A;  2DTJ A;  1FX4 A;  5K8N A;  2MQM A;  5LJ5 Y;  1H73 A;  1FE4 A;  4PG5 A;  3N0B A;  4B3M F;  3AA9 A;  4J7C A;  3PRV A;  1DFD A;  1EAR A;  2R8J A;  1Z1Z A;  5A8R A;  4ZCL A;  2LQJ A;  1T9Y A;  5IYB K;  1SC4 B;  1SUQ A;  4Y52 C;  2BAN B;  3V2U C;  3BDP A;  2P6S A;  3BR9 A;  3PO3 K;  4HVZ A;  2L9N A;  3D0H E;  3K5N A;  5L9N A;  4GTL A;  3M9M B;  1JOE A;  3K5O A;  1RJJ A;  3PEH A;  4BC7 A;  3IO1 A;  4DV1 F;  4CT9 A;  3LUY A;  5FDL B;  1F3V A;  3GTJ C;  1SFO C;  1R3N A;  2XMJ A;  4OIP A;  5HJX A;  3MED B;  5AE3 A;  2DGW A;  1CUL B;  1AFJ A;  1IWA A;  2D3Z A;  3FK4 A;  3ZZZ A;  2OAU A;  3GTO C;  2BEF A;  3BN7 A;  3GTQ A;  1CJU A;  3OT9 A;  4HI2 A;  1S1W A;  2BOP A;  3HFK A;  5KT7 A;  4OZ5 A;  3GV5 B;  2D6F C;  2V6S A;  4ZKA A;  4C8N A;  3FKB A;  4A3M K;  2XHW A;  4ZVP B;  5J2Q A;  4Y0F A;  4FBU A;  1GX5 A;  1VK3 A;  4X4N A;  1EKS A;  4OIN A;  3DLE A;  1RWO B;  3VA7 A;  3B4M A;  3IFE A;  1P9Q C;  1FCA A;  1UA1 A;  4WBF A;  3CXC R;  1XR6 A;  1GXL A;  2KB2 A;  1RP5 A;  1RAF B;  5HO4 A;  1Q82 T;  3CF5 Q;  3K58 A;  1YVF A;  1KKH A;  2JNJ A;  4R25 A;  1NJW A;  1NB2 A;  3UCG A;  4NCG B;  4ZIT A;  1RCX B;  3NNH A;  3IS9 A;  2FHJ D;  2QA1 A;  1X60 A;  1PSD A;  2QLJ B;  1IS1 A;  1KON A;  1S9G B;  3V4I A;  2AYB A;  3ZXW A;  2JEJ A;  3TUZ C;  4JI8 F;  1TWF K;  1FNM A;  1RDR A;  2DO4 A;  1UZD A;  3MM9 B;  2LU2 A;  4KR0 B;  1M5H A;  4ETX A;  1FKP A;  2VG5 A;  4X4S A;  2KT3 A;  2OEM A;  1M5O C;  2DNL A;  1GEH A;  1XMB A;  3QT6 A;  1QAI A;  1JLG B;  4FVC A;  5L9X A;  2B9Y A;  2HRU A;  5IM0 B;  4EBD A;  3SSS A;  5C44 K;  3US5 A;  2V50 A;  1U0H A;  5E3Q A;  3R5A A;  2NLW A;  5DS7 A;  3NOG A;  2VBZ A;  5IC6 B;  3PKY A;  1RAA B;  4USU A;  3BO3 A;  2FJX A;  2QYC A;  4UY8 T;  4B08 A;  1FD8 A;  1WQF A;  1B0V A;  3M8P A;  4B3M J;  1MRO B;  3HOW K;  4ZH4 A;  1RWV B;  5D3G A;  3IWX A;  3M6X A;  2YNG A;  4XCH A;  4QIV A;  2ZC3 A;  4F0M A;  3GG0 A;  2XYH B;  1NRK A;  3GTQ K;  2AYM A;  1RBO B;  2FZC B;  4YB5 A;  3BSC A;  3BF4 A;  3GV8 B;  3QRP A;  3UR3 C;  4ZPC A;  3IR6 B;  4K59 A;  4C98 A;  4DV1 J;  3NGK A;  4XPE A;  3V4G A;  4C8Y A;  3TJ9 A;  3T5H A;  2Q6C A;  4N76 A;  3T02 A;  3MM5 B;  3L95 X;  2VB6 A;  3THV A;  3BGR A;  4RNH A;  4C3J C;  1SQE A;  4NLX A;  3MUM P;  3PEJ A;  4Z37 A;  4ECX A;  2NVY C;  1LWC A;  4FVM A;  5DRK A;  1SKS A;  2UV8 A;  1A6L A;  1GFW B;  5MLC V;  5FLM K;  2K3K A;  3BPS P;  4I6W A;  3LPY A;  3UVJ A;  1IN0 A;  4P75 A;  2K1R B;  2OO4 A;  3CCW A;  1O51 A;  2EFQ A;  5ETK A;  3I4P A;  1U49 A;  2H5J B;  5ETO A;  3O5T B;  4Q5V A;  3SZ2 A;  2HBQ B;  1CJT B;  3BBC A;  1IR0 A;  1X5P A;  4IUF A;  3MEE A;  1Q53 A;  3WBZ A;  3OJS A;  3ZZY A;  3BB5 A;  3ET6 B;  4YFX A;  4ZP7 A;  4AL5 A;  5HLF B;  4YR3 A;  3HOY C;  4ZVO B;  3S1Q K;  3TNV A;  4KGV B;  3H5U A;  3W8P A;  5D4P A;  4RW9 A;  5I3P A;  2PII A;  3B8H A;  3R5D A;  4JI8 J;  4GTD A;  2KFN A;  1U7L A;  4WKR A;  5F3Z A;  2JH3 A;  2GAH C;  2HFS A;  2GHP A;  2GHW A;  2DR6 A;  3M2U A;  5J2P B;  4JI0 F;  4XDC A;  4HH1 A;  4LBI A;  5ETR A;  2ZDP A;  1RTH A;  1C1B B;  1Q5V A;  5AXM A;  5LMU F;  4ZS6 A;  4H4O B;  4KN4 A;  4EO8 A;  3L4B C;  1J2V A;  1TK5 A;  4I2P B;  2AD9 A;  4TN2 A;  2R8H A;  3FZ2 A;  3CC4 S;  2HND B;  3BQ0 A;  4AYB L;  1AT1 B;  1LOU A;  4WIL A;  4BY1 C;  2R7R A;  4W92 B;  4LIR A;  5DO2 A;  4CP5 A;  2HVH A;  5KT3 A;  3JSM B;  2JC1 A;  3H0G A;  3Q23 A;  1TWH A;  4DFP A;  5DM7 Q;  2XCR B;  3MPW A;  1L3K A;  4ELT A;  2Y8W A;  5IOT A;  2AWZ A;  1GMW A;  3IBC B;  2V4Q A;  3RW6 A;  2VPY B;  4ZPT R;  3DGV A;  1NPR A;  2H51 B;  3OTE A;  2DNZ A;  3AJ1 A;  1FDA A;  2CJB A;  2DNH A;  1VRT A;  2BJD A;  2IMO A;  1A7G E;  2IVY A;  1N54 B;  2DH9 A;  1HLW A;  3WHI A;  2QZ8 A;  4F26 A;  2ASY A;  4KAI A;  4G1Q A;  4OZJ A;  4ZJL A;  3QJL A;  4UOF A;  5G4D A;  1R8H A;  5HJY A;  1VR6 A;  5F8H A;  2Z56 B;  3S17 K;  1F1B B;  2BE9 B;  1S6U A;  2XYG B;  2BUN A;  2B7B B;  4UZB A;  2GGP A;  4QQB A;  1R0C B;  4IH7 A;  2MKY A;  4U8V A;  5KFR A;  3EPG A;  1WOS A;  3W9I A;  2ZH1 A;  4O2D A;  3R8Y A;  4JUZ A;  3G86 A;  3CCQ S;  4M5D B;  5KFT A;  4ECT A;  1R6Y A;  5C7P A;  1JJC B;  3RUB L;  2GC8 A;  3GYN A;  4UW2 A;  4CI0 B;  5HQL A;  2XY7 A;  1GTE A;  2VFV A;  2RT3 A;  1SCJ B;  2OPP A;  1NZ8 A;  3QGH A;  4MK8 A;  1XNR F;  4OLP A;  2UUB F;  3CC2 S;  5F41 A;  5DDR C;  2CPH A;  1R8P A;  3GON A;  3I0S B;  4TXS A;  1DAR A;  4GRS A;  1S0V A;  3MMA A;  4CLP A;  5F8L A;  1SMY A;  2ZKT A;  3EMT A;  1JX4 A;  4M95 A;  3JQJ A;  4J9K A;  1UA0 A;  4K4W A;  5IP7 C;  3MTK A;  1C1C B;  5ITH A;  1I3Q C;  3C6U B;  5EWF A;  2KJW A;  4USK A;  1JKH A;  2KO1 A;  3H0G K;  1TWH K;  3CCR S;  4UOH A;  1Y1V A;  2NXN A;  1IBA A;  2OTJ S;  4JI0 J;  4FYY B;  2HVZ A;  3ZNJ 1;  3SEO A;  3UNY A;  9RUB A;  1TL3 B;  4B3S F;  1VHF A;  1FXR A;  2YU9 K;  1GK8 A;  4TYA A;  2N4C A;  3AQO A;  3HKW A;  3MD1 A;  5CYM A;  4WXW A;  1G3O A;  4LF4 F;  4P72 A;  4A3K C;  3BBF A;  3LGM A;  2J6S A;  2E5G A;  4KTQ A;  4YFK A;  1SQF A;  2IM0 A;  3GIM A;  3EVW A;  4MIA A;  2V6U A;  2DY1 A;  5BYR A;  3IRX A;  3TI0 A;  4KBI A;  3DOM A;  5KT4 A;  5KFC A;  1BWE A;  4ZLJ A;  4UQT A;  3PW5 A;  7AT1 B;  4ES3 A;  2C22 A;  1RAG B;  5IOR A;  2HQG A;  1RKI A;  3DRS A;  5ETV A;  4WP8 A;  3A8E A;  3TQ1 A;  2ZD1 B;  2HHT A;  3KK3 B;  2IM3 A;  3POT A;  3RZA A;  3C19 A;  4DU8 A;  2M8H A;  1L3S A;  2LEP A;  3J7A 1;  4PKD B;  3MMC A;  4X4R A;  3M8Q B;  3GEH A;  5F0W A;  2HRT A;  2E66 A;  4DCJ B;  3AOA A;  2ZDO A;  3GJR B;  1UVN A;  2MZ1 A;  3MD3 A;  3SCL E;  2OPS A;  2Y9H A;  2KFZ A;  4I64 A;  3MEC A;  1BXN A;  1XNQ F;  4NRT A;  3AB2 B;  2RS2 A;  2CXE A;  4Q0B A;  1KHW A;  3M8S A;  4RW7 A;  1RU0 A;  2WAQ L;  2V8V A;  4Q2M A;  5E7O B;  2XM3 A;  3KJF B;  2XMW A;  4K0K F;  5E41 A;  1HQE B;  1IKY B;  4H4K A;  3A3N B;  2CQP A;  1G4C A;  2E1P A;  2XZT B;  3PYG A;  5GAD U;  4OHY A;  2A6M A;  4LF2 A;  2AJ0 A;  3Q0A A;  4QWD A;  1P1T A;  1XNR J;  3IM8 A;  5BJR A;  1Q7Y T;  1LWF A;  3D4J A;  5GAG U;  2MQQ A;  1YCL A;  2BE2 B;  1P27 B;  3S1M C;  5A76 A;  1TL7 B;  2WOM A;  2GFF A;  4O44 A;  3BGU A;  1YRX A;  3C3L A;  3R7S B;  2MZQ A;  4RUA A;  1U6Z A;  3VCD A;  3EGZ A;  4JP8 A;  1VC5 A;  4M5H A;  5CYQ B;  4RKU C;  1WKK A;  5HAN A;  2B6A B;  3KG0 A;  2ZH2 A;  2YWH A;  5K5M A;  3M8R A;  3NS7 B;  3S1R K;  2H48 B;  2E44 A;  4B3S J;  4OHX A;  5F9L A;  2V68 A;  1UPP A;  4TQS A;  1U1R A;  1RWM B;  1ULR A;  3DLG A;  1DCO A;  2EXU A;  1TWG K;  4Y7N K;  4A93 K;  2K2P A;  3E3X A;  2KJV A;  2R93 K;  4LF4 J;  1DLO A;  4KAS A;  3QQC D;  1MU2 B;  5A8R B;  3SXL A;  2BE5 A;  4L75 A;  2N82 B;  3SI8 A;  4CO4 A;  1K73 T;  2FC9 A;  1SUQ B;  3D66 A;  3B82 A;  1NK4 A;  2EPI A;  3OLA A;  4I6Y A;  2QA4 S;  2CUY A;  1NSA A;  4HHJ A;  2YKP A;  3LAK A;  1NK9 A;  2H4Y B;  4TKT A;  2CVE A;  3J80 Y;  2ZUE A;  4H54 A;  2UP1 A;  3ONQ A;  3ZO7 A;  2DO0 A;  2IYG A;  2RUG A;  2EW9 A;  5A6P A;  4EWT A;  4I2Q A;  3W61 A;  3KNG A;  2OSQ A;  1UZH A;  3DRP A;  2G0I A;  1WHY A;  2A10 A;  1VJW A;  2CQD A;  3M8W A;  1CJU B;  1S1W B;  1XNQ J;  5IFM A;  3MUT P;  2XGQ A;  4R8U A;  5D8H B;  2LDI A;  3UD3 P;  5J1E A;  4YP3 A;  5CD4 H;  3UI3 A;  1RT5 A;  2QL5 B;  5J2Q B;  2KT2 A;  2O1P A;  3IA0 A;  4K0K J;  4OFZ A;  4K2X A;  2IIH A;  4C3I K;  3BGL A;  2MTL A;  3DLE B;  2XZW A;  1YK9 A;  5RUB A;  2DEI A;  3OUY A;  1O29 A;  4CM2 A;  2BM1 A;  3HOX K;  4KAR A;  4PEO A;  1H74 A;  3SZZ A;  3CIM A;  3KOA A;  1SJ1 A;  3S15 C;  1QDU B;  4QIG A;  2ZUA A;  3NGD A;  4EUV A;  3O1L A;  3EGN A;  4AXJ A;  4C2M A;  2KFY A;  4I0W A;  3IS9 B;  1F9F A;  3RZO K;  2AYG A;  3WDO A;  2ZH4 A;  5HQ8 A;  3C14 B;  1WHX A;  3I96 A;  5KFS A;  3WZ0 A;  3HPO A;  4J9P A;  4PUO A;  3CJK A;  1EQ0 A;  4PPD A;  2C2Z B;  3DC2 A;  1NKE A;  4NCA A;  2NVT K;  2NXJ A;  3EE3 A;  1U1N A;  3RZD C;  3BGF A;  1F9N A;  2C2K B;  1FKP B;  2VG5 B;  2NRE A;  3Q3Q A;  1DY3 A;  3S2D C;  1U0H B;  4V19 X;  1SQG A;  3I6P A;  2AT1 B;  3FUY A;  2OEK A;  4Q4Z A;  1SXL A;  2D3O R;  1G6B A;  1S1U A;  2A2D A;  3K7A C;  4C3K A;  4RX6 A;  2VG7 A;  1B99 A;  4F4X A;  4FM9 A;  2X1F A;  2KI2 A;  1QVG R;  5D3G B;  1FES A;  2YNG B;  2KT5 A;  2L9D A;  5KFQ A;  2V4R A;  1CPZ A;  2JVO A;  1U02 A;  2FHJ A;  4YB6 A;  2CDQ A;  3TYT A;  2MLX A;  3TX8 A;  2DGO A;  1TVR B;  2R9L A;  5IP9 K;  3CO9 A;  2CQ3 A;  5GAD I;  4KRW A;  4JV5 F;  2QG9 B;  2EI5 A;  4WTO B;  2UUW A;  2GSU A;  2GSO A;  4XAK A;  3PG9 A;  5DLF A;  3H40 A;  1J6W A;  3BM7 A;  3BGR B;  4GKK F;  2CPE A;  1VQY A;  2C3Y A;  2JVR A;  2HQD A;  2GJI A;  3A8I A;  3DI6 A;  1J98 A;  4C2M K;  1AUS L;  1LWC B;  3PJW A;  2VDH A;  2F65 A;  2JA6 K;  1M5K C;  4QPT A;  4OI2 A;  1KQG B;  2ZOG A;  2VUM A;  3CJS A;  4AL7 A;  4ZLL A;  3P5B P;  2HQF A;  1YKW A;  4IG3 A;  5M3F K;  4C97 A;  3G6V A;  1HI1 A;  1UFK A;  1YSJ A;  4MKB A;  2U1A A;  1FFW B;  3GG1 A;  4LF6 F;  4J91 A;  5HL8 A;  5CA5 A;  1NCL A;  1B64 A;  2LXI A;  3TEH B;  4GT9 A;  4PXE A;  1KQK A;  1HR0 F;  4TY8 A;  4JBC A;  1YI2 S;  2E5H A;  3BPD A;  3I32 A;  4F04 B;  1EZZ B;  1NJX A;  3QX3 A;  4LF9 F;  2N7Y A;  4M63 A;  2EC0 A;  3S14 K;  4RW9 B;  3W64 A;  2C2E A;  2LXF A;  2WVE A;  1AYE A;  4C7Q A;  2B7C B;  1VQP S;  2HS4 A;  2VG6 A;  3W2V A;  2AX0 A;  1Y1V C;  3M2U B;  5DM6 Q;  1Y3K A;  3VAL A;  1ZS6 A;  1YGY A;  2DRD A;  2QTW A;  4LOW A;  3T1A A;  1RTH B;  3CJ3 A;  4ED4 A;  2XNQ A;  4DCP B;  3BQ2 A;  2IAJ A;  2NZC A;  1Y10 A;  1NH8 A;  2YY3 A;  1D3W A;  2BKN A;  2XSF A;  3IBF B;  2YXL A;  1FK9 A;  4RO0 A;  2H5I B;  4C45 A;  3PXG a;  1UTA A;  4LSZ B;  4ILR A;  5D0E A;  3KMQ A;  3CJ0 A;  3KG1 A;  3OL8 A;  1U47 A;  3FKI C;  1XMQ F;  1TR0 A;  3NP5 A;  4RW4 A;  1XIQ A;  2GMJ A;  3FOE A;  5A6W A;  2H54 B;  3TTG A;  4IFY A;  2AGP A;  3QGI A;  4KHM A;  3QT8 A;  1QSL A;  4EU0 A;  2XMM A;  4LRA A;  2RH6 A;  5KOW A;  4FYD A;  3CCT A;  1FDD A;  4NA2 A;  2EVZ A;  4WFZ A;  1JK9 B;  1O8B A;  4LQ3 A;  2AJ2 A;  4KO0 A;  4M5K A;  2GMH A;  4JV5 J;  5D0H A;  3V4M A;  1WC4 A;  2YQ1 A;  3DLL Q;  3LP1 A;  4NLO A;  2OIH A;  3M1V A;  2ZH6 A;  4ED7 A;  2NYH A;  4NLW A;  1CS4 A;  2VBY A;  5CAB A;  4A47 A;  4R0J A;  4OIR A;  4GKK J;  5I4M A;  3J7Z 5;  2R4F A;  4USJ C;  1ZOT A;  4N47 A;  4QR2 A;  2A3J A;  1KVJ A;  1WWH A;  3RU0 A;  2JEF A;  2XNR A;  5GVQ A;  2VC1 A;  1FT8 A;  2RE1 A;  4IR1 A;  5E0O A;  1U25 A;  1TKT A;  3PO2 K;  1K8A T;  3KWM A;  5IWA F;  4HTJ A;  3W9H A;  2PC6 A;  3AD7 C;  4B3R F;  1RK8 A;  3A4T A;  1X9S A;  2OPP B;  4LF6 J;  4NWB A;  1RAC B;  3P5T L;  1AUD A;  4IO1 A;  3MMJ A;  2YX1 A;  3KDN A;  4A3D C;  5IT0 A;  2RRB A;  2BAB A;  2PA8 D;  1HR0 J;  4J9N A;  1RU1 A;  4G65 A;  3HF5 A;  3C15 B;  4DI6 A;  3I55 S;  2ZEJ A;  1WC6 A;  2QE5 A;  2KTQ A;  1F9E B;  2XO6 A;  1X4A A;  3GTY X;  2EFN A;  4LF9 J;  3BSA A;  3IAS 9;  1B4B A;  2R7S A;  5I42 A;  4EYH B;  1JKH B;  4GTA A;  2UVU A;  3L09 A;  2FY8 A;  4BWJ A;  3DDK A;  2BJ1 A;  4BCA A;  3I56 S;  4OHV A;  4FYW B;  2E9T A;  2FJW A;  1KN6 A;  1UWB B;  1GH8 A;  3MM7 B;  2GW8 A;  2V8G A;  1NAQ A;  2D7S A;  4BXX C;  1UEU A;  1HAR A;  1X31 C;  1I51 B;  3AOC A;  5CYM B;  3G71 S;  2R92 K;  4J9U E;  2QLW A;  2G13 A;  2QA4 G;  1Q78 A;  3DHX A;  1UPM B;  4EGL A;  3NUH A;  4FZV A;  3UN2 A;  3LWL A;  5D0R A;  4KMH A;  3CGI A;  2F5G A;  1WQG A;  3R2C J;  1XMQ J;  4N77 A;  1REG X;  3IRX B;  3DOM B;  1O2F B;  4RWX A;  1HWJ A;  1RAH B;  3T5L A;  2VOP A;  4NYP A;  3V6D A;  2RU3 A;  2B8Q A;  1KHV A;  4NEZ A;  3DRS B;  1G51 A;  1TUV A;  1AA1 B;  1XER A;  3H2L A;  5DDQ C;  5E3C A;  5T41 A;  3POT B;  4GVB A;  4ILM A;  2COL A;  2MYF A;  3KJN B;  4JOU A;  3D6M B;  5THW A;  1RHJ B;  4JI3 F;  1VRU A;  2IFX A;  1ARO P;  2LDY A;  1G2E A;  1MNE A;  3MMC B;  4RBT A;  3CD0 A;  1WEZ A;  2HLU A;  1VIX A;  4MAK A;  3VGV A;  3SQO P;  1Q7L B;  2XLK A;  2OPS B;  4LRB A;  1TV6 A;  1S4E A;  3MEC B;  3HD2 A;  3MEG A;  2W7V A;  1U4B A;  2ROE A;  4OV1 A;  1VBY A;  4Q0B B;  4XSZ A;  3BH6 B;  2V9K A;  1BUX A;  2JFD A;  2NCK L;  1RLC L;  5IYC C;  3G6E S;  4DPX A;  3MAA A;  2UVW A;  4K4Z A;  1M0S A;  3AH5 A;  4RBV A;  4ZK7 M;  4AXI A;  3AXM A;  3M05 A;  2DY9 A;  5IWA J;  3MF5 A;  1ZTT A;  5HMZ A;  3T6B A;  4B3R J;  3OVB A;  2E1A A;  1R8B A;  2QLX A;  1LWF B;  2XLJ A;  3G82 A;  2E2J K;  2BW2 A;  4HH0 A;  1RWX B;  4Z7Y A;  2R7Z A;  2AIR B;  2CVI A;  3K5L A;  2IHR 1;  3FVY A;  4KGZ B;  4TNO A;  3SV3 A;  5K20 B;  1HQU A;  5CHC B;  2ZBQ A;  4LK0 A;  2DVI A;  3OD2 A;  4P7T A;  1WG1 A;  3MPV A;  4WWS A;  2PMH A;  2WOM B;  1MLA A;  4DV2 F;  1WHW A;  2VBW A;  3OTO F;  1K83 A;  4O44 B;  3KUH A;  2FD2 A;  3RBZ A;  3E2E A;  1MWY A;  1LFP A;  2PFD A;  2DH7 A;  4KMU A;  3PO3 C;  1MMN A;  3K2Y A;  4JI6 F;  4QZV B;  2XQC A;  4CLK A;  2HNZ A;  3CNQ P;  2ZZM A;  3DYA B;  1SJQ A;  3R7N B;  5KFZ A;  2CJY B;  3IAM 9;  4Y6I A;  2E1R A;  4M5J A;  3DLG B;  5K14 A;  3HX9 A;  3BV8 A;  4NYZ A;  2VJU A;  2HW3 A;  1WI8 A;  2DHX A;  4LK1 A;  1NHK L;  1FA0 A;  1FVS A;  2LFV A;  1DLO B;  3KNA A;  3QAU A;  1FRH A;  4IRC A;  3KLF A;  1RAD B;  2XGP A;  1ZM4 A;  2V94 A;  4A3M C;  4KC6 A;  1RE1 B;  1FXD A;  2D9P A;  2DGX A;  3M32 A;  5E68 A;  2YVS A;  1TUW A;  2XTJ P;  1K1Q A;  3HSJ A;  3DM2 A;  4KY3 A;  5KFX A;  1EH1 A;  3HOZ K;  1GAO A;  3VAK A;  2FLP A;  1QSS A;  3W2W A;  4YS2 A;  3FEX B;  4J3N A;  2NPF A;  1RWU A;  1LW2 B;  3MAQ A;  2UU9 F;  2J0W A;  2DB1 A;  3W1Y C;  1G1X A;  4LF1 A;  3UD4 P;  2DNK A;  4JI3 J;  4A3I C;  4I2Q B;  4ANC A;  2CRL A;  2RH3 A;  1X4B A;  3TZX A;  2D1C A;  2QSF A;  3DRP B;  3FCV A;  5KFF A;  3UW1 A;  4B9T A;  1DQA A;  4P10 A;  5K8M A;  3HVW A;  1CEZ A;  3H3V D;  5KFM A;  1ROF A;  2I0X A;  2MB0 B;  1RT6 A;  2HBY B;  2ZBP A;  3VAJ A;  4DPO A;  2VUM C;  1GNK A;  1ZZN A;  2NYI A;  1RT5 B;  1YWX A;  2RD5 C;  1K83 K;  5C4J K;  3QIP B;  3X1L B;  5E3P A;  1N34 F;  3BBB A;  4FXD A;  3H4D A;  4WP3 A;  3LWM A;  3OUY B;  1E6Y A;  3DNC A;  4LF5 F;  1JXV A;  3AOB A;  3OHB A;  4YFU A;  2KVI A;  1FJ7 A;  3EZO A;  3ILJ A;  1V3S A;  4ZMM A;  2PA3 A;  2MJU A;  2GX8 A;  4AFF A;  4P73 A;  5B0A A;  2W9A A;  2WVC A;  1VS3 A;  3D5M A;  3KLI B;  4TY9 A;  4MFB A;  1RWN B;  4U96 A;  1DCP A;  2XUL A;  4Y2I A;  1I94 F;  1EHW A;  4ZN3 A;  3OFH A;  4K4S A;  1RT2 A;  3I4N K;  1U26 A;  2MDA A;  3W5X A;  5F9N A;  4DV2 J;  4PUO B;  3OTO J;  3UN3 A;  3CJK B;  1SI9 A;  2MKH A;  1S97 A;  1J27 A;  1CSJ A;  2W7O A;  4IOB A;  4XO0 A;  1XXC A;  3IM9 A;  4JI6 J;  5B0C A;  2DGT A;  4FPI A;  4DLE A;  5DZ7 A;  3T19 A;  1RT7 A;  2W2N P;  3O6Q A;  2JEI A;  3DDN A;  2XYP B;  3G87 A;  4UF4 A;  4LVO P;  1FWL A;  1S1U B;  1PCA A;  4MQ9 A;  2VFT A;  3HFV A;  5G0R A;  5C4X K;  1FJE B;  2VF3 A;  3VWS A;  1R27 B;  2GJF A;  4DR6 F;  3HCX A;  4LSL A;  3OR1 A;  2YWF A;  3SDE B;  1LK7 A;  4HT7 A;  2V8H A;  5C2G A;  7FD1 A;  1WG5 A;  4G6V B;  1VYA A;  4ITS A;  3LAJ A;  1I50 A;  1KC8 T;  2MXY A;  3THP A;  4Y28 C;  2R7T A;  2A2C A;  4XSX A;  3Q8Y A;  4Y2C A;  3Q89 A;  1KOH A;  3LAL A;  1U1L A;  2DNN A;  2L48 A;  4DL6 A;  3KK2 B;  1RB0 A;  4LJZ A;  1V3Z A;  3IR5 B;  4USM A;  2UU9 J;  1AXQ A;  4X84 A;  2F9J A;  3WX8 A;  3W8G A;  3LP2 A;  3ZTP A;  1HNV A;  3OSN A;  2KWA A;  1SJR A;  4JI4 F;  3BKT A;  3MWB A;  3NKY A;  3S1T A;  1RAJ A;  3OTC A;  4I1T A;  5HN0 A;  2MKC A;  4K4X A;  3MCO A;  1QJH A;  1YIT S;  4MJK A;  3I4M K;  4UZC A;  3WOD A;  2GQC A;  4PYD A;  3KHH A;  4NLY A;  1AW0 A;  1JLE A;  3HSG A;  2CZV C;  1FI4 A;  1HNW F;  1P9Y A;  2NXU A;  5GAH U;  3GB0 A;  3NNA A;  4PQU A;  2KVQ E;  4IG3 B;  1Q8B A;  2WHO A;  3AT1 B;  4HL9 A;  1S0N A;  3TAR A;  3HZE A;  3JST A;  1N34 J;  2VFU A;  4ELV A;  4RUB A;  3BO4 A;  4LF5 J;  2CNK B;  3FJ2 A;  3U7J A;  3LW5 C;  2VUG A;  4MKY A;  3MMB A;  3HHN B;  1R7I A;  1S79 A;  1QTN B;  4TY8 B;  2ATL A;  2BAC A;  2B8P A;  4NLP A;  3UO0 A;  4ECY A;  2VON A;  5F8N A;  4V1A k;  1YJT A;  4W4M A;  5KFP A;  3WC0 A;  1MSW D;  2I38 A;  2BQ3 A;  1I94 J;  1NSQ A;  3ZZT A;  3KK1 A;  3Q8R B;  2PGC A;  4Y2K A;  4HEA 9;  2FHM A;  2ZM6 F;  2PI4 A;  1DUR A;  3BH7 B;  1BY9 A;  1N48 A;  4CO5 A;  3V6K A;  4Q44 A;  2VG6 B;  4J9L A;  3W2V B;  1O24 A;  2XMK A;  4ZVE A;  1YRT A;  1IE0 A;  2FUG 9;  4U95 A;  1NHU A;  3BDE A;  3UN5 A;  1K0V A;  4Z2X A;  2IAJ B;  1I6J A;  3V81 A;  2MKS A;  1M5S A;  3BUE A;  5M2P A;  2MST A;  5F8J A;  2DEJ A;  1FK9 B;  2AEF A;  1RU2 A;  1WTB A;  2JJ4 D;  2E2I K;  4E2F B;  2ZUG A;  4ED5 A;  1GMU A;  2ADC A;  3Q8V A;  4RUC A;  2HFV A;  4RW4 B;  4A46 A;  4IFY B;  1WOO A;  4A8M P;  1U0S A;  2DH8 A;  5C2C A;  1S77 D;  2JA5 K;  2RHQ B;  1U1P A;  1N5S A;  3K5P A;  3VZH A;  3CVK A;  3G9C A;  1IQ0 A;  1NU4 A;  4F2R A;  1HD0 A;  4D3G A;  4OJ1 A;  4P2F A;  4KO0 B;  5D0G A;  2VOO A;  3PFO A;  1X0P A;  3TJ8 A;  2OUG A;  2KZM A;  4FZB A;  3LP1 B;  5J1N A;  3M1V B;  2RKI A;  2YNF B;  1KBR A;  2LVW A;  3GV7 B;  3PW7 A;  4JI4 J;  4ECV A;  1CS4 B;  4JB8 B;  1VI7 A;  3MM8 A;  1QUP A;  2GNK A;  3QMQ A;  1UVL A;  3MPD A;  3IWN C;  5HRO A;  4IH6 A;  1HD1 A;  1UWA A;  4IO9 Q;  3LAM A;  2XCO A;  1IBK F;  1SC6 A;  2F8M A;  2BE7 D;  3R9L A;  2ASJ A;  1VQK S;  1RHQ B;  5EGH A;  1NBE B;  4B17 A;  1HNW J;  1WCM A;  2P5M A;  4LUB A;  3S2H K;  3QZ7 A;  2QMU B;  2QX0 A;  1TKT B;  1TWA A;  3KHL A;  2I5J A;  1DBD A;  5KFB A;  3PIP Q;  1D09 B;  3FZB A;  5M5X K;  1XWL A;  2GVZ A;  4HHH A;  4DSL A;  1VQ7 S;  2XBP A;  2R7Z C;  4UUW A;  3CCE S;  4IRD A;  4I56 A;  4F4W A;  4ZCI A;  4USW A;  4WYL A;  2HIQ A;  3JTN A;  3BZQ A;  2AEM A;  4QBU A;  5I42 B;  2JHE A;  3UD5 A;  4ZVH A;  3VQS A;  3NGR A;  2ZM6 J;  2EK6 A;  3CO0 P;  2RDJ A;  2VHG A;  2BW7 A;  2M8D B;  4QYR A;  1RTI B;  2YWG A;  3I31 A;  2GV1 A;  1B70 B;  3N3Y A;  3P4U B;  3HOU K;  3GDZ A;  2YNI A;  2W8K A;  1FRX A;  3GTJ A;  3B6B A;  2ROP A;  1UMJ A;  4NA1 A;  2QV6 A;  3ENV A;  4H4M A;  4OHW A;  4KHR A;  3M8Z A;  3QFW A;  4DQS A;  5IXU A;  3OSP A;  2ZH9 A;  3GTO A;  3T9N A;  4UY8 5;  2CQH A;  3M3Y C;  3DRX A;  4YUD A;  2G2O A;  2B63 A;  4ZP6 A;  1FJC A;  3HXA A;  3UDV A;  3V6D B;  5IS2 A;  5GAH I;  4U7U D;  4LRE A;  2FLO A;  2ZZN A;  5LXY A;  4I6A A;  3A3O B;  4I68 A;  3HLU A;  2VH7 A;  3HO1 A;  4J37 A;  2LA6 A;  1S0O A;  1T05 A;  4GVB B;  4WU2 A;  4WFY A;  3CMA S;  3NCR A;  1Y7P A;  1VRU B;  3FOF A;  3T1Y F;  2JA7 K;  5J2M B;  4DDQ A;  1KQ4 A;  1BC6 A;  3SIP B;  1ZA2 B;  1BLU A;  2DBB A;  3D68 A;  5GMK a;  2J5A A;  2ZBI A;  4ID8 A;  3Q83 A;  4X4V A;  1S7I A;  2HFU A;  1R9T A;  3DGP B;  1N32 F;  2E1C A;  1TV6 B;  5I3U A;  3MEG B;  1U09 A;  3HT3 A;  2BOA A;  5DET A;  1IBK J;  4F2S A;  4G1P A;  3QAE A;  2XLI A;  2HVE A;  2LQ9 A;  2W2M P;  4Y52 K;  2N3L A;  4NPO A;  3EXY A;  4ZVS B;  2AZ1 A;  2A1B A;  3GP9 A;  4JI1 F;  1Q79 A;  1SKU B;  2WVF A;  2B9E A;  3QPI A;  4XLP A;  4OZ0 A;  3SCK E;  3S16 C;  3NY0 A;  2G2Z A;  1NK6 A;  3VHQ A;  3G82 B;  5DG7 A;  4Y7N C;  4IOA Q;  1SFO K;  2YQ0 A;  2AQ4 A;  2J0Q D;  1FO1 A;  1KP6 A;  2ZH3 A;  1OS5 A;  1HQU B;  3EZU A;  1HFE L;  3QYY A;  3LPX A;  3SSQ A;  4YB7 A;  2W8L A;  3CAG A;  2HKE A;  2X1B A;  3AQP A;  3GTO K;  3AJ2 A;  3JS9 A;  4WXO A;  3QSY B;  3NWR A;  2JL9 A;  4CLZ A;  3O2I A;  2XCA A;  1DTT A;  3N6L A;  2QL9 B;  4ED3 A;  4TLR A;  3RW7 A;  5KG7 A;  1FER A;  4DG1 A;  4ZA1 A;  1X4G A;  2RRN A;  2HNZ B;  2NR0 A;  2UXD F;  3EQL A;  4DSK A;  1C4C A;  1SV5 A;  4J9Q A;  5B08 A;  3VGS A;  3MR5 A;  2DPJ A;  1UJ6 A;  5ETQ A;  2ZJQ Q;  3OW2 R;  2ZHO A;  4A3E C;  5K14 B;  3PTW A;  1UV7 A;  4NLQ A;  2XY5 A;  2O5I A;  4MKA A;  2VL1 A;  1PC5 A;  3LGH A;  2NVY A;  1SJ3 P;  1OQ6 A;  3KLF B;  5LM7 E;  3MUR P;  4DUY F;  1EIY B;  3GFY A;  1TK0 A;  2QLB B;  1IKX A;  1NK7 A;  2BDP A;  3HMJ G;  3HVR A;  1I50 C;  3M32 B;  2MGZ A;  1W2I A;  3X3U A;  3FSY A;  1VBK A;  4KMA A;  4FNH A;  5LMN F;  3LGN A;  2V8P A;  4EZ6 A;  3W2W B;  3D1H A;  1NPP A;  3EXC X;  1ZM3 A;  4PWW A;  2B56 A;  3DLJ A;  1ZYQ A;  4UQG A;  2E29 A;  3G8S A;  3T1Y J;  3GTL A;  4MK9 A;  2R3V A;  4RUH A;  4G7Z A;  4OX7 A;  2RIJ A;  4QYZ K;  2HHV A;  4DQQ A;  3H98 A;  4LIW A;  3EUN A;  4OQJ A;  5J2N A;  2F3J A;  2FVR A;  2CPJ A;  2LA4 A;  2W9B B;  1QVF R;  1N32 J;  2Q1L A;  4WFB Q;  4DQI A;  3L9Z A;  1FNX H;  2BV3 A;  3NMR A;  2MLY A;  1RT6 B;  4OI6 A;  1FVQ A;  1SJ4 P;  3THT A;  1BQX A;  1ZZF A;  2CPY A;  3JXO A;  2F4F A;  2DNR A;  1WD6 A;  3T3F A;  2RF2 B;  3VTI A;  4ZVR B;  4WP9 A;  2WON A;  4NE9 C;  4MMO A;  1SIZ A;  4L72 B;  1RTJ A;  3BSO A;  3RGI A;  3KG4 A;  3HJF A;  3ZTQ A;  1ZAX A;  4JI1 J;  1HW8 A;  3KLV A;  2HMI A;  2HHQ A;  1B3T A;  1ZYR A;  2BJ3 A;  2QRR A;  4NCB A;  3GLJ A;  4GKJ F;  3HDS A;  2Z4P A;  1TZ0 A;  1U1O A;  4MFB B;  3HK2 A;  1LXN A;  5K8O A;  1KFS A;  2OEL A;  3V6H A;  1RT2 B;  4C3J K;  4F50 A;  1A0O B;  2HNY B;  2EFO A;  1F2G A;  2NVY K;  3GIR A;  4K7Q A;  2Z8Q A;  4A3J C;  1QE1 A;  1RT4 A;  2QFI A;  2CZ4 A;  4M1X A;  1O2A A;  1KVK A;  2XC9 A;  4CLL A;  4G0W A;  1RT7 B;  4MYT A;  2UXD J;  2H65 B;  1UJ5 A;  4AL6 A;  5DGB A;  5J1P A;  3CSK A;  5HBM B;  1JXL A;  2VBX A;  4TLQ A;  1RAI B;  3JB9 k;  1VQ9 S;  3PHE A;  3DOL A;  5G0R B;  5DJB A;  1JLA A;  2JLE A;  4LLG A;  2BKP A;  4LSL B;  1XBW A;  2RNE A;  3HOV K;  1TKX A;  4OZN A;  1WKJ A;  7FDR A;  1KQS R;  4KV8 A;  2C3O A;  1RA6 A;  2JA6 C;  4B9S A;  2LXU A;  4DUY J;  4WPA A;  3GTK K;  4Q8E A;  5D4L A;  1RLD A;  1U2F A;  5IC4 B;  1CJK A;  2K8G A;  1K1S A;  2WAQ D;  5LMN J;  2RQC A;  5D4N A;  2ZZT A;  3TO8 A;  3VZI A;  1RAE B;  1IBL F;  1NKB A;  4K4U A;  4MTP A;  2LQ5 A;  2KXN B;  1FRJ A;  3LP2 B;  1HNV B;  3Q2T C;  4FP9 A;  2UVV A;  2DD8 S;  2X51 A;  3J7Y U;  2FJE B;  2HRY A;  2X1G A;  1N36 F;  4FF2 A;  4DN9 A;  2M52 A;  3GZ7 A;  1PYS B;  3QO9 A;  3CT9 A;  1VK8 A;  2ZFH A;  4KGK A;  2KXF A;  3GFZ A;  4BY1 K;  2CNN B;  1JLE B;  1Z2Z A;  2CQ0 A;  4PR6 A;  1S1T A;  4ATN A;  1HWI A;  1I3Q A;  5KAK A;  4NZ0 A;  5AXK A;  3J80 U;  4RW6 A;  2OLW A;  4PQU B;  2XCQ A;  3N6M A;  1WCM C;  4GC7 A;  1WSR A;  3O8W A;  3G6Y A;  1UVI A;  2JLF A;  4BY7 C;  2C3U A;  1MW7 A;  4D3H A;  4BDP A;  1TWA C;  1IUJ A;  4PXB A;  4OI4 A;  3PFE A;  2C2R A;  3RAX A;  2QMX A;  5M5Y K;  4JYA F;  3HHE A;  2DXD A;  3MMB B;  2MKI A;  3DXJ A;  2D41 A;  5L1K A;  4GKJ J;  1CG2 A;  3QJJ A;  2G0J A;  1X4F A;  2XO7 A;  2PMZ L;  3EM1 A;  1CC8 A;  2FVS A;  2V4J A;  1NND A;  3TA0 A;  2JDJ A;  3OV7 A;  4TU8 A;  3J7A N;  4QW9 A;  3ZZU A;  3KK1 B;  5FJ4 A;  4A3F C;  1BD6 A;  1J5O A;  1ZPW X;  2CQ4 A;  3OHA A;  2CJX B;  4DV4 F;  3CJ2 A;  4PPZ A;  1PBA A;  3GIJ A;  3QT5 A;  4BBS K;  2GIQ A;  4R5P A;  4A8F A;  1O5J A;  4NZ7 A;  4XLN A;  4LBH A;  3R1H A;  1EAY C;  4NL5 A;  4OYO A;  4XTT A;  2PPB A;  1Q8K A;  4Y34 A;  3CIZ A;  1S1X A;  2O5J A;  2HK2 A;  4WJB A;  5H1S V;  4QIW D;  5IT4 A;  3CD7 A;  4A8W A;  3R97 A;  1OY8 A;  2IMW P;  2ADB A;  1GMV A;  1S1V A;  4YOE A;  4U67 Q;  2B63 C;  4ZPV R;  3U1L A;  4QOT A;  4DS5 A;  1WF0 A;  1HNZ F;  4LVN P;  1U2R A;  2YTC A;  5DQG A;  4ZN1 A;  1UKU A;  4YFN A;  4N56 A;  5IP7 K;  4CQ1 A;  4E98 A;  4L76 A;  1I3Q K;  5D78 A;  2RSQ A;  4C3M A;  1RYR A;  1O2B A;  5KT6 A;  1UET A;  2H5E A;  3EJM A;  2GZO A;  5I3Q A;  2FB0 A;  2QJ3 A;  2OP5 A;  1BGW A;  1IBL J;  1JNZ B;  3CQZ K;  2LQ8 A;  4ZVG A;  2AF6 A;  4LSN A;  2RKI B;  5K9F A;  3VAI A;  5EUH A;  4CZC A;  4I7F A;  3E01 A;  2CJ9 A;  2HWI A;  2R7W A;  1Z2L A;  1R9T C;  3MM6 A;  2AGQ A;  1N36 J;  3MM8 B;  3N5B A;  3M6V A;  4KSE B;  1Y00 A;  2R8K A;  4C0H A;  5T7L A;  2QGF B;  1WEL A;  4A3K K;  1NM2 A;  3T9Z A;  4OYX A;  2IJR A;  1SBR A;  2ALZ A;  3P8B B;  1RGV A;  5KOX A;  4CO0 A;  3QGG A;  2PEB A;  2DXF A;  4F4Z A;  5TMC A;  4ZPA A;  2RAQ A;  1WAC A;  1FRL A;  2I5J B;  2YPZ A;  3N0V A;  4OI0 A;  3W3S A;  4ZIW A;  4UT4 A;  4X6A C;  4JYA J;  2CZ9 A;  4GO7 X;  2R92 C;  2GVZ B;  3UDC A;  3CED A;  4F4A A;  3TAM A;  2R7Q A;  1K47 A;  3KMS A;  3R7B B;  1XMO F;  3OVA A;  3BKU A;  3RB6 A;  4FF3 A;  2SXL A;  1HNX F;  1U8S A;  2HHH F;  4F3Q A;  1S6P A;  4OI3 A;  3ZTR A;  1C0U A;  2C2M B;  1N5Y A;  3DLB A;  2CA9 A;  5CYJ A;  4Q45 A;  2W24 A;  3CCL S;  4X65 F;  2NUU G;  2ZHB A;  3U02 A;  4DSF A;  2OPR B;  4O4G A;  2EWH A;  1XZQ A;  2YNI B;  1S6Q A;  2D74 B;  3CDE A;  2F4V F;  1FRM A;  1Z4U A;  4DL0 C;  3J7Y I;  4YR2 A;  4H4M B;  4DL5 A;  3JSR A;  5EX3 A;  1IWG A;  4EK2 A;  1XPP A;  4YHH F;  3HM9 A;  2C3M A;  4CH0 S;  3GCX P;  1U1K A;  2AMC B;  6FD1 A;  2RRA A;  3TUJ C;  4LMZ A;  2E5L F;  2KG1 A;  2R2U A;  1EI6 A;  5LJ3 Y;  3S1M K;  4XIU A;  4DX8 H;  4BC9 A;  1RTZ A;  1WKL A;  1HNZ J;  3HKZ D;  2HVD A;  4LRC A;  3TZY A;  3DKD A;  4S0M A;  4JI2 F;  1ZA1 B;  4A8S A;  3FRY A;  2V2Z A;  1U2C A;  4KIA A;  3MUV P;  5B7W A;  3GCW P;  2W4P A;  1T05 B;  3OLB A;  4A3G C;  1IBC B;  3NCP A;  3MEK A;  1OYD A;  3GTL C;  4RNN A;  4QU7 A;  1YTY A;  1WEX A;  3RTV A;  2PHC B;  3L3C A;  3D6F B;  3MED A;  1IKW A;  4C8L A;  3TFI A;  3TZZ A;  2EG1 A;  1CUL A;  1WF1 A;  1GTH A;  5E3R A;  4HLB A;  1VC0 A;  3CJ4 A;  3KJV A;  5AE1 A;  3B78 A;  1HKA A;  4A8X A;  4GMK A;  1I6H C;  3TA2 A;  3R6L B;  5AXL A;  4X4P A;  4BHQ A;  4DF4 A;  1VJE A;  2UUA F;  4EZ9 A;  4PXD A;  3SQG A;  1S6O A;  1JMT A;  1KOO A;  2FJB B;  3ERE D;  1T3N A;  4FBT A;  3C2P A;  4YDD B;  2ZNZ A;  4MIB A;  1FKA F;  1L0W A;  2OGU A;  4QWE A;  5A0Y A;  3GSI A;  3KKF A;  2YKN A;  2FIU A;  4ZP9 A;  3CPW R;  3DDI A;  4KPY A;  1C2P A;  1XMO J;  3GWC A;  5D15 A;  5FLX Y;  1T9T A;  1OPZ A;  1RAO A;  1HNX J;  1VBX A;  2EFV A;  3RG6 A;  2HHH J;  3ADA C;  2ZWP A;  3AA8 A;  1KTV A;  1KD1 T;  3SFU A;  1SB6 A;  1SJF A;  1DTT B;  2UVR A;  1YG0 A;  3NAI A;  3HOZ C;  4DG1 B;  1OY6 A;  4DZD A;  4X65 J;  1UFW A;  5AXN A;  2H1Y A;  4XDD A;  2ZVI A;  3OFF A;  2C2D A;  4O3R A;  2VAS A;  1SV5 B;  2V34 A;  1EKR A;  1J6X A;  2ZH7 A;  2HFO A;  2MQP A;  2M7S A;  2CDR B;  1U8W A;  2PN6 A;  3ZTO A;  1JLG A;  2F4V J;  5H9E J;  4KC5 A;  5CZV A;  4ENO A;  2PA8 L;  5CQG A;  2DR7 A;  2W1B A;  1KLN A;  3SSR A;  1FRK A;  4YHH J;  3HHL C;  4DX5 A;  1EQM A;  5CJ9 A;  1IKX B;  4OYI A;  1XJW B;  1TL4 A;  1MRO A;  3FBC A;  2MGZ B;  3G4C A;  5AJ3 F;  3EIC A;  3FBB A;  1E6V A;  3VAG A;  2JRS A;  4JI2 J;  3OTD A;  4RMF A;  1H72 C;  4HT5 A;  1C0T B;  1ZVU A;  2NVX C;  1YRU A;  1WHV A;  1KLM A;  1M1H A;  4DDF A;  2BA9 A;  5FII A;  2PI5 A;  3NAH A;  1XQI A;  2EBE A;  4I67 A;  1R31 A;  4U7U K;  3S2D K;  1S9E A;  5J2N B;  4J9R A;  4QU6 A;  1V5I B;  3GSD A;  3MM5 A;  2OFH X;  3HFZ B;  1XK8 A;  3GR0 A;  3K7A K;  4USH A;  5C24 A;  5F8M A;  4NZ6 A;  2ZOF A;  1V3R A;  2KKH A;  3WX4 A;  2HQ3 A;  4JI7 F;  1RQ0 A;  2KRR A;  2DIS A;  3JSY A;  3KLH A;  2WON B;  2CW0 A;  4B9N A;  1RTJ B;  1S59 A;  1T11 A;  2PO4 A;  5C42 A;  5IOL A;  2V69 A;  5HSP A;  1JXE A;  3ZNU A;  4C8M A;  1XC9 A;  2YKO A;  2HMI B;  4ZIV A;  3CCU S;  2P9C A;  5LMU J;  5JMN A;  3GTM C;  3C46 A;  4BKW A;  3FFI A;  4Y3C A;  3UFC X;  3ZC4 A;  1CVJ A;  5EWE A;  3W5Y A;  2J7K A;  4L3N A;  4WJ3 M;  4ZVQ B;  3B4D A;  4DN0 A;  1RWK B;  3K57 A;  3FKI A;  3TOQ A;  1XZP A;  2KM8 C;  1JB0 C;  1GT8 A;  2DIV A;  1B4S A;  1FHT A;  3Q8U A;  4K50 A;  5KFH A;  1QE1 B;  1RT4 B;  2FQQ B;  1VIO A;  1VDH A;  1BMQ B;  3EWG A;  4OIQ A;  5HQM A;  5HK4 A;  4DF8 A;  4NML A;  4ECQ A;  1Y4Z B;  4C9D A;  5HVF A;  4UOG A;  4K8R A;  3TJA A;  3CB4 A;  2JLG A;  5J2P A;  3BRE A;  2AYE A;  2W2P P;  4WIQ A;  1UEK A;  4KYZ A;  4IG0 A;  3DOL B;  2JZ5 A;  1J5E F;  4AND A;  1H38 A;  4H4O A;  1JLA B;  3PKM A;  4CNZ A;  4U6P A;  3I5A A;  4I2P A;  4ETZ A;  1TKX B;  3IC1 A;  1T3O A;  4CIO A;  5A8W A;  5IOS A;  2MZR A;  3QT7 A;  4KV8 B;  5BYQ A;  3IG1 A;  4N8O A;  3LP0 A;  3PRD A;  2CNL B;  1NEE A;  4URG A;  4ILD A;  3D67 A;  2M3D A;  1BJT A;  4M94 A;  4NA3 A;  4A3B C;  1JLC A;  3PR4 A;  3W66 A;  1CJK B;  5AJ3 J;  3AJD A;  2XI2 A;  2AHO B;  4YME A;  2ZH8 A;  3ZZR A;  3N79 A;  2DYA A;  5C3E C;  2CQB A;  3BEG B;  4DU7 A;  1N4L A;  5E2Q A;  1HNI A;  4OZL A;  1Y1V K;  2F8E X;  4AQY F;  1H7X A;  2UXC F;  2DHG A;  3FQL A;  2M9K A;  5KFY A;  2Q66 A;  4LR9 A;  2UUB J;  2FHO B;  4DEZ A;  2WRM A;  3LQV A;  3NL0 A;  4DX6 A;  3GIK A;  4C8Z A;  3QO9 B;  4OYB A;  4HHU A;  4RNF A;  2DNM A;  2MMY A;  2ZC4 A;  4GC6 A;  1S1T B;  4NLU A;  3BP3 A;  5KFV A;  2B0G A;  4RW6 B;  1ZTW A;  2CWK A;  4JI7 J;  1P6T A;  2H9Z A;  3PX6 A;  1S57 A;  3MOJ B;  1IKV A;  4HI1 A;  2R8G A;  2E5J A;  1YNN A;  4WJ4 A;  3P6Y C;  1N6Q A;  4DV6 F;  4DR2 F;  1F5B A;  4LR7 A;  1PO6 A;  4RZR A;  2DKO B;  3DMJ A;  5LXR A;  2E2I C;  1D9D A;  1NJY A;  1F7V A;  2V4J B;  2EEY A;  2Z2Y B;  2DR5 A;  5B09 A;  1J5O B;  1FD2 A;  4AH6 A;  3BO2 A;  2JA5 C;  1RWW B;  3QID A;  3K59 A;  3UQS A;  4A4J A;  3JSB A;  2QSW A;  4R5P B;  5KFU A;  3ILO A;  4IQM A;  4A3L C;  2MKJ A;  2YX7 A;  1T95 A;  2YH0 A;  2PE8 A;  5M3M K;  2CQG A;  4DV3 F;  1S1X B;  4KB4 A;  2IRY A;  3GE9 A;  2IA6 A;  1YIJ S;  3T00 A;  4PCQ A;  1J5E J;  1N8R T;  1Y1W A;  1L3U A;  1X5S A;  2B4V A;  5ETL A;  3UDL A;  4LF7 F;  4B3T F;  2A6O A;  1TWC C;  3S7R A;  5D4D A;  2JWN A;  3GTG A;  1YBT A;  1VH2 A;  3GTP A;  2HS0 A;  2DNY A;  1NKC A;  1C4A A;  2J9D A;  2I2Y A;  4GTB A;  5HAO A;  2GA7 A;  1Q95 G;  1UP1 A;  3HUL A;  2VKR A;  3R5C A;  1FDN A;  4NMX A;  5KG4 A;  1IM4 A;  2M5Y A;  2W2O P;  2IJF A;  4MEX A;  2E7V A;  1KR4 A;  3UDE A;  3KLE A;  4YDX A;  4C8K A;  4AQY J;  4LSN B;  1S7H A;  3BR8 A;  2UXC J;  1JJ4 A;  3R3T A;  1UCN A;  4I7F B;  4K2J A;  3H90 A;  3E01 B;  2VA2 A;  4BXX K;  3L7U A;  3MM6 B;  4ZPD A;  4JI5 F;  3OL9 A;  5T7L B;  3V4I B;  2YH1 A;  3EVO A;  4AT1 B;  2X7I A;  1YJ9 S;  4EBC A;  3FMB A;  1O28 A;  1LW0 A;  4WTY A;  2RML A;  4CLF A;  3E8O A;  1DZ5 A;  1Q8L A;  3BP8 C;  3KTQ A;  2N4D A;  1F3F A;  3ISN C;  1REV A;  4DR5 F;  2QIF A;  5K8P A;  4DV6 J;  2WVD A;  4DR2 J;  1F6T A;  3PCO B;  2A6E A;  2Y8Y A;  2O01 C;  2QYG A;  4CYU A;  2KYX A;  4ELU A;  3NGT A;  2DJW A;  2DNP A;  3M8P B;  3BN4 A;  1LNQ A;  2E7X A;  2ALY B;  4P5A A;  4OIX A;  4FYX B;  4C3H C;  2CAJ A;  5DLG A;  4JV1 A;  1S6P B;  3TAN A;  3RBE A;  1C0U B;  1N5Y B;  2V2V A;  1R43 A;  2VC0 A;  1B4A A;  4M5I A;  4QYZ J;  1VQ4 S;  4C6A A;  1PIL A;  2Y0S D;  5IYC K;  4W98 A;  1X5T A;  1USO A;  4O4G B;  1XZQ B;  1N5Q A;  1S6Q B;  1BQN A;  4O3O A;  2JA7 C;  4GO5 X;  3D1O A;  5M2U A;  1U48 A;  1NDP A;  4DV3 J;  4ERD A;  2LEA A;  2HHP A;  4EFA C;  1UW9 A;  3A8K A;  4NOI A;  2HZA A;  2MY8 A;  2J9C A;  4ECU A;  3CCV S;  2YBV A;  5F3T A;  2N7C A;  4LF7 J;  2HAF A;  4B3T J;  4WCE Q;  2E5I A;  1TWF A;  5KG0 A;  3U27 A;  4X4O A;  4LBP A;  3GYG A;  1MU2 A;  3D3C J;  2HQC A;  4BBR K;  2E7W A;  3UVJ B;  4LR8 A;  4CLT A;  3RRK A;  2G2Y A;  2KHC A;  3DCA A;  2ZWO A;  4IH5 A;  4C0B A;  2BJE A;  2C1E B;  2HS3 A;  2R2R A;  5U47 A;  4M5L A;  4I69 A;  2ZBC A;  4DFK A;  1YNJ A;  3OL6 A;  1FFS B;  3MEE B;  4P2M A;  2VU5 A;  3QJP A;  4QR0 A;  3QWU A;  3ZZP A;  4K4V A;  3HHD A;  3VQT A;  3UCZ P;  1RIS A;  4GTE A;  5IYD K;  1IKW B;  2DK2 A;  4A3C K;  3DHW C;  1QD1 A;  3KJV B;  4JI5 J;  2CJQ A;  3PO4 A;  1WC5 A;  1XR5 A;  2FTR A;  1O26 A;  2WBM A;  1D1U A;  3KDO A;  1G7C B;  1MN7 A;  1ZM9 A;  2F9D A;  2XSJ A;  1OSD A;  1ZAV A;  2XMA A;  5H9F K;  1H2V Z;  3SQG B;  4ED6 A;  4QIF A;  2IA0 A;  3VV2 B;  2YWK A;  4AE5 A;  5FJ8 K;  2HWH A;  1J6V A;  4ZPW R;  3TRG A;  3RBX A;  1HBU A;  4DR5 J;  5A0Y B;  4PAA A;  2ZUF A;  5E33 A;  2YKN B;  1DCH A;  3Q8Q B;  4IOC Q;  3NOC A;  4A3I K;  1V5V A;  4KFB A;  3D1Q A;  1S0M A;  1NDK A;  3CCZ A;  2KN4 A;  4WE1 A;  4KJI A;  2W9C A;  1RKJ A;  3HSD A;  2MEW A;  2Y1R I;  3C14 A;  3M2R A;  4CDI A;  1JLB A;  4X62 F;  2F40 A;  3EDQ B;  2R2S A;  3SCJ E;  3NGS A;  2VUM K;  4OZ1 A;  1HMV A;  1Q81 T;  2HUR A;  2L9W A;  1VRT B;  2ACY A;  1NJI T;  2K06 A;  2NPI A;  2R8I A;  1IR2 A;  1RSC A;  1EP4 A;  4BBY A;  3GMG A;  1MN9 A;  2GQ2 A;  1NDL A;  1SL2 A;  1WSV A;  4CNY A;  3TP2 A;  3N01 A;  3CW2 C;  4KH1 B;  1O6X A;  4G1Q B;  2IC3 A;  2DGQ A;  3CCS S;  2Z2M A;  3PX4 A;  1NXI A;  3TR5 A;  1LQ9 A;  3W60 A;  3I87 A;  3S1N C;  1D0E A;  1B0T A;  2GGP B;  2W25 A;  1T8E A;  3AH6 A;  1TMM A;  2F8H A;  3FMW A;  4YY3 F;  2LKZ A;  3SFG A;  2DIT A;  1T0T V;  2E1M C;  2CQ1 A;  1E6V B;  5JXS A;  2MLZ A;  1O25 A;  1LK5 A;  1U1Q A;  3AY0 A;  5M5W K;  3SZY A;  4OIO A;  1KEK A;  1TVR A;  1BHN A;  4X64 F;  1KLM B;  2YKQ A;  2J9E A;  1IL2 A;  3T01 A;  3VGT A;  1JQW A;  1RAB B;  3JYT A;  1HHT P;  1S9E B;  4NX9 A;  2HIY A;  3TEG A;  1INN A;  3MMA B;  1Q86 T;  1N0V C;  3MXH P;  1WF2 A;  5C24 B;  3M8Y A;  2WB1 D;  5KFI A;  1R8A A;  1UVJ A;  2MZS A;  4U7C A;  3UE2 A;  1YJU A;  1X4E A;  3LH2 S;  5B0G A;  1R6V A;  2J7U A;  3KLH B;  1BGX T;  3AB4 B;  4WFX A;  3RB0 A;  3TUP A;  1BWV A;  5C42 B;  2XWX A;  4BLB A;  2RUS A;  3IXQ A;  2FQO A;  3MCN A;  2LMI A;  5CAA A;  3QZ8 A;  1D8Y A;  3ORE A;  2X3D A;  4L3K A;  1HBN A;  4FS2 A;  3AHP A;  2K7K A;  4CWB A;  3FFI B;  4G3I A;  3HOV C;  3GFX A;  4X66 F;  3MDF A;  5BXI A;  3LOU A;  3BS9 A;  4RW8 A;  4Y2M A;  4F4K A;  4P9S A;  1XZP B;  2V9W A;  1HBO A;  3GTK C;  3H8Y A;  2FDN A;  2GVD A;  4Z7C A;  4P2S A;  2HBZ B;  1S9F A;  2IY5 B;  1DAX A;  3O3L A;  1BS2 A;  2PEH A;  4X62 J;  4MT1 A;  2XEX A;  2E2H C;  2PD1 A;  3VVT A;  1N0U A;  3PJX A;  2HWT A;  4ES1 A;  2WSE C;  3FNN A;  1V6H A;  1DQ9 A;  1UJ4 A;  1ZBS A;  1YLX A;  4KHP F;  4URQ U;  2GHV C;  5L1L A;  5DG8 A;  1Q16 B;  2RQM A;  3JAM Y;  4IG0 B;  4ZLN A;  2NXC A;  1X5O A;  1SL0 A;  3R5J B;  2KRB A;  1Y1W C;  1VLO A;  4F8R A;  3FSX A;  3D3B J;  2J6U A;  3PZP A;  5A8W B;  2NVQ C;  2AX1 A;  3FEZ A;  4TQR A;  3SCI E;  1JJ2 R;  3IG1 B;  3GTG C;  3LP0 B;  1GXT A;  3EGW B;  3GTP C;  3H2V E;  4RW7 B;  2CKW A;  3M30 A;  4NLT A;  4YY3 J;  1JLC B;  2UXB F;  3M4O C;  1TEL A;  3TX0 A;  2YPY A;  3PRB A;  2BR0 A;  2Q3P A;  4KM8 A;  2IBK A;  2DNG A;  1KSP A;  2DRA A;  1X9W A;  3K89 A;  1HNI B;  4X64 J;  2YU9 A;  1OY9 A;  3GJT B;  1Y3J A;  2Z0G A;  1O0P A;  5E3A A;  4DX7 A;  1YHQ S;  2EFP A;  1T9U A;  4R0E A;  3DRY A;  4QR1 A;  4OJG A;  1FJG F;  3SYZ A;  4XK8 C;  3F73 A;  1APS A;  2IVM A;  3W5Z A;  5KG5 A;  1S12 A;  4WU3 A;  2VJV A;  5IYB C;  3QBC A;  2P8I A;  4F7V A;  4UST A;  2HPU A;  2B4P A;  5C25 A;  4F4Y A;  4B9V A;  3HHK A;  5EGE A;  1N5V A;  4BBS C;  2AJ4 A;  2HAI A;  2BRK A;  1IKV B;  4EYI B;  2JA8 K;  2Z2L A;  4B9L A;  1XTZ A;  1NK5 A;  4N5S A;  1YBU A;  4NEY A;  1N6Q B;  2VDI A;  2MY7 A;  3D7S B;  4MIW A;  3FSI A;  1YJN S;  2B4U A;  3A1Y G;  4KAW X;  3DMJ B;  3H42 A;  1QAJ A;  2QMW A;  3M4X A;  3TUI C;  1BDF A;  1LKZ A;  2NZ4 A;  4ES2 A;  1DJ0 A;  2A68 A;  4X66 J;  3D0G E;  2JEG A;  2KU7 A;  3G2X A;  1VBZ A;  3C15 A;  1RT1 A;  1NK8 A;  4A48 A;  1LEO A;  4OZ2 A;  3KHR A;  2MQN A;  4FXW A;  3MR6 A;  1M90 T;  3BSN A;  3CD5 A;  3IR7 B;  5CCL A;  2VD3 A;  2RDD A;  1T9X A;  1D9A A;  2FJD B;  4O3N A;  3OXG A;  5DDO C;  1S99 A;  3CQZ C;  2B9X A;  1GQE A;  1R89 A;  4KHP J;  2ZOM A;  2RJZ A;  1UWB A;  2KL8 A;  3MM7 A;  1UAW A;  3KUE A;  3Q86 A;  3QNW B;  4ZVT B;  2ZKU A;  5HI7 A;  2CFX A;  1EET A;  3FHZ A;  3OJU A;  4K4Y A;  2G1D A;  2ZFZ A;  1QSY A;  2R7Z K;  4KM9 A;  4R8U B;  1M1G A;  5HVH A;  1TWF C;  2QC3 A;  4TU7 A;  4CLW A;  2CNO B;  2PSZ A;  4IKA A;  5J1E B;  4MEY A;  1PYO B;  3A3P B;  5IOQ A;  3IGV A;  2XHC A;  2UXB J;  4FS1 A;  2HHW A;  4P71 A;  2BVZ A;  2NQP A;  2MSS A;  4OMF G;  3HXM A;  1EK8 A;  1CLF A;  2CJK A;  5DQH A;  5C44 C;  3HHL D;  3KLE B;  2VFS A;  1CC7 A;  3QSI A;  3DLH A;  5B0D A;  1NUE A;  4Q8F A;  2Y3P A;  1FEE A;  1HHS A;  3W65 A;  1TWG A;  2MKK A;  4DOZ A;  2V2K A;  2FVP A;  3MOZ A;  2R93 A;  1YJV A;  2DHH A;  1FJG J;  1Q8I A;  4ZCK A;  2MZT A;  4J5O A;  3R1L A;  3HOW C;  4K5S A;  4BLA A;  1FNO A;  3GJQ B;  1Y11 A;  5DGA A;  3GTQ C;  3O44 A;  4DQR A;  1SVD A;  1H7W A;  3EDR B;  3NXZ A;  5E5N A;  1VCT A;  3SMZ A;  1HW9 A;  3M3Y K;  4DL4 A;  1LW0 B;  3UR0 A;  2KHD A;  2POK A;  1F2H A;  3FDS A;  3HSZ A;  4FN5 A;  1WIH A;  4YG2 A;  1REV B;  4L74 A;  2M88 A;  3ELH A;  1HI0 P;  4CO2 A;  1K0T A;  2Y3Y A;  3K8V A;  4CYU B;  1H98 A;  3JTP A;  1F0X A;  3BGO P;  1YJ7 A;  2VG7 B;  2IM1 A;  4CLU A;  4KDD A;  3RR8 A;  4C11 A;  4ZHR A;  1RHU B;  5FLM C;  2CPI A;  5DZ6 A;  2HHX A;  3MPY A;  1RBL A;  2KH9 A;  2Z2Z A;  2CAD A;  5KFJ A;  2ZE2 A;  3NS5 A;  1WDT A;  4NRU A;  1M5V C;  4ZDN A;  4RR5 A;  1PAU B;  1BQN B;  1EJ7 L;  2KDO A;  2FY1 A;  3C16 A;  4AD6 A;  4OL8 A;  3DYA A;  4G7H A;  4RPF A;  3DFE A;  2EBB A;  1Y5L B;  1FF2 A;  2WSF C;  4QJV A;  4G0U A;  3S16 K;  4X4Q A;  1YJW S;  3S1Q C;  2GSN A;  5ETT A;  3DI6 B;  1OJ4 A;  3RRG A;  2OD4 A;  4NXN F;  3WIU A;  4OJ3 A;  3RAQ A;  4O0I A;  3EGV A;  5C5J A;  1NHV A;  1EFW A;  5B0F A;  1F5A A;  3L7P A;  2CPD A;  3DXB A;  1FXL A;  1TMJ A;  2EKN A;  4RBU A;  2D3U A;  4C4W A;  1AB8 A;  2ILZ A;  1SC1 B;  3R5B A;  4HYK A;  3KLG A;  3TWZ A;  4QIW L;  5A2Q Y;  2UV8 G;  1LW2 A;  4DV7 F;  4ER8 A;  4Q7A A;  2BX6 A;  2ASL A;  3VGU A;  1VQ5 S;  2B3T B;  1TTH B;  1RT3 A;  4UUX A;  3ILI A;  4ID5 A;  4A3E K;  4HDG A;  2PMZ D;  1T7P A;  2RGR A;  5D4O A;  3AXK A;  2GJ2 A;  5JVO A;  1H2T Z;  1HQM A;  4ALZ A;  3IP0 A;  2XSJ B;  2OD6 A;  5L1J A;  1QUV A;  1I50 K;  1CJV A;  2XWY A;  1HWL A;  1N52 B;  1NDC A;  2LP4 A;  2BQU A;  2RVJ A;  1R0B G;  3T5K A;  3QIP A;  4DL3 A;  4QWA A;  2V2Q A;  1JLF A;  3DLK A;  4DR4 F;  1IQZ A;  2NSC A;  4JV0 A;  1HBU B;  3I0R A;  4LFA F;  1OPI A;  1KNZ A;  4IDK A;  4KAT A;  4F36 A;  2M70 A;  8ATC B;  3K8W A;  3S17 C;  2GIF A;  4LF8 F;  4DR6 J;  4KFB B;  3GJS B;  4DXL A;  2VV5 A;  4CH7 A;  3I5B A;  4LJM A;  3MFH A;  2VQF F;  2BJ9 A;  3KLI A;  4WE1 B;  2P9E A;  5LSO A;  1HPZ A;  5IT9 U;  2W9C B;  3MI7 X;  2JA6 A;  1LWE A;  2D9O A;  5CCM A;  2C2N A;  4HAC A;  2M4M A;  3M2R B;  5JUM A;  1JLB B;  1DTQ A;  3PDN A;  2W4D A;  2XS7 A;  2MHN A;  2DRB A;  3ZTS A;  3CD6 S;  4RU9 A;  2FVQ A;  4CO3 A;  1HMV B;  1FEH A;  1RUS A;  4CCH A;  5F8G A;  4Q43 A;  1HHQ A;  5KFG A;  3CC7 S;  1PGZ A;  1EP4 B;  2X1A A;  1FWP A;  4F0H A;  1VHI A;  5SUH A;  3RRH A;  2XMV A;  3CDB A;  2IC3 B;  2APO A;  1D8Z A;  5AT1 B;  4ZJO A;  2XS5 A;  4ZVF A;  3G8T A;  5F0U A;  3DOK A;  4FDF A;  4EMD A;  1OMS A;  4NXN J;  3SDE A;  3FGV A;  1L3T A;  2IDL A;  3F44 A;  2HQI A;  3U1M A;  3B54 A;  4PAB A;  3H0G C;  4MKV A;  3QFH A;  1H2U X;  3ETM A;  2QLF B;  1TWH C;  1NO8 A;  4Y65 A;  1JNR B;  2OTL S;  4LRD A;  2CQ2 A;  3EVM A;  4DFJ A;  2ZJP Q;  4A3J K;  3CJR A;  4USI A;  1VLY A;  1X7V A;  2Q43 A;  1NB7 A;  2KZZ A;  3R2D J;  8AT1 B;  4KKO A;  5JVG Q;  1JQG A;  3KK2 A;  2YU9 C;  3GU0 A;  4B3O A;  4KH0 B;  1CQN A;  3JYT B;  3WQP A;  4F02 A;  4BWM A;  5BR8 F;  3CUL A;  4DV7 J;  4PG8 A;  1UW4 A;  3MCS A;  2NS1 B;  1KTQ A;  4ED0 A;  4PWD A;  4DR1 F;  5GAG I;  5B0B A;  2EFG A;  1RZM A;  3UWT A;  2CIM A;  3W63 A;  5KFL A;  5M2R A;  2QA2 A;  3IBW A;  3HKZ L;  2O67 A;  1VGX A;  2CG4 A;  1RTD A;  2V6A A;  1KQF B;  3HP6 A;  1ZAW A;  4OV6 A;  4Q5S A;  3T1H F;  2HLT A;  5MAO A;  2FLN A;  3LPE A;  1XN9 A;  2H3E B;  2N3O A;  4DR4 J;  1OWX A;  4HR2 A;  2FZG B;  1HBN B;  4LFA J;  4J9O A;  5ADZ A;  1QM9 A;  4DUZ F;  3NBP A;  2CPZ A;  3I9Z A;  3CCJ S;  2GIR A;  1VQN S;  2PMW A;  2VQE F;  4LF8 J;  2YNH A;  4PG7 A;  3FEY B;  4RW8 B;  2ZH5 A;  2VQF J;  3LAP A;  3C6T A;  4M8L A;  1HBO B;  2GVD B;  1TU0 B;  3ISN D;  2AGO A;  3PJ9 A;  1RI7 A;  2HVI A;  4X4U A;  5CHP A;  3TFJ A;  2CQI A;  2OPQ A;  1HIY A;  3PYF A;  2LCW A;  3CUN A;  1WCM K;  1I1G A;  3PYE A;  4ZPB A;  4OX9 F;  1ZET A;  4BY7 K;  3ENQ A;  4OX8 A;  4DFM A;  3JTO A;  1TWA K;  3M9N B;  3E51 A;  4ECS A;  1PAE X;  3LO3 A;  1TP7 A;  4KGX B;  4ICL A;  4DUT A;  5FLX U;  2B4O A;  4PRF A;  4DJB A;  5IQQ A;  4DLG A;  2ILY A;  2WW4 A;  1WC0 A;  1D9F A;  1FWK A;  4NXM F;  1ZXO A;  1HYS A;  3M30 B;  1NJZ A;  2AV5 A;  3D54 A;  5BYS A;  3ZFV A;  2HGM A;  2I1R A;  4A3F K;  5HMX A;  4QWB A;  3MAA B;  5EN1 A;  2FYX A;  3R6G B;  4CM0 A;  4W90 B;  3FRZ A;  2BRL A;  2ZVS A;  4ED2 A;  3CJ5 A;  1FTC A;  5DQI A;  3N4W A;  2DGU A;  2DCL A;  3S1R C;  2BMB A;  2KYZ A;  5IZH A;  5KFA A;  2RS8 A;  1HI9 A;  1N33 F;  4OJH A;  2R92 A;  1TL1 A;  4OYA A;  2CJA A;  1RA7 A;  5BR8 J;  1TWG C;  3GTJ K;  4A93 C;  2YNF A;  1UVM A;  3Q22 A;  2R93 C;  4LFB F;  3M7V A;  3N6N A;  2A0F B;  2RB7 A;  4EEY A;  4GVL A;  5KG1 A;  4DR1 J;  4AYB D;  1PJ6 A;  3PW4 A;  1IJE B;  1IBM F;  2IYI A;  3VR1 A;  3N5F A;  4M5G A;  5C25 B;  4ECZ A;  1YZ6 A;  3VAM A;  2B63 K;  8RUC A;  3MTJ A;  2VKZ G;  1OIA A;  1PJ5 A;  1U1M A;  3P49 B;  2HBR B;  3ISZ A;  1I3O B;  3VVU A;  4FXV A;  4CLY A;  4NI2 A;  4H4K C;  3MGJ A;  4OI1 A;  1YZ7 A;  1U6F A;  1VQM S;  3T1H J;  4DPU A;  5D77 A;  4J9S A;  2QFJ A;  4WII A;  2PFF B;  2BM0 A;  3MCM A;  2MHE A;  3T41 A;  4DUZ J;  3GR1 A;  2W2Q P;  3S0X A;  4IRK A;  3OPF A;  2DXE A;  3HVT A;  2VQE J;  5B0E A;  1AZS A;  4LR2 A;  2NXE A;  1RT1 B;  1Y5I B;  4RNM A;  4DL7 A;  1FKO A;  1R9T K;  2HZV A;  3K0J A;  2ACM A;  5D6G A;  1KDN A;  2OH2 A;  1TQL A;  3VAH A;  5KG3 A;  3DM2 B;  3FBF A;  2VFR A;  4C3I C;  2YWW A;  3PHT A;  4YR0 A;  1F9H A;  1WQH A;  2BJ7 A;  2JFK A;  1HA1 A;  3F56 A;  2RQK A;  3HOX C;  1RTI A;  1RXO B;  1S10 A;  4G0V A;  2Q79 A;  4OX9 J;  1FTR A;  1EQR A;  3PW0 A;  4UOC A;  1GXU A;  4WK1 A;  1R8C A;  4WFN Q;  2MQO A;  1VQS A;  4X6A K;  1EET B;  4KGM A;  1DQ8 A;  3RZO C;  2Y1L B;  5H9F J;  4GZY A;  2PDA A;  5IV4 A;  3G6X A;  3JQK A;  2ASD A;  3PV8 A;  5SZT A;  4NXM J;  1JLQ A;  1F93 A;  2X3G A;  1FX2 A;  3D9B A;  2NVT C;  2LYV A;  1X4D A;  4FKX A;  4ECW A;  2R7X A;  5KFK A;  1FE0 A;  3MR3 A;  3D28 A;  2VPW B;  1E6Y B;  1TAU A;  2XMU A;  2P9G A;  1TAQ A;  4B9M A;  4LFC F;  2FJA B;  2O5D A;  4LRF A;  4WFA Q;  1YBA A;  5L1I A;  4MH8 A;  3PM9 A;  4WZM A;  1N33 J;  5J2M A;  3H4B A;  3GEI A;  3TA1 A;  5KTQ A;  3OQ2 A;  2XG8 A;  3DRR A;  4LFB J;  2AU0 A;  4ZVU B;  2AEJ A;  2FQT A;  3DGP A;  4NLG A;  3NNC A;  3M6W A;  1FFG B;  2C3P A;  1AFI A;  4B9U A;  5KFE A;  3IPJ A;  1IBM J;  1B0P A;  3M6U A;  5L39 A;  4J9V A;  1VQ6 S;  1HWU A;  2AJF E;  5IP9 C;  2VA3 A;  1VQL S;  2V67 A;  2XB2 D;  2YWE A;  3OBI A;  2G1H A;  5CH7 B;  2J76 E;  4P5B A;  1RWP B;  4CLS A;  2ERR A;  4P2X A;  2ABY A;  4DMZ A;  1MML A;  4A3G K;  6FDR A;  4X4T A;  3RBD A;  2WBR A;  4CTA A;  1UVK A;  4RL1 A;  4DSI A;  3GTL K;  3H5Y A;  1JJH A;  3OR1 B;  2U2F A;  3HHL A;  3A8J A;  4C2M C;  1NME B;  3NMA A;  2BBE A;  2UUT A;  4FNI A;  2QN6 B;  4C11 B;  4ZHR B;  3HOY K;  2GQQ A;  1X4C A;  4KN7 A;  4BBR C;  2QEX S;  4RWW A;  2HZC A;  3ENA A;  2P2C B;  2BKO A;  1I6H K;  4BLG A;  1Y5N B;  1U45 A;  3MAH A;  1M5P C;  4DHV A;  2J8S A;  4PQA A;  2QO3 A;  2AP6 A;  2ZE2 B;  3IGN A;  5ETS A;  3EYZ A;  2NVX A;  3LTO A;  1DRZ A;  3J81 j;  3C16 B;  3R27 A;  2B5J A;  5CXT A;  4KE5 A;  3TAP A;  4RU2 A;  4QCL A;  1TK8 A;  4QPX A;  3BYP A;  2AJ1 A;  1YJR A;  1YX2 A;  3K17 A;  5IYD C;  4QJV B;  2NUH A;  1S5Z A;  3OFE A;  4A3C C;  1VFJ A;  1VIS A;  3AD9 C;  1RHR B;  1UL3 A;  3H5S A;  3S14 C;  4JV2 A;  2JX2 A;  1S4F A;  4NLS A;  3I5C A;  1VMB A;  4A8O A;  2WZ1 A;  2R7V A;  2ZBR A;  3OL7 A;  3CTR A;  4K4T A;  3A13 A;  1IM6 A;  2Z57 B;  4I4B A;  4PG4 A;  4DCO B;  4RJV A;  5IV3 A;  2XCP A;  3ITH A;  5TMF A;  5HMW A;  4MK7 A;  4NYO A;  2O3D A;  2R7O A;  3KLG B;  3TFH A;  4UTG A;  4LFC J;  1TKZ A;  3GTM A;  5ETM A;  4NLV A;  4URS A;  2LLZ A;  4BS2 A;  1X8D A;  1RT3 B;  2R42 A;  5LSR A;  1WDD A;  4ID5 B;  3CMQ A;  1RHK B;  2VPZ B;  1LV5 A;  1DHM A;  1WUU A;  2W9B A;  5KG6 A;  1KRP A;  3I82 A;  2GML A;  3KUG A;  1H0H B;  2CG8 A;  4G7O A;  4PXC A;  1HI8 A;  1MWQ A;  2V5H G;  1ITP A;  3ICL A;  3J81 U;  3T5J A;  1CJV B;  3ENW A;  2GO8 A;  2RF2 A;  1C0A A;  3L7O A;  3DLK B;  1JLF B;  1KFD A;  3V81 B;  3I0R B;  4KQZ A;  3UNG C;  5LOQ A;  2J8A A;  3TQE A;  2FC8 A;  1GX6 A;  4IDK B;  2NVX K;  1IW7 A;  4FF4 A;  3HZG A;  1B7Y B;  2LU1 A;  1WJ9 A;  2LEB A;  2OMO A;  2V8D A;  1F60 B;  2PT0 A;  2VPX B;  2OI2 A;  1HPZ B;  1Q0N A;  1LWE B;  5T14 A;  2Q6B A;  5KFO A;  4HAC B;  1X9M A;  1DTQ B;  4CT8 A;  1IVZ A;  2DR8 A;  2H4W B;  2HNY A;  2CFA A;  3PO2 C;  1HBM A;  4KB7 A;  3M2V A;  2DIU A;  1FRI A;  2AW0 A;  3M9O B;  3QGP A;  5A8K A;  2Z30 B;  4P6Q A;  3ZZ0 A;  2HFN A;  1SIW B;  3PNI A;  1Q1K A;  1W26 A;  3EX7 B;  4O0N A;  2I9S A;  5F8I A;  1ZM2 A;  4WK3 A;  5HBM A;  3GTM K;  2IPO B;  3P45 B;  1HQ2 A;  3DOK B;  3OEP A;  2E9Z A;  3DN9 A;  1HL6 A;  3FC9 A;  1N88 A;  3CDW A;  3NEK A;  5HRO B;  5EDW A;  3CJT A;  2NSB A;  1K44 A;  2VOD A;  5ETP A;  3LA0 A;  5AE2 A;  4ED8 A;  2Y0S L;  3OXL A;  5IT9 Y;  3AD8 C;  2G9O A;  2K7J A;  1YDL A;  3N0C A;  2GO9 A;  3FBE A;  1OO0 B;  2P6T A;  2IRX A;  2IRU A;  2XY6 A;  4WF9 Q;  2WTF A;  1RYS A;  3IRW P;  1M1K T;  4KKO B;  4C0O C;  2AKW B;  3FCW A;  2EKY A;  4B3O B;  1ELO A;  1PBU A;  2WVB A;  2MJN A;  3QLH A;  3Q24 A;  2C2O B;  2FVC A;  4FYV B;  2E2I A;  2LEC A;  4HKQ A;  4PWD B;  4DV5 F;  3H25 A;  4ECR A;  1AB4 A;  3HT0 A;  2F7V A;  2DGV A;  2YKM A;  3RR7 A;  4EI2 A;  2QL7 B;  3OTB A;  2R7U A;  4OHZ A;  1HWK A;  2P8T A;  4YB1 P;  2JA5 A;  2JOQ A;  5H9E K;  4HDH A;  1S76 D;  1X4H A;  4DV4 J;  1RTD B;  1BQM A;  1ZPV A;  4C8O A;  1T03 A;  1R0A A;  4A3B K;  3IWL A;  4PZV A;  4Y00 A;  4O3S A;  1SPB P;  2BYC A;  4IFV A;  3MFI A;  3I9V 9;  4B02 A;  3OR2 A;  3RJM B;  3SBM A;  5HP1 A;  5C3E K;  3I4H X;  3NBP B;  1PG5 B;  3S01 A;  3HI9 A;  4DZ6 A;  2YNH B;  1NSK L;  3C6T B;  3EPI A;  3PY8 A;  2WB4 A;  4PYA A;  1TWC A;  3BJY A;  5KT5 A;  1K9M T;  2BJ8 A;  3DU5 A;  2M2B A;  2OPQ B;  2VIH A;  2J6T A;  2BAN A;  2FZK B;  5KFN A;  2CQC A;  2YX4 A;  4OX6 A;  3N9U C;  5DDP C;  3R5G A;  4LT6 A;  4YN3 B;  1JVI A;  2EC2 A;  3PO5 A;  1VRQ C;  2AZ3 A;  5FDL A;  4J9M A;  1QLN A;  3W62 A;  4DR3 F;  2E2J C;  4ICL B;  4M5N A;  1QY7 A;  3S6E A;  3TVY A;  2J0S D;  3LAN A;  4FKY A;  4E8U A;  3J7Z T;  1KWM A;  3UPF A;  5I3U B;  3CCM S;  1PC4 A;  5LT5 A;  4IQX A;  1HYS B;  1GE9 A;  4HTI A;  2RIL A;  5EHH A;  1WI6 A;  4CH1 A;  3G4S S;  4DSE A;  2FLL A;  3V6J A;  4G1I A;  4FPR A;  3GIL A;  2JA8 C;  3DXS X;  1S49 A;  2DPI A;  3RB4 A;  4NAS A;  1WG4 A;  1B7F A;  1WTF A;  1NLK L;  2MZJ A;  1UFL A;  1SH2 A;  3MR7 A;  4A3L K;  2W7A A;  1LWX A;  4RNO A;  1TL1 B;  3NGU A;  3S8S A;  3KXD A;  2OFG X;  4NCG A;  3GFH A;  3BKF A;  1TFW A;  1N5T A;  4TVA B;  2HFZ A;  4DV5 J;  5CD4 A;  5HAT A;  2AJQ A;  1NPK A;  4L6V 3;  2FHK A;  4ZLP A;  3CDA A;  3MML B;  4QWC A;  1S9G A;  3TW0 A;  2K3I A;  3P96 A;  2XZD B;  1N56 A;  4A8Y A;  1TWC K;  4C3L A;  4DBQ A;  3N28 A;  4DR7 F;  2DNQ A;  4NI2 B;  3MM9 A;  2DT9 A;  1URR A;  3AFG A;  5L8R C;  1KVI A;  2JA7 A;  4F67 A;  1L3V A;  3PW2 A;  1ACM B;  3H0P A;  3NWG A;  4PWU A;  5EWG A;  5IM0 A;  1T94 A;  2OSR A;  3GII A;  3D0I E;  3TVZ A;  1XEZ A;  5EX0 A;  4OZ3 A;  3CDU A;  3S15 K;  5TJ3 A;  4DPT A;  2OML A;  1EX8 A;  3HVT B;  1AZS B;  3GPA A;  2HSE B;  4KMD A;  2WB1 L;  1FKO B;  4F3M A;  2E5L J;  3PX0 A;  3V5R A;  2FPH X;  2R2T A;  3RAM A;  1OQ3 A;  2XI3 A;  1TUG B;  1LXJ A;  3ILL A;  1T9V A;  1K83 C;  5C4J C;  3D2W A;  2DNO A;  2RQ4 A;  4QW8 A;  1F5C A;  3GQC A;  4YQW A;  1VC6 A;  3RZD K;  2I6W A;  2IM2 A;  4PG6 A;  2OPR A;  3C66 A;  3AOD A;  3PYD A;  4ZP8 A;  4KB2 A;  2F63 A;  2CWX A;  3LF0 A;  3KYL A;  2CYY A;  1SFO A;  3Q8S B;  4QIE A;  4DR3 J;  1ISE A;  3JQM A;  2P5V A;  3VAF A;  3H5X A;  2J0X A;  3U1N A;  3I4N C;  2VZ9 A;  3PAC A;  2OJ3 A;  4USV A;  3IN5 A;  1JWW A;  1JLQ B;  3VF0 B;  2XS2 A;  4OYP A;  3K5M A;  4A8Q A;  2HHS A;  1JIH A;  1S48 A;  4NLR A;  3PVX A;  4C3H K;  9ATC B;  1QTM A;  3QRQ A;  2KG0 A;  2UUA J;  3C8Y A;  3KHG A;  2K1R A;  3JAM U;  3RB3 A;  1TFY A;  5HVG A;  1L5U A;  5ETN A;  4M5M A;  1I5O B;  3L4J A;  1CJT A;  3GEE A;  4L73 A;  2V63 A;  2ROG A;  1ZQ1 C;  4KT0 C;  5C4X C;  2L41 A;  5GAE U;  4O23 A;  4X2B A;  3CWJ A;  3DRR B;  3ET6 A;  2DR9 A;  4TU9 A;  2HEK A;  3W7B A;  5HLF A;  3OVS A;  3NG8 A;  1GMW D;  1IR1 A;  2Z58 B;  2LQB A;  2XMT A;  4KPC A;  1P8G A;  3BQ1 A;  4DR7 J;  2WK4 A;  1IJF B;  1RCO B;  4DV0 F;  2GAG C;  3GYX B;  1WC3 A;  2HG4 A;  1PIE A;  4M1K A;  1PYT A;  1OYE A;  3MZI A;  1I6V A;  4GTC A;  1VJQ A;  3G8Q A;  4DPW A;  4N8N A;  1C1B A;  4DPY A;  2DHS A;  3QAT A;  3CJ8 A;  4CTA B;  2QT7 A;  1ZBT A;  1NZA A;  1P1L A;  5HL7 Q;  4DS4 A;  3HHL B;  3I4M C;  5CZX A;  2RDI A;  2ZHA A;  3RYL A;  2HND A;  2WSC C;  1Y0H A;  3H2U B;  3D6T B;  3IMQ J;  4O3P A;  3UCU P;  3JSM A;  1QAX A;  2RU9 A;  4IR9 A;  4LQ9 A;  1TL5 A;  2HYI B;  1VQO S;  1WC1 A;  3BYR A;  4EO6 A;  3TAQ A;  4OYW A;  1OSC A;  5GME A;  4F0K A;  3HVA A;  3TZW A;  3ETO A;  1NK0 A;  1URN A;  2D69 A;  2B5J B;  2JC0 A;  2GS8 A;  3PIO Q;  4P52 A;  2V0N A;  4IYQ A;  3FCH A;  1S72 S;  3SV4 A;  3F41 A;  5KG2 A;  3WC2 A; 
#chains in the Genus database with same CATH homology
 1WSR A;  3A8K A;  4PAA A;  3GEH A;  3TTG A;  1XZQ B;  5L46 A;  4PAB A;  1WOP A;  1PJ6 A;  1WOR A;  3A8I A;  1WSV A;  3A8J A;  1PJ7 A;  3GEE A;  3GEI A;  1V5V A;  1WOO A;  1XZP A;  3GIR A;  3TFI A;  3TFJ A;  2GAG C;  1YX2 A;  4P9S A;  1WOS A;  1XZP B;  3AD7 C;  3GSI A;  3TFH A;  3ADA C;  1VLO A;  1X31 C;  2GAH C;  3AD9 C;  1VRQ C;  1XZQ A;  3AD8 C;  1PJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...