1VRQC

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
total genus 50
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1vrqC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1vrqC01
1WSVA 3GEEA 1XZQA 3AD8C 1WORA 3GEHA 1PJ7A 1V5VA 3GEIA 1XZPA 1WOSA 3A8IA 3GSIA 1WOOA 1XZQB 2GAGC 1VLOA 1VRQC 3A8KA 3TTGA 1YX2A 4PABA 4P9SA 5L46A 3TFHA 1PJ6A 1XZPB 3A8JA 3TFIA 3AD7C 2GAHC 3AD9C 1PJ5A 1X31C 3GIRA 4PAAA 3ADAC 1WSRA 1WOPA 3TFJA
chains in the Genus database with same CATH superfamily
3ILJA 1KQKA 3BH6B 2EEYA 3OUYA 3H90A 1ZM9A 2EFQA 2QN6B 2BV3A 2VV5A 1LXNA 2Q66A 1YJWS 5CXTA 4KDDA 5D3GB 4CDIA 1G2EA 4DQIA 3AD8C 2RJZA 2V2VA 1TL4A 2DK2A 3NGTA 1J5EF 3MMAB 2ZBRA 1ZQ1C 1R6VA 1KQGB 4PYAA 2UXBJ 3N0CA 4A3FC 2HHHJ 3T41A 5KFUA 1EIYB 2HGNA 3VHQA 5LSOA 3N9UC 3UDVA 4I0WA 2GHPA 2G2OA 2H54B 2GIQA 2ZC4A 1N48A 3BGRA 4RW4A 1NK7A 4NLTA 3KTQA 3R97A 3KDOA 4P6QA 7AT1B 1XNQF 1JKHB 4OHWA 3UW1A 4XSZA 3GU0A 2ZH8A 1KFSA 2ZNYA 4Y28C 3CJ3A 1GXUA 2VUMA 1KWMA 5C42A 3GFXA 4XCHA 3TX8A 3HDSA 2OUGA 3EUNA 2IHR1 1VRQC 3KWMA 4NLWA 2DR5A 3M8QA 2HQIA 4CO2A 1HWJA 4Q45A 5DDPC 1NKCA 4ID5B 1AYEA 3QLHA 5KFLA 2LEAA 4ALZA 2CAJA 3R3TA 1HR0J 1FWPA 4PUOB 2YNHB 3S01A 1X5OA 3OL6A 4RNFA 3TVKA 1BMQB 2C22A 2UZAA 2HWIA 2KRRA 3H2LA 1W2BR 3GTJK 2A18A 2BXJA 4GMKA 4R5PA 2ZBPA 4DLEA 3SSSA 3IM8A 3TWZA 5AJ3F 3IM9A 1ZYQA 2Y1LB 1QTMA 3AB2B 1WHWA 4M5NA 4Y2MA 1C1BA 1LK5A 4CT9A 3D1HA 3OTCA 4JI1J 4WZQA 2DIVA 1RT4A 4WJ3M 2XG8A 3I0SA 3TNVA 1EKSA 1BS2A 1TQLA 4C6AA 1WUUA 3KJVB 2AYGA 2CZVC 4OZLA 2OEMA 4EYIB 2IYGA 3S17C 3KK3A 4YOEA 4WFAQ 1JWWA 5GAGI 5M5YK 3Q24A 4Y2KA 3UD5A 4CP5A 1WCMK 3RZOK 3N5BA 1NHUA 2Q6BA 2RKIB 4WF9Q 2FVCA 2HBQB 2E9TA 4DXLA 1CS4A 1XXCA 3MAHA 3FKBA 3D2WA 5M5XK 4QW9A 4OZJA 1NRKA 3D0HE 3P6YC 2W7AA 3DCAA 3AA9A 4AL7A 1CSJA 3W5YA 1WF2A 3HT3A 4KAIA 4LSLA 2KWAA 3CQZA 1JQWA 3DM2A 4YFUA 3DMJA 3QO9A 3ZTPA 1J98A 3PX0A 5C4JC 3KFWX 2MKSA 4FN5A 5L39A 4J9PA 2A6HA 3D6MB 3T02A 2VKZG 2VH7A 4FPRA 1FEEA 4ZPTR 1J6VA 2OSQA 4ILMA 5KT6A 3EGZA 4KGXB 4P7TA 1SJQA 2DY9A 5HL8A 4Y34A 4NRTA 4K50A 4F50A 3HT0A 3NAHA 2AF6A 1ZBTA 2H51B 4OHZA 2OI2A 3W9JA 3JAMY 2HHUA 3THPA 1IR0A 3S15C 2FJAB 2BJ7A 2LU2A 2V6UA 2B4UA 4M1XA 4YB7A 3BP3A 3VTIA 1SC4B 2WHOA 2MZSA 1R3NA 1XC9A 1HBMA 2R8JA 1PAEX 1BXNA 4ID8A 3B82A 4LRCA 4Q5VA 1X5SA 2PC6A 1VQPS 1U7LA 1TWHK 2DCLA 2BE5A 1YNJA 2Y1IA 1C2PA 3LP2A 4KMHA 4X62F 4LFCJ 1UEKA 4DV1J 1M5KC 5J2QA 1Y1VA 2VZ9A 3DGPB 1B0PA 4JI5J 1S6PA 1NXIA 2O5DA 3R5GA 5ETOA 2LEBA 1EZZB 2AMCB 5DLGA 5DQIA 2ZNZA 3GTYX 4MEYA 1DARA 3MUVP 3TI0A 4A8WA 4I4BA 1WQGA 2V67A 1U49A 5KT4A 1K1QA 1IKWB 5K14B 2E44A 4Y2AA 2XSFA 4CZCA 2RUSA 3QT6A 3I56S 4ELUA 1EQMA 3CNQP 2VQEF 4LRBA 1HBOB 1JLAB 2YWWA 4WKYA 2Y0SD 4NRUA 2ZUAA 1AZSB 3HSDA 1AB4A 3OPFA 4DPXA 2E5LF 4GTBA 1I1GA 5KFSA 1J6WA 3GV7B 1Y0HA 4RL1A 3MEGA 4DX6A 1QVFR 1N5TA 4I2PB 2XS2A 3H3VD 1N5VA 1WOOA 2E7XA 1EETB 1NSAA 1M1GA 4JB8B 4J9NA 4YFKA 4OZ3A 5C24A 3W8GA 4ED4A 1YK9A 1Y10A 4ECWA 4NA3A 2HK3A 4PRFA 1Y3JA 4ICLA 1FO1A 4E8UA 4Z7YA 1U0HA 2BJ9A 4HDHA 5F8LA 3VAMA 4DR5F 1BWVA 3AJ2A 1SJRA 3I0RA 1H3DA 3NBPA 1R0BG 3HVTA 4L74A 1UPPA 1FDAA 2V2QA 2WCXA 1VOMA 1FRXA 1C0UB 1GMWD 4A3CC 1WC6A 4U7UD 3PKMA 2OIHA 3UDLA 4K2XA 1UV7A 4WXWA 2J6SA 3OEPA 2FHJD 5HL7Q 1PBAA 4JI4F 2CPJA 1RT7B 2DVIA 2RH6A 5GAHI 4QQBA 4DR3J 4GVBB 2ASYA 4OV6A 1N5YA 1RT6B 4WP8A 4X4QA 4Z2XA 2HG4A 1DD5A 1VQYA 3C6UB 1HKAA 4LF6F 2G9OA 1BE4A 3W61A 5RUBA 1RTDA 2ZBCA 2JEFA 2MKJA 4X65F 2DHSA 1G3OA 1HNZF 1O51A 3MM9A 1IKYA 2DIUA 4F0HA 4ES1A 3VVTA 3FQLA 2YH1A 2ZJRQ 2L9DA 4OLOA 5D0EA 3HOVK 3V4GA 2R7ZK 4CLUA 5HVFA 2HFNA 4IQMA 1WG5A 4DI6A 3VGUA 2CQ4A 5KFQA 4MYUA 1O2FB 2NVXK 2A6OA 3VR1A 4JI8F 3HOYC 1WC5A 1PJ6A 3TAMB 1JLQA 5A2QU 1J5EJ 5L8RC 5T7LB 4NX9A 2LEPA 1Q4RA 2QE5A 1T05B 1Q95G 1NJXA 2F8EX 4DEZA 4F67A 2ZFHA 2LKZA 5IOQA 2ZE2A 4U95A 3IPJA 1LWCB 4RUBA 1S77D 3M8WA 4W4MA 1BC6A 2IDLA 4MYTA 1FKPA 2JA5A 4DCOB 1YSJA 4UQGA 4F3OA 1RAGB 4G0VA 1XNQJ 3BKFA 1QD1A 5BXIA 3M4OC 5B7WA 1FA0A 3M8PA 5J2MA 1WDDA 2DXFA 1QAJA 1CQMA 4RZRA 5D6GA 1YJNS 2W7VA 3M32A 5K8PA 3M9NB 2BJ3A 2VFUA 5AXNA 3DLGA 1LKZA 1VDHA 1SIZA 4O23A 1N54B 1SQFA 3BV8A 1RB0A 4IDKB 2GVDB 1OPIA 2NREA 2BJ1A 2M3DA 4X4TA 3PKYA 5KAKA 2NVQK 2DEJA 4BBSK 3NS6A 3GJQB 3NWGA 1XXBA 3R5BA 2UXCJ 3H8YA 3GG1A 5KG7A 5HATA 1O28A 1TWGC 2ASDA 1RTZA 2C2KB 5E41A 2VQFF 2IRXA 5MLCV 4JV2A 3L7UA 3RGIA 4GO5X 1NHVA 3IP0A 3RR8A 4DV6F 5AJ3J 3BGLA 3BQ2A 2B9WA 3DLKB 3BBFA 2YNIA 3H0GC 1T0TV 1VQKS 4PR6A 2HMIB 1S1WA 3QSYB 5L38A 3ISNC 4DPUA 1G7CB 3JTPA 4KM9A 4ED7A 2QRRA 4OX8A 2BMBA 1RLCL 2Y1JA 2MHEA 5IT4A 2LVWA 1H2VZ 4F3QA 2MLYA 3S14C 2H5IB 2FHMA 2BVZA 2LXIA 1RWWB 2YQ3A 3L3CA 4BY1K 2HWHA 3NS7B 4OHXA 2DNGA 1NJIT 2RQMA 3M8RA 1R0CB 4CH1A 2V9WA 1C0TB 5HMYA 1VRTA 1VBZA 1DTTB 3A3NB 1PG5B 4NLOA 2W4CA 1VISA 3MFHA 3AOCA 1ZA2B 3OFHA 4ZVPB 4ZPDA 4Q44A 3HLUA 2KJVA 3KUGA 4OV1A 3TEHB 4DX7A 1AFJA 4WU3A 3TZWA 1CJVA 4CNZA 2R7SA 3M7VA 3PYDA 2PA3A 3MAQA 3MCOA 3K8WA 2IC3B 1X60A 1HNWF 1RT5A 2E2JC 1DY3A 4KO0A 5EWGA 1WQFA 1Y3KA 5A76A 5C2GA 4KC5A 3NY0A 4DR1J 2VONA 1IR1A 2HHPA 2OPPA 4K4XA 4Q2MA 2XI2A 1DZ5A 3AJDA 3JS9A 3GLJA 2P5MA 2Z2MA 5JUMA 3N4WA 5K20B 2LCWA 5M5WK 3JSMA 2HHQA 1L3KA 4QOTA 4K0KJ 3L7PA 2HIYA 3UR0A 4XO0A 2BKNA 1EHWA 3DYAA 5HVHA 1TWCK 4NOHA 2H9ZA 1U2RA 2MLXA 5DLFA 1WIHA 2QLBB 4DF8A 1REGX 1HIYA 2IBKA 1NZAA 3MM6A 4PWDA 2OO4A 1NDLA 1XJWB 5G0RB 4DV3F 4K4ZA 4OZ2A 3AD9C 5KFFA 5D4DA 4DQPA 4B02A 3TQEA 2UXDF 4I1TA 3S16C 2AU0A 2YX1A 1WORA 5A6WA 3QATA 3Q89A 4AYBD 1EI6A 5LJ5Y 1HPZA 1I6VA 3TUZC 5F8JA 3BGRB 3LH2S 2VA3A 4RW4B 3OTDA 4E98A 4IH5A 3TFJA 1ZETA 2KH9A 4C11A 2GHWA 1H2UX 2XTJP 5C42B 4ILLA 1MN7A 2B63C 2QEXS 3S1RC 3W7BA 3K89A 1SL1A 1S1XA 1HYSA 3M8QB 3KLIA 1JK9B 3CCQS 3MMBA 5H9FJ 4WPAA 3OVSA 4FS2A 4A3LK 3IRXA 4ZOSA 2P9GA 3R27A 3QLHB 2Y3YA 3Q0AA 2UVUA 1V3SA 4GZYA 1E6YA 2A6MA 2AJFE 2Y3PA 4ZP7A 1RKIA 1SC3B 5JXSA 1CJTA 2KG0A 4J9OA 4F4XA 1RAIB 5A8RA 2CUYA 5KFXA 3T1YF 1X4CA 3OFGA 3I4HX 4LF5F 4B3RF 1P1TA 2UVRA 4R5PB 1U48A 3G6YA 3AOAA 3PR4A 1KTQA 3QPIA 2BUNA 3DXBA 2KZZA 2Z57B 1D9FA 1C1BB 3HOZC 2UUBF 2SXLA 2JC0A 1H6KX 1RT4B 2ZD1A 1IQ0A 1MLAA 2DHXA 4USKA 3I0SB 5E5NA 6AT1B 1C1CA 2HVHA 4DR5J 2VUMK 1G51A 3JAMU 2ILZA 1H72C 4PG7A 3KK3B 4FP9A 5KG1A 4YR0A 1WEXA 3KHHA 1KONA 3C6TA 3ZNUA 1UVJA 2W9CA 3QGPA 3ZZOA 2V4JA 5IYCC 3H5SA 2M2BA 1WG4A 2GNKA 2OPRA 1CS4B 4L75A 1ZA1B 1I3OB 2V5HG 2RNEA 1CQNA 3PY8A 2DR8A 1WI6A 1TKTA 3KXDA 3HD2A 3Q8SB 3NOGA 1FTRA 3RRHA 2MY8A 4BXXK 4OINA 3ET6A 1N34F 2VL1A 3DM2B 2VIHA 2R93C 3DMJB 5CYQA 3QO9B 2DJWA 4LF6J 2HKEA 2K1RA 4DV7F 2XLKA 4PPZA 4X65J 1Y9OA 4OYAA 5D4PA 1HNZJ 4TYBA 4FKXA 3RJMB 4CLKA 2ZDPA 4BY7K 1TKXA 2OKQA 2CA9A 4OX7A 4DR6F 4TLRA 1RAJA 2HAFA 3OPKA 4KRWA 2E5IA 2C2OB 3J80Y 1T9XA 4DV2F 4JI8J 1T02A 2E1PA 2GCFA 2V69A 4NXNF 3W2VA 2KFZA 2YNFA 2ZJPQ 4F2SA 4CLLA 4RBTA 4FKYA 1X4EA 2CKWA 3BPDA 2XMWA 4K5RA 1MSWD 3KK1A 2ZDOA 2QO3A 1Y1WC 2EBBA 4HTIA 1HBMB 2CQCA 4F2RA 2C2NA 1ZM4A 3GTPK 4EI2A 2MDAA 1YQHA 3GPAA 4GTAA 2Z56B 4LRFA 2FVSA 4FYVB 3CQZK 4EYHB 1JX4A 2UUAF 4PG4A 2WZ1A 3LP2B 3QIDA 1QSLA 3OREA 2FIUA 5J2QB 1DCPA 4P9SA 1O6XA 4QYZK 2PN6A 2JA7K 3CCZA 2JSXA 1TU0B 1S6PB 1Z4UA 4JV5F 4LRDA 4DZDA 3TRGA 4KARA 3DOKA 3D66A 2NVTK 5CQGA 5DJBA 3RW6A 3IO1A 3CIMA 1SQEA 2XYHB 5F8IA 4DR7F 4N8NA 3J7YI 3J7ZT 2BM0A 2IM2A 1IBCB 2CFAB 1KDNA 4D3GA 2QJ3A 2YKQA 5F8NA 3TANA 3RZDK 3TAPA 1TK5A 4MFBA 1NUEA 2OD6A 2NUUG 1KEKA 4CO1A 3OTOJ 1H7WA 2JLGA 1KTVA 2C3OA 1B99A 4A46A 2NXNA 4DV6J 4ZP6A 5B0FA 4QR2A 2KT3A 2IPOB 3MEGB 5LMNJ 3BZQA 4LVOP 2W2NP 4A8FA 2ZZTA 4IR9A 2FUG9 4ERDA 4BC9A 1S72S 2R4FA 1EJ7L 2FZKB 2ATCB 2V2KA 4ICLB 2W25A 2MZ1A 1U0HB 2CPDA 4O3QA 1KVKA 1RZMA 2EG1A 3LAKA 4HVZA 1Y1VK 3I0RB 1VQMS 2DGSA 2EK1A 2PI5A 1S0MA 3NBPB 3HVTB 2FLLA 2GHVC 3HSJA 1QSYA 4PXBA 4GO7X 3Q3QA 4NCGA 3T6JA 1KQ4A 4JP8A 2F4VF 4WIQA 4C3MA 3Q86A 3HFZB 1RHRB 3Q23A 4CH0S 4W92B 4LR7A 2UVWA 3GTLA 1FRIA 4AT1B 2CZ4A 2D9OA 1IW7A 4ZVTB 3QJLA 2HEKA 1OQ3A 2L41A 1FK9A 5ITHA 1D1UA 1GQEA 2QMXA 3SV3A 1BHNA 1N5YB 5FD1A 4A3IC 3GG0A 4NXMF 4O3PA 2B56A 2XMTA 2YWFA 1NCLA 4F36A 3PW4A 3MPYA 4XLNA 1HNWJ 3ZTQA 1JVIA 4A3MC 1F3FA 3UO0A 1JB0C 3M2RA 3M6XA 3OW2R 3V6KA 4YY3F 3MM9B 2RQ4A 1IKYB 3J81j 1YRXA 2HQ3A 3EGWB 4PXCA 3I5BA 5KFBA 2GSUA 1HI9A 5F8GA 2CNKB 4NPOA 5KG5A 2CQIA 3HZGA 4C3JK 3DRYA 3CSKA 3MCMA 1EB0A 1AT1B 1XR7A 1RWXB 2Q1LA 3Q8PB 1JLQB 2DGXA 2RILA 3MR7A 3P4UB 2JEJA 3KLEA 3WQPA 2R7UA 2VBYA 1KOOA 1NSKL 5KFYA 2ADCA 5C44K 5HJYA 4LVNP 3LPEA 3H2UB 4DV3J 4DCJB 1YRTA 4URSA 1XZQA 3CDEA 2UXDJ 2BBEA 3HCXA 1FKPB 5HO4A 3FEYB 1NPPA 3MPUB 3BPSP 4FXDA 4N7TA 3M8PB 3CULA 5J2MB 1F7VA 3KUEA 3CB4A 4HKQA 3N5FA 4QJVA 4DV5F 3ONQA 3M32B 4UUWA 4X66F 3DLGB 1XPPA 2WTFA 3VAHA 1JXVA 2XYGB 4H4MA 1QLNA 3OTEA 1D8YA 1ZS6A 1I6JA 2MQOA 3QJPA 1TWGA 1TUVA 5AT1B 4BBRK 3DXSX 4FNIA 2MQLA 3FZBA 3S1QC 1T9VA 5T41A 4RO0A 1S97A 2MYFA 3D4JA 4JYAF 5A8WA 2DNOA 3ZZUA 1BQMA 2CQBA 2AGPA 4QIEA 1O26A 3PYEA 3R1LA 3AD7C 3T1YJ 5DM7Q 2CJQA 2RD5C 4RUCA 1CULA 4LF5J 3T1HF 4B3RJ 4J9VA 4UY8T 3H0GA 3TZYA 4ZVQB 3CCMS 2HS4A 2IMOA 2YX7A 5D0HA 4G0WA 3AXKA 1RWUA 4DL0C 2YNIB 4B3SJ 3K58A 3D67A 2UUBJ 2JA5K 3HHLC 1HWLA 1S1WB 3NAIA 5IT0A 2B43A 1R0AA 5BR8J 1X4BA 3FZ2A 5KG0A 3OFFA 2XNRA 1OPZA 4XAKA 2R7RA 3HOXC 2DXDA 2KKHA 4M5JA 3A12A 5TJ3A 4DU8A 4ZIWA 4FZVA 2NXEA 4LF1A 5IYBC 3VVUA 3RBZA 2QA1A 1RGVA 1UEVA 1TWAC 4OZ1A 3NGDA 1Z2ZA 2WVBA 1UEUA 1VRTB 1Q8KA 5HLFA 4WTOB 2GFFA 1RTHA 1GAOA 2DRBA 8RUCA 3SQGA 1UFLA 2DEIA 4LQYA 1U1OA 1FDDA 1P9YA 3GJTB 1XZPA 2HFUA 3MD1A 2LDIA 1FJ7A 3PNIA 4Y2IA 1VJQA 4DL6A 3J81U 1WKJA 1O24A 1RHQB 4AL5A 1UP1A 1CJVB 2VG6A 2CQGA 1U02A 1N34J 4DZ6A 1RXOB 4ZPAA 3MI7X 3BKUA 1GX5A 1RT5B 4O3SA 4KO0B 1U6FA 2K3KA 5LJ3Y 4DV7J 1FD2A 2UUCJ 5CCLA 1O8BA 1CC7A 2OPPB 1XMOJ 5AXMA 4QWAA 2AQ4A 4DL4A 5KOWA 1A6LA 4TLQA 4BY1C 1Q8BA 3JSMB 1RLDA 1U0SA 1XIQA 2XZDB 4DR6J 1JJHA 1LFPA 4J9KA 1W25A 3D0IE 2F8HA 4FF3A 2OHDA 4U96A 1TV6A 3DYAB 1KP6A 4USWA 2UV8G 3AFGA 3TEGA 2QSFA 5HMZA 4NMLA 4DR2F 4PEOA 4NWBA 1SXLA 3MM6B 4QPTA 4PWDB 3PX4A 2HYIB 2E1RA 4HI1A 3R5JB 5LT5A 2R92C 2M8HA 4CWBA 2HIQA 2IRUA 3M2VA 4KN4A 1GMWA 2JZ5A 2KG1A 2RS2A 1HQEA 3WDOA 3WBZA 2FHJA 3LQVA 1HPZB 2CQ1A 3PDNA 1NB2A 4EFAC 2EVZA 2ZZNA 4KMUA 3PEHA 1IJFB 2B63A 2UUAJ 3KDNA 3GDZA 4HH1A 4FPIA 3SEOA 2JWNA 4C11B 3FKIC 2H1YA 4LQ3A 2J5AA 3CGIA 4XDCA 1Y7PA 1VQ9S 4RW9A 3CWJA 2R3VA 1S1XB 1FXLA 1ZOTA 2R8KA 1HYSB 1FEHA 1FXRA 3LAJA 4DS4A 3KLIB 1VQOS 5IOLA 2HVEA 3MMBB 5E3CA 2M5YA 1X9SA 4AFFA 2WW8A 3IMQJ 3IRXB 3CDWA 2ZHOA 5L9XA 5CHCB 1S59A 4NEYA 4DR7J 4A3FK 2EG2A 5ETQA 1E6YB 4RNMA 1VHFA 3K57A 1VI7A 1F60B 1WKLA 4GRSA 3F73A 3KJFB 2K7KA 5A8RB 2G1DA 4USTA 4B9LA 1GK8A 2AYBA 5C25A 4HHUA 3BBCA 1SJFA 1HLWA 1OSDA 2PMZD 4ZVOB 1MG7A 4DQRA 4P5BA 2G2ZA 1OYDA 5IC4B 4B9UA 3DLEA 2QX0A 3QRQA 2HZCA 1TP7A 5F8MA 1S49A 2ZD1B 3PIPQ 1URNA 3VAJA 4J9MA 1UJ4A 3GFYA 3J80U 2EC2A 1HHQA 1XEZA 1C1CB 3DC2A 4M5MA 3SI8A 3DKDA 3B54A 3MCSA 1TMJA 4OYXA 1EQRA 5CAAA 5DDRC 3HFVA 1U1MA 3AA8A 1BGXT 3GEIA 3C6TB 5BYRA 2FQOA 2W9CB 4DSFA 2VB6A 4MIWA 3DU5A 4C8KA 2F65A 2V4JB 5C3EC 3IRWP 1S99A 2OPRB 4QYRA 1KKHA 2XMUA 2BABA 1J27A 2F8MA 3AHPA 3BN4A 4DOZA 3BM7A 2WSEC 1HWIA 1PIEA 3UNYA 4OFZA 3SDEA 3PW7A 1F9NA 4N77A 2FQQB 2R93A 1RBLA 4TXSA 3M8YA 3SFUA 2DITA 1KFDA 3ET6B 3CD5A 1FJGJ 5CYQB 2K1RB 2VC1A 1S0VA 1NU4A 1D3WA 3I87A 5KFVA 1VQSA 2GAHC 3FOFA 2YPZA 2R8IA 1HNVA 4BWJA 1I3QC 3GTQC 3BBBA 2CNLB 5F8HA 4A3DC 4BDPA 3BSCA 3S17K 4WP3A 3RW7A 3HM9A 4IUFA 3LP1A 1TKXB 4EEYA 1P9QC 4RLEA 4CLYA 3HKWA 4YHHF 1I50C 4FF4A 1H98A 1JIHA 5AE1A 3C16A 2AX0A 3GTOC 4IH6A 2WAQD 2YKNA 4RW7A 2HZAA 2ZKUA 4MKYA 3W2VB 2YNFB 4YQWA 3CMES 2QFIA 4HT7A 2UU9J 4LIWA 1Y1WA 4ETZA 5IXUA 2J6TA 4J91A 3PCOB 2NXUA 3NXZA 2XULA 3KK1B 3GV5B 1H73A 3RU0A 3DRSA 2ZOMA 3TJ8A 2JRSA 4C97A 1ZTWA 1WJ9A 1PILA 5C4JK 2M4MA 1FRKA 2U2FA 1A7GE 3UN3A 2C3PA 2MHNA 2GIFA 2NLWA 1VFJA 2YKMA 3ZTRA 2B4OA 2WSFC 3THTA 3SZZA 3HSZA 4DV5J 1AUDA 1SKWA 2AZ3A 1X5TA 3A3PB 1S9EA 4B9SA 4X66J 4F4AA 3HHKA 4EU0A 4CLFA 3E8OA 4EWTA 3G4AA 2KDOA 4OYOA 3DOKB 5EUHA 2ACYA 1NK6A 1HWKA 1S1UA 3U27A 1MNEA 1RTIB 4K7QA 4XSXA 1S12A 3LA0A 3S15K 4USUA 4WU2A 1RUSA 7FD1A 2XS5A 2IM1A 4JYAJ 1S9FA 4ED1A 4IO9Q 1S6OA 4MFBB 3EXCX 2C2DA 2XBPA 3T1HJ 3GTPC 4KY3A 1IM4A 1MWQA 1DAXA 4IOBA 4GC6A 4TY8A 3W64A 1QUVA 3OXFA 2HRTA 1PO6A 2OEKA 3EZUA 3IG1A 4YUDA 3GFZA 4ZMMA 1PYSB 1SFOC 4J3NA 4J90A 2DTJA 1WG1A 4WP9A 2EFGA 2WVEA 4FS1A 2EPIA 1S4EA 3TQ1A 3OQ2A 1L3SA 5HMWA 2RHSB 3DLJA 3V81A 4HH0A 1U2CA 1IS1A 1RADB 2NUHA 3DI6A 5M2RA 1KOHA 1HW9A 2J0WA 2XZWA 3LPYA 4NCGB 5LSRA 3IBFB 3MPVA 3LANA 1NLKL 4I69A 2E9RX 1HBNA 3AH5A 4OL8A 4OX6A 2JL9A 4Z7CA 3HOUC 4B3TJ 3QRPA 1F9HA 2BX6A 4IYQA 4RBVA 2G0JA 2QYCA 4X64J 1JMTA 3J7AN 1FK9B 2FVQA 4PQAA 3R2DJ 2LXFA 1LWEA 4RWXA 3QRRA 2KXHA 4WYWA 2P6SA 4DFJA 2X1FA 1BY9A 4ETXA 2KM8B 3FGVA 4LR2A 3G82A 3W1YC 2RRBA 4IOCQ 1N33F 3W60A 4AXJA 5KG3A 2R8HA 3M2RB 1YWXA 4TKTA 1UFKA 3G2XA 1JLEA 3QYYA 4ZITA 3CMAS 2V0NA 3PZPA 1VQ8S 4PWUA 3V6JA 4DFKA 1DTQA 3VQSA 4R0EA 3ILOA 1C4AA 5IV4A 2GW8A 4G7HA 2M70A 4DDQA 2FY1A 4Q5SA 2RMLA 3W63A 1HR0F 3JSTA 4A3CK 1FFWB 2JA6C 5ETPA 1RAHB 3NRBA 2PO4A 4ZLLA 2EK6A 3EPGA 4DR2J 3ETMA 3KLEB 2HW3A 2HBRB 4LF2A 4NYPA 4OI4A 3MR3A 2VFRA 2UVVA 1WHVA 1OS5A 4MTPA 4DU7A 5F0WA 1XZQB 4JI2J 3M6WA 5LXYA 4N76A 1X4DA 4A3BC 1K0TA 4N41A 3QFWA 1INNA 3MXHP 1PKUA 2XY5A 5ETNA 4A3EC 4FDFA 2BEFA 3W9HA 3KUHA 2R7ZA 2OELA 1W26A 4IOAQ 2DNHA 3E2EA 2XNQA 3HD1A 1PYOB 2KZMA 1IN0A 3EJMA 1NJYA 1WF1A 5D4OA 2ZH3A 3P96A 4QJVB 4LBIA 3WC2A 2ZOGA 2B9XA 3MEDA 1YJRA 2AV5A 3HXAA 4H4MB 5GAGU 1IXKA 5CYMA 2HBYB 2F1FA 1OY6A 5EGYA 3OJSA 2M9KA 2GJFA 4PG5A 4NEZA 3ZFVA 4KAWX 3GQCA 3SZ2A 4JV1A 4YR2A 1CBKA 2CPXA 3U02A 1MWYA 4WIIA 3M1VA 1ZBSA 4NLDA 5A8WB 2H5JB 3H7HB 1BQMB 1YJ7A 3CMQA 5LSLA 4O0NA 3EZ5A 1RT3A 2EFNA 4H4KC 1CULB 1YKWA 3PXGa 2CVIA 2XZTB 1EP4A 3HHLA 3A1YG 2W2QP 2QL9B 4OJHA 4KE5A 2VODA 2G1HA 4TN2A 3M4OK 3M8ZA 1NMEB 2PDAA 3BO3A 5H1SV 1RU2A 2NZ4A 1X4FA 4IG0A 4QIGA 1R0AB 4A93K 3H42A 3TX0A 1C0AA 1XQIA 4K5SA 4LJZA 4DSEA 2KYZA 4OX9F 7FDRA 3V4MA 4C8YA 3FBFA 3G4CA 3G71S 3GYNA 2QYGA 1TWAA 2KB2A 1OJ4A 1BLUA 4NLXA 3NG8A 1S1TA 3IXQA 2G0IA 4EO6A 9RUBA 1NZ8A 2DNYA 2DGWA 1D0EA 1B4BA 5HLFB 1FX2A 1NBEB 1TWGK 1RTHB 4KJIA 1BQNA 2J9CA 3SQGB 2CADA 3BYPA 2HVDA 2RF2A 5I4MA 1TKDA 4V19X 3O3LA 4I2QA 3MR6A 1XZPB 5HP1A 2MJNA 4M63A 2RE1A 1L3VA 2R7TA 3OSNA 4O2DA 1N6QA 5ETVA 2QA4G 2RB7A 2VG6B 1TL3A 2DPJA 1KLMA 2HFSA 3H0GK 1R9TC 1UPMB 4JI0F 1HD0A 1B70B 2NPFA 1U1NA 3D28A 4MMOA 1R8BA 4IFYA 4JI5F 2B3TB 4P2SA 3GIKA 4G65A 4RBUA 2N3OA 1ISEA 3GWCA 3PACA 1IKXA 1Q16B 1YBTA 2DH8A 4O0IA 1F5BA 3PO2C 2OD4A 1NHKL 4ZPWR 3CD6S 2DO0A 1M5SA 3S14K 1Q79A 5KFPA 2ATLA 2E1MC 2CVEA 8ATCB 2V8VA 1VBKA 3RAXA 1T03B 4XPEA 1JNZB 4YHHJ 1YJUA 2DR9A 1TV6B 3LPXA 1NM2A 3DDKA 1U1KA 2R92A 5E3RA 3DHXA 4LREA 3A13A 1NJWA 1J5OA 2OJ3A 3AY0A 1CEZA 5DZ6A 3MFIA 4ZJQA 2CWXA 1SC6A 5FJ8K 2V34A 2HQGA 2CNNB 1RYRA 3M2VB 3CUNA 2XMJA 3BGOP 4C9DA 2V63A 2CQDA 4USMA 1HQEB 2RAQA 5DM6Q 2XLIA 2QL5B 4Y65A 4DX8H 5DQGA 2E2JK 3FKIA 3W5ZA 3ETOA 4LFBJ 2C2MB 1RBAA 5IOSA 4QYZJ 2BDPA 1KHVA 2LP4A 2ADBA 3L4KA 1I6HC 1NK8A 1R8CA 5IP7C 4WWSA 4RW9B 3TJAA 4P2XA 4YB6A 4J5OA 1XR6A 4YEAA 5LMUJ 3K59A 2Z8QA 2E2IC 3FEZA 3SSRA 4LFAF 2VUGA 3MECA 1ZAWA 4G3IA 1QM9A 4YG2A 1WKKA 3MTKA 2CZ9A 4DSJA 1H74A 4ER8A 1X4HA 4DSIA 2H4WB 4RUHA 1HI0P 3PJWA 4NCAA 2E29A 2XMAA 2I2YA 3C19A 3CCLS 5GAHU 2HZVA 1USOA 4WK1A 3S16K 4C98A 1XBWA 4P5AA 5C25B 3BR8A 5KFGA 2Q79A 1F9FA 2B8PA 2HFVA 1M90T 3M30A 1SIWB 5J1NA 3TA2A 1OWXA 1VC5A 5L9NA 5BYSA 2D3ZA 4NLQA 1RWNB 3DLEB 2Q3PA 1GNKA 4A3GC 3NGUA 6FDRA 1JLGA 4QBUA 5L46A 2B63K 3R5AA 3S1RK 1Q78A 1R89A 1OMSA 4CYUA 3I9ZA 4QZVB 3BO2A 5CYJA 1SV5A 1VQ5S 2EFOA 3QQCD 3VGSA 3G8QA 2I5JA 2PPBA 3P49B 2J7KA 3O44A 3LGHA 4CO0A 3VCDA 4DX5A 3S0XA 5KFDA 1X5PA 4DSLA 2RRAA 4L6V3 1Q7YT 2DD8S 1ZVUA 5KFKA 1DLOA 2GQQA 4FYWB 4KSEB 5CZVA 3SDEB 3NUHA 2X7IA 3ENAA 4NMXA 2KI2A 1F93A 5EWFA 3IWLA 1NDKA 3T6BA 4WJ4A 2DY1A 5F0UA 4G7ZA 5HQLA 4HR2A 1I3QA 3HOZK 3GTQA 5FLXU 3CDBA 4KH0B 3DLLQ 3B6BA 5B0EA 1N33J 1SH3A 5FJ4A 1HNVB 1YTYA 1WI8A 4ZP9A 1ZYRA 1IVZA 1RI7A 1KVJA 2E5JA 4BC7A 1I50A 4B9MA 3LP1B 1DQ8A 1JLBA 3GTOA 4C2MC 2HNZA 3RR7A 3L7OA 2X51A 4N47A 5DDOC 2UXCF 5IYCK 2L3MA 3C16B 3M8SA 2YKNB 2HQDA 3FBEA 4RW7B 2MGZA 1B0VA 1ZAXA 3FRZA 3LGNA 2VG7A 3C15A 1VCTA 2ZBQA 4M5LA 4LBHA 4G0UA 1MMDA 2J7WA 1URRA 1T3OA 1IL2A 3UQSA 3FBCA 1WC0A 3DRSB 1TAQA 4Y2CA 1IKVA 4WFZA 1R43A 2R93K 3PO4A 4WYLA 4C8MA 2QLJB 1X4GA 4EZ9A 4EO8A 3WHIA 1S48A 4OYMA 3IR7B 2ROGA 2YKMB 1GT8A 3KJNB 4O3RA 1RCXB 3CPWR 1D8ZA 3TUJC 2QGFB 3K5NA 2XY7A 4K59A 2FZCB 2N7CA 3KKFA 3DRPA 3I96A 3OFEA 2QLXA 1S9EB 2VPYB 2HHSA 2EBGA 2D69A 3R2CJ 2HRUA 4YR3A 3D6FB 5GADI 1XTZA 3PTWA 1FCAA 1S1UB 1JLFA 1V5VA 4Y3CA 2PMZL 1IM6A 3SCLE 3LALA 2WONA 1GH8A 2B9YA 2BQRA 2NVYC 5IOTA 2HS3A 4XDDA 3GTPA 4R0JA 4BHQA 1QVGR 4K4UA 4RNHA 2I38A 1LW2A 3ILLA 2YU9C 1Y1WK 1Q81T 4EK2A 2OEJA 5HMXA 2IVYA 4UY85 3VGTA 3QIPA 4DR1F 1SFOA 4TY8B 2OTLS 2PMWA 3I4NC 2JA7A 4CIOA 2V8PA 2IIHA 3KG0A 1RJJA 3K8VA 4LR9A 3I55S 3IG1B 4DPYA 2O01C 5L1LA 2I0XA 5EX0A 3MEEA 1F5AA 4F8RA 4DV4J 3UR3C 1S57A 4KATA 1L3TA 4OX9J 2XGQA 1TL7A 4WE1A 4K0KF 1XXAA 3V81B 2UUWA 3LOUA 3IN5A 3DI6B 1RU1A 3M3YC 4P74A 2MKIA 4USHA 4OYPA 3QWUA 2FJBB 3HSGA 4USIA 2IVMA 1HBNB 3TVYA 3IBCB 4C7QA 2MSSA 1RWOB 2J7UA 2V8GA 2B7BB 3TYTA 1V5IB 3WZ0A 1X7VA 2XCRB 4YB1P 2OP5A 1P8GA 4YFNA 3HOWC 1Q5YA 3BQ1A 5K8OA 5IYDC 1SL0A 1LWEB 1XNRJ 3KK2A 4L76A 4JI0J 2R2SA 3HVWA 4QWCA 4F26A 3G82B 3IA0A 3LTOA 3DRRA 3QGHA 2C28A 4Z37A 2RIJA 5U47A 4KB7A 2DGTA 5D0RA 2BE9B 3ZC4A 2WAQL 1JLEB 3T5KA 3FVYA 4Q2LA 2LQ5A 5C5JA 3GTKC 1BD6A 5LXRA 3GIRA 2MQPA 1DJ0A 1DTQB 2WK4A 4U6PA 1U1PA 2JA6A 1NNDA 1B4AA 2ALYB 1TK8A 3CCES 1N0VC 2XM3A 4X6AC 2B4VA 3ENVA 5IT9U 1EX8A 4H4OA 5DG7A 3HI9A 1I5OB 3CT9A 2HNDA 2IMWP 3PG9A 1UVNA 1O27A 1G6BA 4PG8A 1GE9A 2L08A 5FLMC 5MAOA 3CJSA 2YWGA 3HKZL 1PJ7A 2A2DA 2OFGX 1FVQA 1VC0A 2FLOA 2AYEA 1KQFB 2RDDA 1UWAA 4A3IK 2Y8YA 2QLFB 1N56A 3NGKA 3QX3A 1B3TA 4IRDA 4NCBA 1QAIA 4KPYA 3TA1A 4IO1A 1NDCA 1OY8A 3BEGB 1SJ1A 3OSPA 3R7NB 3NEKA 4A3MK 4NLYA 1R7IA 1X8DA 3JTNA 4CO3A 4HL9A 5KT3A 2CPIA 4C8NA 3W65A 1HQMA 2GVZA 2LMIA 1PC4A 2HFOA 2PD1A 2KO1A 5IQ6A 1UW9A 3MEDB 1WNEA 4M5GA 4IQXA 4M94A 4PWWA 2J9EA 4XK8C 4P7VA 2FPHX 4DSKA 5CYMB 5F41A 4LFAJ 2C1EB 2XY6A 3PW0A 3POTA 2NSCA 1VS3A 3VAGA 1IBKF 3HJFA 4R8UA 2ZHBA 3PJ9A 2EFPA 3MOZA 3M1VB 2E5GA 4H4KA 1RT1A 2BRKA 4ZA1A 4ZPBA 1DCOA 2HLUA 4W98A 4DHVA 4KT0C 4KHPJ 3EDRB 4C3HK 1RT3B 2KN4A 3TFIA 1PJ5A 3TA0A 1NK0A 1EP4B 2V50A 4AH6A 2DISA 3HHLB 3CJ4A 3IS9A 4RR5A 3T5LA 4OI6A 3J7A1 3HHNB 1N32J 3S1MC 3DNCA 2J76E 1AA1B 4Y7NC 1RHKB 4IG0B 3KLHA 1QSSA 1NKEA 2ABYA 2Q6CA 4QIFA 1NPKA 4LF7J 4JK1A 2YWKA 4EUVA 1YVFA 1S1TB 1RQ0A 3FSIA 3G6ES 1P6TA 3S1QK 2BACA 1I51B 5DG9A 4J9SA 1EAYC 1I94F 1PYTA 2B8QA 1BQNB 3BH7B 4ZP8A 3HK2A 2DNQA 4CI0B 2R2UA 4I2QB 5HP1B 4WFNQ 4G1IA 3JB9k 2GO9A 3B4DA 1PGZA 4GKJF 2MQQA 1VGYA 1MU2A 3MM8A 1R9TA 2HSEB 3IC1A 3D68A 1N6QB 3ITHB 4FZBA 2L9WA 3T3FA 1V3ZA 1B0TA 4ECSA 1TL3B 4QR0A 1J6XA 2JA8K 5KFOA 1KLMB 1KS2A 5DRKA 2D1CA 4AL6A 3MURP 3OL9A 1V3RA 4A93C 5KFAA 3CXCR 3P3DA 2Z2LA 4IFYB 1FRJA 2JVOA 4Q0BA 1IKXB 2FLPA 3N3YA 3HOXK 3UD3P 3SMZA 4P71A 1UAWA 4EZ6A 3I4MC 1OSCA 5IYBK 5HI7A 1TMMA 2NS1B 2OLWA 1RA7A 1TWAK 3WODA 1T8EA 2ZH1A 2QTWA 4MEXA 2QMUB 4FVCA 3D1QA 2DNPA 2E66A 1ROFA 4FNHA 2D74B 3WIUA 3J7YU 2O5JA 2JJ4D 1J5OB 3RTVA 1AFIA 4DG1A 3LP0A 3OTOF 1MW7A 2YXLA 2MQNA 2Y0BB 3KYLA 1S6QA 2EI5A 4RX6A 3B78A 1ZZFA 2WB1D 4M8LA 5LMNF 2W8KA 2VBWA 4PXDA 2N4CA 2ZVSA 3BYRA 3M2UA 3MMLB 2FJDB 1IUJA 5IP9C 2KT2A 2VFVA 4EBEA 4ED8A 2CQ0A 3Q2SC 3MEKA 4LF4F 1RCOB 3ELHA 2VBZA 2E1AA 3GR1A 4ANEA 3SV4A 2E2IA 3D54A 3R7SB 3KHGA 2J8AA 5ETSA 3Q2TC 2GSOA 2YKAA 2W24A 1TWFC 4LT6A 3VGVA 3QT5A 1WWHA 3MECB 5JFEA 4B3MF 1F2GA 2LQ9A 4ZLPA 1WC4A 1K44A 1IWAA 3V2UC 4A8KA 2IY5B 2R92K 4QU7A 2A3JA 4KC6A 5EWEA 1HQUA 3UPFA 1ELOA 5JVOA 3MDFA 4BLAA 1LEOA 4RW8A 5A0YA 1Y4ZB 1GTEA 2V4QA 3N6MA 5SUHA 3M30B 3RB3A 3K7AC 5DS7A 2XCAA 4RW6A 1IE0A 5EHHA 3OUYB 5AE2A 1VBYA 3FKIK 4PQUA 5ETMA 5M2PA 5J2PA 1JLGB 2WOMA 1UL3A 5KFRA 2QL7B 4DFMA 1W7WA 1LWXA 5J1PA 3DDNA 5SZTA 1Q0NA 3I4PA 3Q8UA 2KFNA 1FWKA 2RS8A 1BUXA 1SV5B 3I82A 4OYWA 2R42A 2I5JB 4DJBA 4JBCA 4DUYF 5IWAF 1U1LA 2R2TA 2CYYA 4LSNA 1NPRA 3PW2A 2FVPA 3ILIA 4ZDNA 4CH7A 3EMTA 3ISZA 1DLOB 2ZITA 3FEXB 2FHKA 1WC1A 4WK3A 3UD4P 1H7XA 4R25A 3J81Y 3F56A 2G4BA 3P5BP 5IM0A 2VA2A 1DBDA 3V4IA 5H9EK 5IC6B 1TKZA 5HROA 4ZVEA 3BP8C 2PGCA 2LLZA 4OHVA 2KU7A 4C2MA 4O4GA 1WSVA 4JI3J 2OTJS 1K8AT 2J0SD 2XMMA 5B0GA 2AJQA 2XHWA 1W2IA 1JLBB 3L95X 3RBXA 2HNZB 3FQKA 1M0SA 2J9DE 4MIAA 1YZ7A 4J9LA 1L3UA 2WSCC 5C3EK 5CH7B 5J1EA 4ZN3A 2MGZB 4PCQA 5GVQA 2VG7B 3C15B 1WDTA 3O8WA 2GX8A 2ACMA 2HHXA 3MTJA 1HL6A 2Z0GA 1VMBA 2CDRB 2PHCB 2W2OP 2CW0A 1ZPVA 2H48B 3H98A 1TFWA 2BQ3A 3CCTA 3IBWA 2OH2A 3P8BB 4OZNA 4KHMA 2ZC3A 5F9LA 1DURA 2IM0A 4MT1A 4B3SF 3EPIA 4LMZA 1IKVB 2MLZA 4IR1A 4GTLA 2QFJA 4X4OA 4YMEA 1FRHA 1NJZA 2VF3A 3RZAA 1SKRA 4ZKAA 5BR8F 3FCVA 4EGLA 2XMVA 1T11A 2YH0A 4TQRA 4DQQA 4OZ5A 3RYLA 1I3QK 4A3JC 3GTQK 1RWPB 4ZS6A 3PW5A 3A8IA 1U1RA 3MD3A 5KFIA 4DBQA 5G4DA 3R9LA 3FCHA 4A3DK 2IC3A 3NLCA 2ZH5A 4YP3A 3TP2A 1RE1B 2OAUA 3QWPA 3N01A 3DRPB 5GMEA 1NSPA 3W3SA 4NYOA 1I50K 5DGBA 3G9CA 1U2FA 3W62A 3GTOK 1JLFB 2NVYA 2CPZA 1IBKJ 2ZJQQ 2RHQB 4N56A 4J37A 1APSA 2WONB 4XIUA 4DUZJ 3SYZA 3VAIA 2YU9A 3MPWA 1NSQA 1LW2B 4JI7J 2Z4PA 4V19J 1A0OB 4LSLB 4LOWA 1X9WA 1N52B 2UUCF 5G0RA 3QIPB 1SCJB 2A0FB 4NL5A 1IQZA 1XMOF 3D9BA 3W9IA 4CLZA 4C4WA 2PFFB 3OV7A 1WEZA 3MEEB 4UOCA 3Q8YA 4CTAA 1C4CA 4DPOA 1TL7B 4WE1B 1TZ0A 1Q86T 1JOEA 3GTMC 4TY9A 2DR6A 3MZIA 2LU1A 4CLTA 3G6VA 3V6HA 3AQPA 1TFYA 5THWA 2V4RA 5F3TA 2C3YA 2W9BA 1CG2A 4DL3A 3EVWA 2EBEA 5IS2A 1I94J 2DRDA 5L1JA 1D09B 2FJVA 1P1LA 2AJ2A 4X4VA 1SJ3P 1JJ2R 3OVAA 2FHOB 2FGCA 4B9TA 3G6XA 4GKJJ 3UCZP 3FFIA 3OR2A 1FRMA 3CJTA 2DNKA 2VHGA 5CABA 3JYTA 3N6NA 2I9SA 3KK2B 1LXJA 2HFZA 1OY9A 4L3NA 1RK8A 3OJUA 2J9DA 4RWWA 1FHTA 3GTKA 3DRRB 1SFOK 2KXFA 4I7FA 2QIFA 2JH3A 2XCOA 3L09A 1MN9A 1HNIA 2LA6A 3ENQA 4EBCA 4JV0A 2H3EB 1FVSA 4BBYA 3PO3C 3GTGC 3K17A 1JXEA 1HD1A 2H4YB 2BANA 4WZMA 2D7SA 2FJWA 1RAEB 3ENWA 2HAIA 4H4OB 3MUMP 5EDWA 2HVZA 3S1NC 2HNDB 4UUXA 3D6HB 1U4BA 3RRGA 5HQ8A 1H38A 4A4JA 1K0VA 2CPHA 2NQPA 2BKOA 3HOUK 2XLJA 3CJRA 5KFMA 2MZRA 2MJUA 1RABB 3PRDA 3MOJB 2BKPA 4RU2A 3CJKA 4XLPA 2GV1A 3C2PA 1N36J 2C3UA 3CCSS 1F0XA 2YWEA 2CQHA 2RH3A 1IQTA 2MKHA 2IFXA 5KG4A 3AODA 3KNAA 5K8MA 3QJJA 2KRBA 4CM0A 3M05A 2ZH4A 4UOGA 4AUKA 5C24B 4NZ0A 3GIJA 1AXQA 4DR4F 5C4XC 3IAM9 4U9RA 1RYSA 2BR0A 3H5YA 4ZPVR 5LOQA 4LF4J 3EICA 2A69A 2GVZB 1QE1A 2M0GB 2Y9HA 2RQKA 1YNNA 2AIRB 1EH1A 2YTCA 1TK0A 3TVZA 3K5OA 1SC1B 1FNMA 3ZO7A 4DL5A 3IWNC 1RT2A 2JA6K 2VASA 3POTB 3UFCX 1M5VC 4M1KA 4BCAA 2LA4A 2MEWA 3KLFA 4B3MJ 4OYIA 2A2CA 1WSRA 3RBEA 4F25A 4R8UB 4Y52C 2Q43A 3PYFA 5L1KA 4Y6IA 2V68A 1AW0A 1ACMB 2X1AA 3GIIA 1RT1B 3OL7A 3BKTA 1Q1KA 2Z30B 2BZ2A 1GMUA 3VALA 4A3BK 1FJGF 3N0VA 4QPXA 3MUTP 3ISND 3IR5B 3UCUP 2BW7A 4A3EK 2AEJA 1RTDB 2FJXA 3BSNA 2BQUA 4UW2A 3RRKA 3IS9B 2EFVA 4ZN1A 3THVA 3PO5A 3NS5A 5B0AA 2RSQA 1VJWA 3CJ2A 1GMVA 3SQOP 2CJ9A 3KLHB 5EGEA 2VPZB 5KT2A 2RDJA 2BW2A 1EFWA 4DMZA 4F4YA 3ZZ0A 3F44A 3LGMA 5D4LA 2VBXA 1GFWB 2VG5A 1DFDA 3H4BA 1F7UA 3JSRA 4DUYJ 2F9JA 5IWAJ 2UU9F 2XWXA 1RHUB 1BWEA 2GQCA 3GJRB 2ZE2B 4RPFA 1S0NA 2POKA 4C3HC 2G13A 1WOSA 4GTDA 4KV8A 4UOHA 3HJVA 3GCWP 3CCUS 2GSNA 5IZHA 1MU2B 3MM8B 3VV2B 5IV3A 2MY7A 2EKNA 2CFAA 3JSBA 2W9AA 2K3IA 2D41A 3PHTA 2BYCA 2ASJA 3GEEA 1WTFA 4M95A 2PIIA 1B4SA 2YWHA 5ETLA 1UKUA 3AT1B 2Y8WA 3FK4A 4L73A 2ROPA 4ES3A 4RJVA 1AUSL 2IVFB 4OIQA 4Q0BB 5GAEI 3KMSA 3E01A 4WILA 2CJKA 2Y0SL 4A3KC 3U1MA 4KGVB 4P52A 1SH2A 3BO4A 2ROEA 4F4KA 3OTBA 2V6AA 4AXIA 1CJUA 4KN7A 4M5DA 2BOAA 3HHDA 3H3VL 5I3UA 4X2BA 5DO2A 4ZJLA 3OXLA 4DG1B 4ZHRA 1GEHA 3WX4A 3LP0B 4TU8A 2N82B 3W5XA 2FD2A 3MMJA 3JXOA 4TYAA 5TMFA 4PPDA 1S6QB 2ZWOA 4I6AA 3CJ5A 1BGWA 3PFEA 1KHWA 1IBLF 2JA8C 2DXEA 2ZUGA 2W1BA 2GQ2A 4UF4A 3M2UB 1R9TK 2JFDA 1J2VA 3BJYA 2HNYA 4WFYA 2ERRA 4ZVFA 4KGZB 1F9EB 3GTLC 4GT9A 1FRLA 4DL7A 5D8HB 4F0KA 4E0DA 4KTQA 4BKWA 2QA2A 2XWYA 1TWFA 3PO2K 2FDNA 1WEYA 3S2DC 2RRNA 5DETA 4CO4A 3Q8VA 1SUQA 2GC8A 1S79A 1E6VA 2NPIA 2OFHX 4UZCA 5CD4A 2YKPA 3CCWA 4WXOA 2KM8C 2D3UA 3RG6A 2HLTA 3OD2A 3HFKA 3FDSA 4B3TF 2O66A 2MSTA 3HX9A 1KR4A 4X64F 3X3UA 2L9NA 1UJ5A 2W2PP 4LF8F 2RU3A 1HQUB 2NXCA 3FUYA 4OIRA 4QIWD 1TR0A 3S2HC 4HACA 4C8OA 2Z58B 4I6WA 3ZNJ1 1WQHA 4P75A 4RW8B 3I5AA 5A0YB 3BB5A 4FYXB 4O44A 1ITPA 1D9DA 1YZ6A 2MB0B 3GP9A 2VJVA 1Y5LB 3MMCA 3NKYA 4RW6B 1VRUA 1I6HK 2YBVA 4PQUB 5J2PB 1N4LA 1BJTA 4YDDB 5C7PA 5IP7K 2WOMB 1O0PA 5EGHA 4ZJOA 2A68A 1JJCB 2CG4A 1RA6A 1XWLA 2FGOA 4LR8A 2AW0A 2E2IK 2F4FA 1KD1T 3R7BB 5E33A 2R7XA 5I3QA 3IFEA 4C0OC 4KASA 4JI6F 1LW0A 3EDQB 2I8EA 4LSNB 1IBAA 2VPWB 4LF9F 4JI2F 2MMYA 3LAMA 1S9GA 3HPOA 1RWKB 2R8GA 4WFBQ 4G7OA 2WRMA 2LXUA 5BJRA 1Q82T 2ZUFA 1T9UA 4HHJA 2BA9A 1AB8A 4J9UE 3M9MB 2V8DA 5IM0B 4A8QA 2OPQA 1ZM3A 4A3GK 3V4IB 1HMVA 4N5SA 4C3IC 1TKZB 4TQSA 5HROB 4OQJA 1PBUA 2IA0A 4I68A 2VDHA 1RAFB 3QZ8A 4QU6A 4F02A 4DPTA 1CVJA 5K9FA 4O4GB 1SI9A 2HGLA 1USMA 1UETA 5I3PA 3RB6A 1N8RT 2MXYA 3GJSB 3NNHA 4BLGA 3VZHA 1QJHA 1K83C 5K5MA 4I6YA 3H5XA 2WB1L 5ADZA 2WBRA 1JLCA 3AQOA 4A8OA 2WVDA 5J1EB 1VQNS 1O2BA 4USVA 1CJTB 4ECYA 3ZZZA 4F0MA 3K7RA 5JVGQ 1SKUB 4ZPCA 5E3QA 3MR2A 2HPUA 4FYYB 3H40A 3ZZYA 1LK7A 5E7OB 4OIXA 3PV8A 4FXVA 3Q83A 3FC9A 4GTCA 3L4JA 4OHYA 1FERA 3CCRS 1F1BB 1K1SA 2MQMA 1KLNA 3EWGA 2R7OA 3CD7A 3TW0A 1S4FA 4DR4J 2KYXA 1M5HA 2MKKA 3IGNA 4X84A 4EBDA 2W8LA 4KR0B 2P9EA 4WFXA 1WD6A 1FX4A 4PKDB 1IJEB 4ELVA 4MIBA 1G1XA 5KFTA 4C48A 4FF2A 4WCEQ 1M5PC 4C2MK 2APOA 2E2HC 2NCKL 2HBZB 2OSRA 2JNJA 3CC7S 1F3VA 3ZZPA 2IJRA 4RUAA 3H25A 3R8YA 1U8WA 4J9QA 1RBOB 1NK4A 4G1PA 2KJWA 1NH8A 3JQMA 3QSIA 1UWBA 2GMHA 3PIOQ 4QWEA 2VFSA 2GZOA 4TU7A 1TKTB 2VDIA 5E3PA 3P45B 3U1NA 4PABA 3HF5A 1Y5IB 1S10A 2OMLA 3NP5A 2GMLA 1YJVA 3LWMA 2YQ1A 4HDGA 3AJ1A 2P8TA 1UMJA 2DGVA 1XMBA 2ZVIA 2MTLA 2LFVA 2IBOA 2AEMA 4I56A 4OIPA 4NOIA 1TTHB 2Z2ZA 2HVIA 3GTMA 4FBTA 4CTAB 5HBMA 3GFHA 4F3MA 3FBBA 3O6QA 2LQJA 3CJQA 3DGVA 4X62J 4AYBL 2DHAA 1QAXA 3DFEA 3NCRA 4ECVA 3G8SA 4USJC 2DB1A 1SQGA 3T5JA 3SBMA 2JEGA 4KHRA 2W9BB 1L5UA 2NVYK 1G4CA 2I1RA 2CPFA 3Q8QB 4OYZA 1R27B 4IRCA 3K5LA 1ICEB 3NGRA 2ASLA 1RHJB 1YX2A 2KVIA 2RGRA 2JLFA 2YU9K 1GTHA 3PX6A 2FYXA 1Z1ZA 4C0HA 4GTEA 5IORA 4K4VA 2F9DA 2DBBA 4LFBF 3FFIB 3OR2B 5DDQC 2YKOA 1LWFA 2EKYA 3ZXWA 3GE9A 3JYTB 2D3OR 3I5CA 3I4NK 1UVKA 2VQEJ 1OYEA 3BDPA 4DFPA 4L72B 3D6TB 1NK5A 4C3LA 1O29A 3IGVA 1QAYA 3R6LB 1TUGB 1HQ2A 3GTGA 3MAAA 2E5LJ 4I7FB 5F9NA 5FLXY 4A8MP 1MROA 2B51A 4K4SA 4LRAA 1HNIB 1U09A 4HTJA 3NMAA 5LL6d 2AZ1A 4AQYF 5LMUF 2HK2A 2QA4S 2PSZA 3NNCA 4K8RA 2BANB 1ZXOA 4GVLA 3F41A 1UVIA 3DRXA 1F6TA 2RQCA 3HXMA 3M3YK 1FE0A 3TOQA 3JQJA 3GSIA 2F7VA 2LQ8A 4ED0A 3ZZRA 5DG8A 3FOEA 3DOMA 1Q53A 1D9AA 4URQU 5DZ7A 3BREA 5HAOA 1R31A 2JX2A 3CJKB 3DLHA 3I9V9 4ILDA 2P2CB 3G87A 3QGGA 3HOWK 2W7OA 4ITSA 2QC3A 5IYDK 1U24A 1IBLJ 4JI4J 1GXTA 1Q5VA 5C2CA 3CAGA 3T9NA 3GTJC 3QT8A 2D3O1 1OO0B 3VA7A 4Q43A 2B6AA 2F40A 3UNGC 2IA6A 3NCPA 2E9ZA 3GTKK 1QE1B 1HHSA 3SZYA 3UCGA 2C42A 4X6AK 1REVA 1YITS 2HQCA 4A8SA 1XERA 1S1VA 2U1AA 3KLGA 1U6BA 5TMCA 4NA1A 1RT2B 5KG6A 3RUBL 4OMFG 4ZLJA 3DXJA 3NCQA 2P9CA 3KLFB 2M8DB 5FLMK 3K5PA 4ED2A 4UT4A 1WCMC 2JHEA 3RZOC 4KB4A 3DLBA 2GJIA 1FNOA 4OJ1A 4ZVRB 5KTQA 4MKBA 2O3DA 4LF8J 5J2NA 5T14A 5D77A 3HHLD 1P27B 2DNZA 3LWLA 4P10A 1SBRA 5GMDA 3PJXA 2GJ2A 3FCWA 1XMQF 4AE5A 2XCQA 2BE2A 3S8SA 1KN6A 5GMKa 2F5GA 2M88A 3EM1A 2KTQA 3EVOA 3T9ZA 1WELA 4A47A 2KT5A 4NI2A 4OYBA 5B09A 4NLPA 4J9RA 4MK9A 3M9OB 3UVJA 2CPEA 3R5DA 5D15A 2JFKA 2P8IA 2YPYA 5AE3A 4MJKA 1MWZA 2N7YA 1RKJA 5FDLA 4F7VA 4XPCA 1S76D 1YG0A 4U7CA 1LFWA 2RU9A 2XYPB 3SCJE 1CJKA 1T9YA 2VG5B 4OIOA 5HQMA 2QG9B 3OL8A 4JI6J 4TU9A 4BWMA 4A8XA 3SSQA 3FMWA 3N28A 5B0BA 4LF9J 4ZCIA 1RTIA 4ED3A 2MZTA 4KV8B 1U1QA 4AD6A 4IG3A 4P72A 1FI4A 3MM5A 2PA8D 4KMAA 3OR1A 3CVKA 2I6WA 2XCPA 3E3XA 5H9EJ 1RP5A 4U8YA 5HSPA 5HN0A 2ZH9A 4UZBA 2E1CA 4P2MA 3S1MK 2VQFJ 2QLWA 2NSBA 4Y7NK 3ICLA 4DF4A 3PVXA 1RWMB 2XB2D 3PEJA 4DS5A 1TWHC 5CCMA 3V6DA 2IDEA 2H5EA 1PSDA 3MM7A 5KFEA 3E01B 3CC2S 4K4WA 1NB7A 3NGSA 3RB4A 1UA0A 5GADU 1X0PA 3N0BA 5E3AA 3Q22A 2V94A 4IFVA 3VZIA 4W90B 4Y00A 2XMKA 1Y5NB 1JNRB 3BDEA 5LM7E 4OI2A 2UUTA 5IT9Y 1CJUB 1F2HA 4M5DB 3PRBA 5I3UB 2VFTA 1T9TA 4ZCLA 2CXEA 4ZHRB 4X4RA 3CF5Q 4UTGA 1VH2A 3G4SS 4MK7A 1UVLA 1TELA 5M3FK 4RNNA 9ATCB 1R8HA 2H65B 1X31C 1FTCA 3U1LA 2AGQA 3H59A 3BGFA 2HNYB 2M7SA 2FJEB 4QIVA 4ENOA 3SIPB 3OT9A 4LQ9A 3MWBA 4DV4F 2DNNA 4DLGA 1FWLA 4X4NA 4URGA 4BLBA 2V6TA 1MMLA 3T19A 4B9VA 5KFZA 4P73A 4GFQA 5M2UA 3ZZTA 2CJBA 3I4MK 1NDPA 4CRJA 1OIAA 1SUQB 1E6VB 3KHLA 3SCKE 3HMJG 1YCLA 2QV6A 3NMRA 3BN7A 1Q8LA 2DGOA 1O5JA 2XI3A 4P2FA 3CW2C 2XC9A 3R1HA 1FDBA 2GS8A 2CG8A 1N5QA 4KKOA 3ERED 2N3LA 2DT9A 5K8NA 4DN0A 3EVMA 1T9WA 3C46A 3L9ZA 3FNNA 4Q8FA 1U47A 1XNRF 4HACB 1S7HA 2KL8A 1QDUB 1VBXA 2FC9A 3MHYA 2B9EA 4YS2A 5I42A 4O44B 2IAJA 3PRVA 4NYZA 5IP9K 4NZ6A 4PXEA 3MMCB 5B0DA 2W01A 4KFBA 3H20A 4CCHA 3NNAA 1IBMF 1VR6A 4CO5A 4X4UA 4I67A 1VRUB 1VK8A 2R7QA 3U7JA 4CLWA 2HHTA 4IKAA 3D7SB 1TL1A 2CNOB 1N0UA 5KT7A 1UFWA 1RHMB 3MR5A 1TWFK 1LNQA 1TVRA 3EYZA 1RDRA 4ELTA 2O5IA 1U8SA 2VICA 3HOVC 2WBMA 1HNXF 2R7ZC 1S6UA 3DOLA 1FD8A 1N5SA 1R8AA 2X3GA 1NH7A 1LW0B 1XK8A 4NLUA 2UV8A 3PR5B 2YNGA 1O25A 2NVXC 1UA1A 2LQBA 5HANA 2DNMA 1S9GB 3D3CJ 4ECXA 3CDAA 3EQLA 2LECA 1SB6A 4ZVHA 2BJ8A 3VAFA 3MPDA 3GB0A 1VIOA 4LK1A 4C0BA 4M5KA 2CJAA 4B08A 2AT1B 2X1GA 3K7AK 1YGYA 3FSXA 2ALZA 4PYDA 1RAOA 2ZFZA 1FFSB 2OPQB 2EWHA 4LBPA 2CFXA 1HMVB 4PZVA 2HRYA 3RB0A 1X0FA 1ZTTA 3EZOA 2GIRA 4YB5A 4AQYJ 4U67Q 4RU9A 1K83A 3LUYA 4J7CA 3CJ0A 2IJNA 3EE3A 2DH9A 2IM3A 2NR0A 4DDFA 4OI3A 4DQSA 5CJ9A 1CLFA 1HBUA 3OHAA 4ANDA 2FQTA 1JLCB 5AXLA 2B5JA 3J7Z5 4HEA9 2E7WA 3K0JA 3QAUA 4B3OA 5E68A 3QFHA 2BM1A 2MZQA 1VQ7S 5KFCA 2MKCA 1TUWA 4ECTA 4KHPF 2B0GA 2NVQC 4BBSC 3W66A 3VQTA 2IRYA 3OVBA 2ZOFA 5KFJA 5KFHA 3GMGA 5AXKA 1FE4A 1EQ0A 2FY8A 4U7UK 1MMNA 2ZUEA 1HHTP 3TUPA 2G2YA 4MQ9A 2RVJA 4ZH4A 1N32F 5F3ZA 1VQ6S 1K47A 4OI0A 1M5OC 2O67A 1Y11A 5A8KA 3K5MA 1YLXA 4RMFA 3TR5A 2R2RA 2XO7A 2C2RA 3F0NA 3W2WA 3H4DA 4LF7F 1X9MA 1SMYA 4KQZA 2E2HA 3T00A 1DCHA 3OLBA 2QT7A 1FKOA 2VC0A 3HZEA 2G0CA 3OLAA 4O3OA 2QMWA 5KOXA 2N4DA 3FMBA 1CC8A 3IAS9 2GGPA 4QIWL 2ZKTA 5KG2A 2VJUA 3GEHA 3MCNA 2MQ8A 3QGIA 4NZ7A 1EARA 2V2ZA 1UWBB 3TFHA 2VKRA 1WACA 3I31A 1T03A 1HI8A 1RTJA 1VGXA 3A8EA 3ZTSA 4DV2J 2HURA 2RT3A 2JC1A 2PI4A 4NXNJ 2YY3A 1VQ4S 3C3LA 2A10A 4MH8A 2AJ0A 1LOUA 1XMQJ 1KRPA 4ZVSB 3GV8B 2ZBIA 2XS7A 1K73T 4I64A 4UQTA 3QZ7A 2AP6A 3LF0A 4A3JK 4V1Ak 3C14A 2C3MA 4JUZA 4ECZA 3N6LA 3TZZA 1Z2LA 2K06A 2BRLA 5HBMB 2E7VA 3CE8A 3HHEA 2F63A 3S7RA 3C66A 2L48A 4MAKA 1K9MT 4N8OA 4ILRA 3A8JA 1Q7LB 4PAAA 1TAUA 5B08A 3AXMA 3I32A 1IWGA 2W7PA 5EN1A 4ZIVA 5E2QA 4ANCA 2DHHA 4JV5J 3RAMA 4L3KA 4G1QA 1V9OA 3JSYA 1TWCC 1KSPA 2LYVA 1NEEA 1Q8IA 2RUGA 2K8GA 2V9KA 2D6FC 2R7WA 1FESA 2RDIA 4WTYA 1FJEB 3FSYA 3H0PA 1LWFB 2PFDA 2DKOB 1UTAA 2O1PA 1AROP 1RSCA 4Q4ZA 2OPSA 3G86A 3MAAB 4ZCKA 4G6VB 4CM2A 1MROB 3SXLA 2XSJA 4ES2A 4DV0F 2CJXB 4KGKA 1FJCA 4QCLA 3SFGA 2XEXA 5IQQA 3MGJA 1FNXH 3GTMK 1RWVB 4A8YA 2E5HA 2GMJA 1LQ9A 2DR7A 4ED5A 2JLEA 2WVFA 5D3GA 1XN9A 2VOOA 3EGNA 1VIXA 4ZLNA 3PYGA 2AHOB 2AD9A 1YDLA 5M3MK 2VU5A 2ZH6A 1UW4A 3DOMB 4A3LC 2CDQA 4S0MA 3MMAA 2B4PA 2C2ZB 4TNOA 1RISA 1O2AA 3AH6A 3GTJA 1ZM2A 2F4VJ 2KFYA 1WTBA 4WKRA 1VJEA 1ZAVA 3HVRA 4FXWA 1RU0A 1SKSA 3VWSA 1HARA 4ZVGA 2K7JA 1SJ4P 1UZDA 2OGUA 2PEHA 3EXYA 4XTTA 3CDUA 1NK9A 2B6AB 3M4XA 5DQHA 3CO9A 4GKKF 1X4AA 2FZGB 1JKHA 4KMDA 2LDYA 3CIZA 4NXMJ 4LUBA 2AJ1A 3BSOA 3PO3K 3GTGK 2ZWPA 1L0WA 5CA5A 2MPUA 4M5IA 4B17A 4JOUA 2W4DA 2UP1A 1REVB 3VF0B 2DGQA 1S1VB 3KLGB 3HULA 3S1NK 4YY3J 5DGAA 3PM9A 1NKBA 2KVQE 2VUMC 1YHQS 1WCMA 3RBDA 3US5A 3TTGA 1B7YB 1LV5A 3QT7A 1EKRA 4ID5A 2HHVA 1S5ZA 2R9LA 1CPZA 1WOPA 3BS9A 2ZM6F 1ZH5A 4M5HA 4PUOA 2CWKA 3WC0A 2JVRA 3S6EA 4F04B 2YNHA 4QWBA 5J2NB 1V6HA 4GTFA 4F4ZA 4KM8A 3GZ7A 4EMDA 1JXLA 2CRLA 1VHIA 4ZK7M 2CIMA 5ETKA 2JEIA 2CQ2A 5C4XK 4D3HA 2BE2B 5ETRA 4BXXC 3EGVA 1IBMJ 3PFOA 1KBRA 4NE9C 3DU6A 3O1LA 1XR5A 4FYDA 3GONA 1ZPWX 1WHYA 4JI3F 3LW5C 4NI2B 1QTNB 1PAUB 3KMQA 3WIVA 3UVJB 3OHBA 3HKZD 3A3OB 2HHWA 4BS2A 2HQFA 3P5TL 4LLGA 5FDLB 3KJVA 4ECUA 3UE2A 5JJBA 2QSWA 2FLNA 3AB4B 1HNXJ 1KNZA 3NL0A 1CJKB 4X4SA 4BY7C 4O4RA 3D0GE 1NO8A 2BE7D 4Y52K 1T95A 1ULRA 1YRUA 4U8VA 1WC3A 4KIAA 4MK8A 3HP6A 3T5HA 2RKIA 2KHCA 1YJTA 1HW8A 3JQKA 3WX8A 4IG3B 4FM9A 3NOCA 3MM5B 1RAAB 4ECRA 1PC5A 1KQSR 3OR1B 1B7FA 4KYZA 3TO8A 2FTRA 4H54A 4CLSA 4QW8A 2JDJA 2DHGA 5D4NA 4NLRA 3TJ9A 1GXLA 1TWHA 2XO6A 3M6UA 2HWTA 4DL2A 2EXUA 3CCJS 2NZCA 2CPYA 2BJDA 2DH7A 3V6DB 5CZXA 4CNYA 2BJEA 3CQZC 1VLYA 3MM7B 3E51A 1T3NA 4KH1B 1UZHA 1VK3A 4C3KA 1HI1A 4NA2A 2X3DA 4DCPB 2JA7C 2ZZMA 4IFVB 4C8ZA 2M52A 1VQLS 5FIIA 2DPIA 4DUZF 1KC8T 2YVSA 4HLBA 2NVTC 2PE8A 1NAQA 4FBUA 4JI7F 4LSZB 2NXJA 4PG6A 2UXBF 2CQPA 2HHHF 4UOFA 1U6ZA 2PEBA 4LJMA 3KG1A 2WB4A 3D5MA 4A48A 2ZH7A 2CQ3A 4KPCA 3RZDC 3O2IA 3UI3A 1DRZA 5JMNA 1VC6A 1U25A 1U26A 1UJ6A 2V8HA 5JVHQ 2IYIA 1H2TZ 4K4TA 4A3KK 3DGPA 1S0OA 1BQXA 1GX6A 2GA7A 2C2EA 3A4TA 3HVAA 1KVIA 2XHCA 3GSDA 3CTRA 2MZJA 3KJQB 1Y1VC 1DHMA 2RF2B 4KKOB 4OJGA 1ZZNA 3BUEA 1R8PA 5H9FK 3GCXP 1H0HB 2KHDA 3CJ8A 1FF2A 4IRKA 1IKWA 5K14A 3GYGA 2BOPA 3H5UA 1R6YA 4YN3B 3BSAA 1HBOA 1JLAA 2AWZA 5I42B 2IAJB 1AZSA 3OXGA 1YBUA 3KOAA 3CD0A 1JJ4A 3QBCA 5E0OA 4KFBB 3GTLK 2DYAA 4I2PA 5ETTA 1HWUA 4JI1F 2PMHA 1EETA 3S2DK 3LO3A 1TL1B 3ULHA 4HT5A 4OLPA 3N79A 4O3NA 5BYQA 1U45A 5HVGA 3FHZA 1TVRB 2HGMA 2CJYB 1WHXA 2MKYA 5CD4H 2NYIA 4KB2A 2NVXA 4ECQA 2PA8L 1YBAA 3DOLB 4Q7AA 4WBFA 2PT0A 3OBIA 4HI2A 4E2FB 3R6GB 4C3JC 2YNGB 1C0UA 1YJ9S 1N36F 2JOQA 3HOYK 3KHRA 3S2HK 4ZCMA 4OJ3A 1RT7A 4ATNA 3EX7B 3ZTOA 3KG4A 1PCAA 2X1BA 3G96A 5C44C 4GVBA 2ZHAA 5A6PA 3D1OA 1RACB 3UN5A 4DWIA 2GO8A 4K4YA 1RT6A 3UWTA 4ZVUB 3B4MA 4NLVA 1F5CA 2K2PA 4IH7A 2DGUA 3C6UA 4HYKA 2J0QD 4CT8A 2YQ0A 3LAPA 3VAKA 3PHEA 3ADAC 5D78A 4DV0J 1DQ9A 1S7IA 3BGUA 3JTOA 4X4PA 3KLVA 4CLPA 1T94A 2DCUB 4Q8EA 2GAGC 1VLOA 1HBUB 2DRAA 2OMOA 3AAWB 2ZEJA 2P6TA 1A9NB 2DNLA 2V6SA 1Y00A 2B5JB 3NWRA 1JQGA 4B3OB 2IJFA 4MKAA 3TAMA 4C8LA 2ILYA 2YX4A 3D3BJ 5T7LA 1IR2A 4BBRC 3T01A 1SH0A 1T05A 3BF4A 2J8SA 2QZ8A 5KFWA 4GC7A 3T1AA 4Y0FA 1EK8A 2P5VA 3A8KA 1LWCA 3V5RA 2J6UA 2F3JA 1QUPA 4QWDA 3DHWC 3MF5A 1M1KT 3AOBA 4NLGA 5A8KB 4GKKJ 2VOPA 2NYHA 4C3IK 4FF1A 3C8YA 4NLSA 2AKWB 3W2WB 1VYAA 3ITHA 2WW4A 2R7VA 3TZXA 1FXDA 2D9PA 5HJXA 2WVCA 4CYUB 2AX1A 2JA5C 2AJ4A 1HA1A 1FKOB 4LFCF 4DV1F 2W4PA 3UN2A 3SCIE 3TAQA 4K2JA 3QNWB 1K83K 4B9NA 3GYXB 1UCNA 2GGPB 3RAQA 3TUIC 4YFXA 2ZH2A 1SVDA 2HS0A 5D0GA 4NASA 4IDKA 3X1LB 3CCVS 2GVDA 4ED6A 1TL5A 1FKAF 3BR9A 5KFNA 4DUTA 3QMQA 2ZM6J 4WJBA 3KNGA 3R5CA 1RTJB 3BQ0A 4TVAB 1FDNA 2KXNB 2XGPA 3GIMA 2EC0A 2J0XA 3Q8RB 3CO0P 5A2QY 3FJ2A 1QY7A 4OI1A 3O5TB 4RKUC 5KT5A 4HHHA 2W2MP 1SL2A 5CHPA 3S1TA 5L1IA 4KGMA 3DDIA 3DLKA 3GILA 3C14B 2A1BA 4OZ0A 1M1HA 2HMIA 4F4WA 2FC8A 5GAEU 3H2VE 3K2YA 2FVRA 3G8TA 2Z2YB 2E2HK 2VPXB 3QAEA 2A6EA 3IR6B 1HFEL 1N88A 3UDEA 4RNOA 1YIJS 4CQ1A 3B8HA 4KBIA 2B7CB 5EX3A 1TWCA 4LK0A 2DO4A 3I6PA 3L4BC 2EW9A 1UVMA 3UDCA 2AEFA 5IFMA 4G1QB 3CC4S 3M6VA 4YDXA 1WF0A 1C0TA 1FFGB 3DN9A 8AT1B 3CEDA 3HO1A 2VD3A 1DTTA 4LIRA 4DN9A 3FRYA 3IWXA 4DPWA 6FD1A 2AGOA 2XQCA 1YI2S 2Y1RI 4MKVA 1B64A 5B0CA 4DR3F 1OQ6A 1DQAA 1SPBP 5HK4A 3GR0A 1T7PA 3W8PA 4FVMA 2FB0A 1BDFA 2DNRA 2COLA 4C45A 4QR1A 2OPSB 1FT8A 2AYMA 2XSJB 3TARA
chains in the Genus database with same CATH topology
1WSVA 3GEEA 1XZQA 3AD8C 1WORA 3GEHA 1PJ7A 1V5VA 3GEIA 1XZPA 1WOSA 3A8IA 3GSIA 1WOOA 1XZQB 2GAGC 1VLOA 1VRQC 3A8KA 3TTGA 1YX2A 4PABA 4P9SA 5L46A 3TFHA 1PJ6A 1XZPB 3A8JA 3TFIA 3AD7C 2GAHC 3AD9C 1PJ5A 1X31C 3GIRA 4PAAA 3ADAC 1WSRA 1WOPA 3TFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSV A;  3GEE A;  1XZQ A;  3AD8 C;  1WOR A;  3GEH A;  1PJ7 A;  1V5V A;  3GEI A;  1XZP A;  1WOS A;  3A8I A;  3GSI A;  1WOO A;  1XZQ B;  2GAG C;  1VLO A;  1VRQ C;  3A8K A;  3TTG A;  1YX2 A;  4PAB A;  4P9S A;  5L46 A;  3TFH A;  1PJ6 A;  1XZP B;  3A8J A;  3TFI A;  3AD7 C;  2GAH C;  3AD9 C;  1PJ5 A;  1X31 C;  3GIR A;  4PAA A;  3ADA C;  1WSR A;  1WOP A;  3TFJ A; 
#chains in the Genus database with same CATH topology
 3ILJ A;  1KQK A;  3BH6 B;  2EEY A;  3OUY A;  3H90 A;  1ZM9 A;  2EFQ A;  2QN6 B;  2BV3 A;  2VV5 A;  1LXN A;  2Q66 A;  1YJW S;  5CXT A;  4KDD A;  5D3G B;  4CDI A;  1G2E A;  4DQI A;  3AD8 C;  2RJZ A;  2V2V A;  1TL4 A;  2DK2 A;  3NGT A;  1J5E F;  3MMA B;  2ZBR A;  1ZQ1 C;  1R6V A;  1KQG B;  4PYA A;  2UXB J;  3N0C A;  4A3F C;  2HHH J;  3T41 A;  5KFU A;  1EIY B;  2HGN A;  3VHQ A;  5LSO A;  3N9U C;  3UDV A;  4I0W A;  2GHP A;  2G2O A;  2H54 B;  2GIQ A;  2ZC4 A;  1N48 A;  3BGR A;  4RW4 A;  1NK7 A;  4NLT A;  3KTQ A;  3R97 A;  3KDO A;  4P6Q A;  7AT1 B;  1XNQ F;  1JKH B;  4OHW A;  3UW1 A;  4XSZ A;  3GU0 A;  2ZH8 A;  1KFS A;  2ZNY A;  4Y28 C;  3CJ3 A;  1GXU A;  2VUM A;  1KWM A;  5C42 A;  3GFX A;  4XCH A;  3TX8 A;  3HDS A;  2OUG A;  3EUN A;  2IHR 1;  1VRQ C;  3KWM A;  4NLW A;  2DR5 A;  3M8Q A;  2HQI A;  4CO2 A;  1HWJ A;  4Q45 A;  5DDP C;  1NKC A;  4ID5 B;  1AYE A;  3QLH A;  5KFL A;  2LEA A;  4ALZ A;  2CAJ A;  3R3T A;  1HR0 J;  1FWP A;  4PUO B;  2YNH B;  3S01 A;  1X5O A;  3OL6 A;  4RNF A;  3TVK A;  1BMQ B;  2C22 A;  2UZA A;  2HWI A;  2KRR A;  3H2L A;  1W2B R;  3GTJ K;  2A18 A;  2BXJ A;  4GMK A;  4R5P A;  2ZBP A;  4DLE A;  3SSS A;  3IM8 A;  3TWZ A;  5AJ3 F;  3IM9 A;  1ZYQ A;  2Y1L B;  1QTM A;  3AB2 B;  1WHW A;  4M5N A;  4Y2M A;  1C1B A;  1LK5 A;  4CT9 A;  3D1H A;  3OTC A;  4JI1 J;  4WZQ A;  2DIV A;  1RT4 A;  4WJ3 M;  2XG8 A;  3I0S A;  3TNV A;  1EKS A;  1BS2 A;  1TQL A;  4C6A A;  1WUU A;  3KJV B;  2AYG A;  2CZV C;  4OZL A;  2OEM A;  4EYI B;  2IYG A;  3S17 C;  3KK3 A;  4YOE A;  4WFA Q;  1JWW A;  5GAG I;  5M5Y K;  3Q24 A;  4Y2K A;  3UD5 A;  4CP5 A;  1WCM K;  3RZO K;  3N5B A;  1NHU A;  2Q6B A;  2RKI B;  4WF9 Q;  2FVC A;  2HBQ B;  2E9T A;  4DXL A;  1CS4 A;  1XXC A;  3MAH A;  3FKB A;  3D2W A;  5M5X K;  4QW9 A;  4OZJ A;  1NRK A;  3D0H E;  3P6Y C;  2W7A A;  3DCA A;  3AA9 A;  4AL7 A;  1CSJ A;  3W5Y A;  1WF2 A;  3HT3 A;  4KAI A;  4LSL A;  2KWA A;  3CQZ A;  1JQW A;  3DM2 A;  4YFU A;  3DMJ A;  3QO9 A;  3ZTP A;  1J98 A;  3PX0 A;  5C4J C;  3KFW X;  2MKS A;  4FN5 A;  5L39 A;  4J9P A;  2A6H A;  3D6M B;  3T02 A;  2VKZ G;  2VH7 A;  4FPR A;  1FEE A;  4ZPT R;  1J6V A;  2OSQ A;  4ILM A;  5KT6 A;  3EGZ A;  4KGX B;  4P7T A;  1SJQ A;  2DY9 A;  5HL8 A;  4Y34 A;  4NRT A;  4K50 A;  4F50 A;  3HT0 A;  3NAH A;  2AF6 A;  1ZBT A;  2H51 B;  4OHZ A;  2OI2 A;  3W9J A;  3JAM Y;  2HHU A;  3THP A;  1IR0 A;  3S15 C;  2FJA B;  2BJ7 A;  2LU2 A;  2V6U A;  2B4U A;  4M1X A;  4YB7 A;  3BP3 A;  3VTI A;  1SC4 B;  2WHO A;  2MZS A;  1R3N A;  1XC9 A;  1HBM A;  2R8J A;  1PAE X;  1BXN A;  4ID8 A;  3B82 A;  4LRC A;  4Q5V A;  1X5S A;  2PC6 A;  1VQP S;  1U7L A;  1TWH K;  2DCL A;  2BE5 A;  1YNJ A;  2Y1I A;  1C2P A;  3LP2 A;  4KMH A;  4X62 F;  4LFC J;  1UEK A;  4DV1 J;  1M5K C;  5J2Q A;  1Y1V A;  2VZ9 A;  3DGP B;  1B0P A;  4JI5 J;  1S6P A;  1NXI A;  2O5D A;  3R5G A;  5ETO A;  2LEB A;  1EZZ B;  2AMC B;  5DLG A;  5DQI A;  2ZNZ A;  3GTY X;  4MEY A;  1DAR A;  3MUV P;  3TI0 A;  4A8W A;  4I4B A;  1WQG A;  2V67 A;  1U49 A;  5KT4 A;  1K1Q A;  1IKW B;  5K14 B;  2E44 A;  4Y2A A;  2XSF A;  4CZC A;  2RUS A;  3QT6 A;  3I56 S;  4ELU A;  1EQM A;  3CNQ P;  2VQE F;  4LRB A;  1HBO B;  1JLA B;  2YWW A;  4WKY A;  2Y0S D;  4NRU A;  2ZUA A;  1AZS B;  3HSD A;  1AB4 A;  3OPF A;  4DPX A;  2E5L F;  4GTB A;  1I1G A;  5KFS A;  1J6W A;  3GV7 B;  1Y0H A;  4RL1 A;  3MEG A;  4DX6 A;  1QVF R;  1N5T A;  4I2P B;  2XS2 A;  3H3V D;  1N5V A;  1WOO A;  2E7X A;  1EET B;  1NSA A;  1M1G A;  4JB8 B;  4J9N A;  4YFK A;  4OZ3 A;  5C24 A;  3W8G A;  4ED4 A;  1YK9 A;  1Y10 A;  4ECW A;  4NA3 A;  2HK3 A;  4PRF A;  1Y3J A;  4ICL A;  1FO1 A;  4E8U A;  4Z7Y A;  1U0H A;  2BJ9 A;  4HDH A;  5F8L A;  3VAM A;  4DR5 F;  1BWV A;  3AJ2 A;  1SJR A;  3I0R A;  1H3D A;  3NBP A;  1R0B G;  3HVT A;  4L74 A;  1UPP A;  1FDA A;  2V2Q A;  2WCX A;  1VOM A;  1FRX A;  1C0U B;  1GMW D;  4A3C C;  1WC6 A;  4U7U D;  3PKM A;  2OIH A;  3UDL A;  4K2X A;  1UV7 A;  4WXW A;  2J6S A;  3OEP A;  2FHJ D;  5HL7 Q;  1PBA A;  4JI4 F;  2CPJ A;  1RT7 B;  2DVI A;  2RH6 A;  5GAH I;  4QQB A;  4DR3 J;  4GVB B;  2ASY A;  4OV6 A;  1N5Y A;  1RT6 B;  4WP8 A;  4X4Q A;  4Z2X A;  2HG4 A;  1DD5 A;  1VQY A;  3C6U B;  1HKA A;  4LF6 F;  2G9O A;  1BE4 A;  3W61 A;  5RUB A;  1RTD A;  2ZBC A;  2JEF A;  2MKJ A;  4X65 F;  2DHS A;  1G3O A;  1HNZ F;  1O51 A;  3MM9 A;  1IKY A;  2DIU A;  4F0H A;  4ES1 A;  3VVT A;  3FQL A;  2YH1 A;  2ZJR Q;  2L9D A;  4OLO A;  5D0E A;  3HOV K;  3V4G A;  2R7Z K;  4CLU A;  5HVF A;  2HFN A;  4IQM A;  1WG5 A;  4DI6 A;  3VGU A;  2CQ4 A;  5KFQ A;  4MYU A;  1O2F B;  2NVX K;  2A6O A;  3VR1 A;  4JI8 F;  3HOY C;  1WC5 A;  1PJ6 A;  3TAM B;  1JLQ A;  5A2Q U;  1J5E J;  5L8R C;  5T7L B;  4NX9 A;  2LEP A;  1Q4R A;  2QE5 A;  1T05 B;  1Q95 G;  1NJX A;  2F8E X;  4DEZ A;  4F67 A;  2ZFH A;  2LKZ A;  5IOQ A;  2ZE2 A;  4U95 A;  3IPJ A;  1LWC B;  4RUB A;  1S77 D;  3M8W A;  4W4M A;  1BC6 A;  2IDL A;  4MYT A;  1FKP A;  2JA5 A;  4DCO B;  1YSJ A;  4UQG A;  4F3O A;  1RAG B;  4G0V A;  1XNQ J;  3BKF A;  1QD1 A;  5BXI A;  3M4O C;  5B7W A;  1FA0 A;  3M8P A;  5J2M A;  1WDD A;  2DXF A;  1QAJ A;  1CQM A;  4RZR A;  5D6G A;  1YJN S;  2W7V A;  3M32 A;  5K8P A;  3M9N B;  2BJ3 A;  2VFU A;  5AXN A;  3DLG A;  1LKZ A;  1VDH A;  1SIZ A;  4O23 A;  1N54 B;  1SQF A;  3BV8 A;  1RB0 A;  4IDK B;  2GVD B;  1OPI A;  2NRE A;  2BJ1 A;  2M3D A;  4X4T A;  3PKY A;  5KAK A;  2NVQ K;  2DEJ A;  4BBS K;  3NS6 A;  3GJQ B;  3NWG A;  1XXB A;  3R5B A;  2UXC J;  3H8Y A;  3GG1 A;  5KG7 A;  5HAT A;  1O28 A;  1TWG C;  2ASD A;  1RTZ A;  2C2K B;  5E41 A;  2VQF F;  2IRX A;  5MLC V;  4JV2 A;  3L7U A;  3RGI A;  4GO5 X;  1NHV A;  3IP0 A;  3RR8 A;  4DV6 F;  5AJ3 J;  3BGL A;  3BQ2 A;  2B9W A;  3DLK B;  3BBF A;  2YNI A;  3H0G C;  1T0T V;  1VQK S;  4PR6 A;  2HMI B;  1S1W A;  3QSY B;  5L38 A;  3ISN C;  4DPU A;  1G7C B;  3JTP A;  4KM9 A;  4ED7 A;  2QRR A;  4OX8 A;  2BMB A;  1RLC L;  2Y1J A;  2MHE A;  5IT4 A;  2LVW A;  1H2V Z;  4F3Q A;  2MLY A;  3S14 C;  2H5I B;  2FHM A;  2BVZ A;  2LXI A;  1RWW B;  2YQ3 A;  3L3C A;  4BY1 K;  2HWH A;  3NS7 B;  4OHX A;  2DNG A;  1NJI T;  2RQM A;  3M8R A;  1R0C B;  4CH1 A;  2V9W A;  1C0T B;  5HMY A;  1VRT A;  1VBZ A;  1DTT B;  3A3N B;  1PG5 B;  4NLO A;  2W4C A;  1VIS A;  3MFH A;  3AOC A;  1ZA2 B;  3OFH A;  4ZVP B;  4ZPD A;  4Q44 A;  3HLU A;  2KJV A;  3KUG A;  4OV1 A;  3TEH B;  4DX7 A;  1AFJ A;  4WU3 A;  3TZW A;  1CJV A;  4CNZ A;  2R7S A;  3M7V A;  3PYD A;  2PA3 A;  3MAQ A;  3MCO A;  3K8W A;  2IC3 B;  1X60 A;  1HNW F;  1RT5 A;  2E2J C;  1DY3 A;  4KO0 A;  5EWG A;  1WQF A;  1Y3K A;  5A76 A;  5C2G A;  4KC5 A;  3NY0 A;  4DR1 J;  2VON A;  1IR1 A;  2HHP A;  2OPP A;  4K4X A;  4Q2M A;  2XI2 A;  1DZ5 A;  3AJD A;  3JS9 A;  3GLJ A;  2P5M A;  2Z2M A;  5JUM A;  3N4W A;  5K20 B;  2LCW A;  5M5W K;  3JSM A;  2HHQ A;  1L3K A;  4QOT A;  4K0K J;  3L7P A;  2HIY A;  3UR0 A;  4XO0 A;  2BKN A;  1EHW A;  3DYA A;  5HVH A;  1TWC K;  4NOH A;  2H9Z A;  1U2R A;  2MLX A;  5DLF A;  1WIH A;  2QLB B;  4DF8 A;  1REG X;  1HIY A;  2IBK A;  1NZA A;  3MM6 A;  4PWD A;  2OO4 A;  1NDL A;  1XJW B;  5G0R B;  4DV3 F;  4K4Z A;  4OZ2 A;  3AD9 C;  5KFF A;  5D4D A;  4DQP A;  4B02 A;  3TQE A;  2UXD F;  4I1T A;  3S16 C;  2AU0 A;  2YX1 A;  1WOR A;  5A6W A;  3QAT A;  3Q89 A;  4AYB D;  1EI6 A;  5LJ5 Y;  1HPZ A;  1I6V A;  3TUZ C;  5F8J A;  3BGR B;  3LH2 S;  2VA3 A;  4RW4 B;  3OTD A;  4E98 A;  4IH5 A;  3TFJ A;  1ZET A;  2KH9 A;  4C11 A;  2GHW A;  1H2U X;  2XTJ P;  5C42 B;  4ILL A;  1MN7 A;  2B63 C;  2QEX S;  3S1R C;  3W7B A;  3K89 A;  1SL1 A;  1S1X A;  1HYS A;  3M8Q B;  3KLI A;  1JK9 B;  3CCQ S;  3MMB A;  5H9F J;  4WPA A;  3OVS A;  4FS2 A;  4A3L K;  3IRX A;  4ZOS A;  2P9G A;  3R27 A;  3QLH B;  2Y3Y A;  3Q0A A;  2UVU A;  1V3S A;  4GZY A;  1E6Y A;  2A6M A;  2AJF E;  2Y3P A;  4ZP7 A;  1RKI A;  1SC3 B;  5JXS A;  1CJT A;  2KG0 A;  4J9O A;  4F4X A;  1RAI B;  5A8R A;  2CUY A;  5KFX A;  3T1Y F;  1X4C A;  3OFG A;  3I4H X;  4LF5 F;  4B3R F;  1P1T A;  2UVR A;  4R5P B;  1U48 A;  3G6Y A;  3AOA A;  3PR4 A;  1KTQ A;  3QPI A;  2BUN A;  3DXB A;  2KZZ A;  2Z57 B;  1D9F A;  1C1B B;  3HOZ C;  2UUB F;  2SXL A;  2JC0 A;  1H6K X;  1RT4 B;  2ZD1 A;  1IQ0 A;  1MLA A;  2DHX A;  4USK A;  3I0S B;  5E5N A;  6AT1 B;  1C1C A;  2HVH A;  4DR5 J;  2VUM K;  1G51 A;  3JAM U;  2ILZ A;  1H72 C;  4PG7 A;  3KK3 B;  4FP9 A;  5KG1 A;  4YR0 A;  1WEX A;  3KHH A;  1KON A;  3C6T A;  3ZNU A;  1UVJ A;  2W9C A;  3QGP A;  3ZZO A;  2V4J A;  5IYC C;  3H5S A;  2M2B A;  1WG4 A;  2GNK A;  2OPR A;  1CS4 B;  4L75 A;  1ZA1 B;  1I3O B;  2V5H G;  2RNE A;  1CQN A;  3PY8 A;  2DR8 A;  1WI6 A;  1TKT A;  3KXD A;  3HD2 A;  3Q8S B;  3NOG A;  1FTR A;  3RRH A;  2MY8 A;  4BXX K;  4OIN A;  3ET6 A;  1N34 F;  2VL1 A;  3DM2 B;  2VIH A;  2R93 C;  3DMJ B;  5CYQ A;  3QO9 B;  2DJW A;  4LF6 J;  2HKE A;  2K1R A;  4DV7 F;  2XLK A;  4PPZ A;  4X65 J;  1Y9O A;  4OYA A;  5D4P A;  1HNZ J;  4TYB A;  4FKX A;  3RJM B;  4CLK A;  2ZDP A;  4BY7 K;  1TKX A;  2OKQ A;  2CA9 A;  4OX7 A;  4DR6 F;  4TLR A;  1RAJ A;  2HAF A;  3OPK A;  4KRW A;  2E5I A;  2C2O B;  3J80 Y;  1T9X A;  4DV2 F;  4JI8 J;  1T02 A;  2E1P A;  2GCF A;  2V69 A;  4NXN F;  3W2V A;  2KFZ A;  2YNF A;  2ZJP Q;  4F2S A;  4CLL A;  4RBT A;  4FKY A;  1X4E A;  2CKW A;  3BPD A;  2XMW A;  4K5R A;  1MSW D;  3KK1 A;  2ZDO A;  2QO3 A;  1Y1W C;  2EBB A;  4HTI A;  1HBM B;  2CQC A;  4F2R A;  2C2N A;  1ZM4 A;  3GTP K;  4EI2 A;  2MDA A;  1YQH A;  3GPA A;  4GTA A;  2Z56 B;  4LRF A;  2FVS A;  4FYV B;  3CQZ K;  4EYH B;  1JX4 A;  2UUA F;  4PG4 A;  2WZ1 A;  3LP2 B;  3QID A;  1QSL A;  3ORE A;  2FIU A;  5J2Q B;  1DCP A;  4P9S A;  1O6X A;  4QYZ K;  2PN6 A;  2JA7 K;  3CCZ A;  2JSX A;  1TU0 B;  1S6P B;  1Z4U A;  4JV5 F;  4LRD A;  4DZD A;  3TRG A;  4KAR A;  3DOK A;  3D66 A;  2NVT K;  5CQG A;  5DJB A;  3RW6 A;  3IO1 A;  3CIM A;  1SQE A;  2XYH B;  5F8I A;  4DR7 F;  4N8N A;  3J7Y I;  3J7Z T;  2BM0 A;  2IM2 A;  1IBC B;  2CFA B;  1KDN A;  4D3G A;  2QJ3 A;  2YKQ A;  5F8N A;  3TAN A;  3RZD K;  3TAP A;  1TK5 A;  4MFB A;  1NUE A;  2OD6 A;  2NUU G;  1KEK A;  4CO1 A;  3OTO J;  1H7W A;  2JLG A;  1KTV A;  2C3O A;  1B99 A;  4A46 A;  2NXN A;  4DV6 J;  4ZP6 A;  5B0F A;  4QR2 A;  2KT3 A;  2IPO B;  3MEG B;  5LMN J;  3BZQ A;  4LVO P;  2W2N P;  4A8F A;  2ZZT A;  4IR9 A;  2FUG 9;  4ERD A;  4BC9 A;  1S72 S;  2R4F A;  1EJ7 L;  2FZK B;  2ATC B;  2V2K A;  4ICL B;  2W25 A;  2MZ1 A;  1U0H B;  2CPD A;  4O3Q A;  1KVK A;  1RZM A;  2EG1 A;  3LAK A;  4HVZ A;  1Y1V K;  3I0R B;  1VQM S;  2DGS A;  2EK1 A;  2PI5 A;  1S0M A;  3NBP B;  3HVT B;  2FLL A;  2GHV C;  3HSJ A;  1QSY A;  4PXB A;  4GO7 X;  3Q3Q A;  4NCG A;  3T6J A;  1KQ4 A;  4JP8 A;  2F4V F;  4WIQ A;  4C3M A;  3Q86 A;  3HFZ B;  1RHR B;  3Q23 A;  4CH0 S;  4W92 B;  4LR7 A;  2UVW A;  3GTL A;  1FRI A;  4AT1 B;  2CZ4 A;  2D9O A;  1IW7 A;  4ZVT B;  3QJL A;  2HEK A;  1OQ3 A;  2L41 A;  1FK9 A;  5ITH A;  1D1U A;  1GQE A;  2QMX A;  3SV3 A;  1BHN A;  1N5Y B;  5FD1 A;  4A3I C;  3GG0 A;  4NXM F;  4O3P A;  2B56 A;  2XMT A;  2YWF A;  1NCL A;  4F36 A;  3PW4 A;  3MPY A;  4XLN A;  1HNW J;  3ZTQ A;  1JVI A;  4A3M C;  1F3F A;  3UO0 A;  1JB0 C;  3M2R A;  3M6X A;  3OW2 R;  3V6K A;  4YY3 F;  3MM9 B;  2RQ4 A;  1IKY B;  3J81 j;  1YRX A;  2HQ3 A;  3EGW B;  4PXC A;  3I5B A;  5KFB A;  2GSU A;  1HI9 A;  5F8G A;  2CNK B;  4NPO A;  5KG5 A;  2CQI A;  3HZG A;  4C3J K;  3DRY A;  3CSK A;  3MCM A;  1EB0 A;  1AT1 B;  1XR7 A;  1RWX B;  2Q1L A;  3Q8P B;  1JLQ B;  2DGX A;  2RIL A;  3MR7 A;  3P4U B;  2JEJ A;  3KLE A;  3WQP A;  2R7U A;  2VBY A;  1KOO A;  1NSK L;  5KFY A;  2ADC A;  5C44 K;  5HJY A;  4LVN P;  3LPE A;  3H2U B;  4DV3 J;  4DCJ B;  1YRT A;  4URS A;  1XZQ A;  3CDE A;  2UXD J;  2BBE A;  3HCX A;  1FKP B;  5HO4 A;  3FEY B;  1NPP A;  3MPU B;  3BPS P;  4FXD A;  4N7T A;  3M8P B;  3CUL A;  5J2M B;  1F7V A;  3KUE A;  3CB4 A;  4HKQ A;  3N5F A;  4QJV A;  4DV5 F;  3ONQ A;  3M32 B;  4UUW A;  4X66 F;  3DLG B;  1XPP A;  2WTF A;  3VAH A;  1JXV A;  2XYG B;  4H4M A;  1QLN A;  3OTE A;  1D8Y A;  1ZS6 A;  1I6J A;  2MQO A;  3QJP A;  1TWG A;  1TUV A;  5AT1 B;  4BBR K;  3DXS X;  4FNI A;  2MQL A;  3FZB A;  3S1Q C;  1T9V A;  5T41 A;  4RO0 A;  1S97 A;  2MYF A;  3D4J A;  4JYA F;  5A8W A;  2DNO A;  3ZZU A;  1BQM A;  2CQB A;  2AGP A;  4QIE A;  1O26 A;  3PYE A;  3R1L A;  3AD7 C;  3T1Y J;  5DM7 Q;  2CJQ A;  2RD5 C;  4RUC A;  1CUL A;  4LF5 J;  3T1H F;  4B3R J;  4J9V A;  4UY8 T;  3H0G A;  3TZY A;  4ZVQ B;  3CCM S;  2HS4 A;  2IMO A;  2YX7 A;  5D0H A;  4G0W A;  3AXK A;  1RWU A;  4DL0 C;  2YNI B;  4B3S J;  3K58 A;  3D67 A;  2UUB J;  2JA5 K;  3HHL C;  1HWL A;  1S1W B;  3NAI A;  5IT0 A;  2B43 A;  1R0A A;  5BR8 J;  1X4B A;  3FZ2 A;  5KG0 A;  3OFF A;  2XNR A;  1OPZ A;  4XAK A;  2R7R A;  3HOX C;  2DXD A;  2KKH A;  4M5J A;  3A12 A;  5TJ3 A;  4DU8 A;  4ZIW A;  4FZV A;  2NXE A;  4LF1 A;  5IYB C;  3VVU A;  3RBZ A;  2QA1 A;  1RGV A;  1UEV A;  1TWA C;  4OZ1 A;  3NGD A;  1Z2Z A;  2WVB A;  1UEU A;  1VRT B;  1Q8K A;  5HLF A;  4WTO B;  2GFF A;  1RTH A;  1GAO A;  2DRB A;  8RUC A;  3SQG A;  1UFL A;  2DEI A;  4LQY A;  1U1O A;  1FDD A;  1P9Y A;  3GJT B;  1XZP A;  2HFU A;  3MD1 A;  2LDI A;  1FJ7 A;  3PNI A;  4Y2I A;  1VJQ A;  4DL6 A;  3J81 U;  1WKJ A;  1O24 A;  1RHQ B;  4AL5 A;  1UP1 A;  1CJV B;  2VG6 A;  2CQG A;  1U02 A;  1N34 J;  4DZ6 A;  1RXO B;  4ZPA A;  3MI7 X;  3BKU A;  1GX5 A;  1RT5 B;  4O3S A;  4KO0 B;  1U6F A;  2K3K A;  5LJ3 Y;  4DV7 J;  1FD2 A;  2UUC J;  5CCL A;  1O8B A;  1CC7 A;  2OPP B;  1XMO J;  5AXM A;  4QWA A;  2AQ4 A;  4DL4 A;  5KOW A;  1A6L A;  4TLQ A;  4BY1 C;  1Q8B A;  3JSM B;  1RLD A;  1U0S A;  1XIQ A;  2XZD B;  4DR6 J;  1JJH A;  1LFP A;  4J9K A;  1W25 A;  3D0I E;  2F8H A;  4FF3 A;  2OHD A;  4U96 A;  1TV6 A;  3DYA B;  1KP6 A;  4USW A;  2UV8 G;  3AFG A;  3TEG A;  2QSF A;  5HMZ A;  4NML A;  4DR2 F;  4PEO A;  4NWB A;  1SXL A;  3MM6 B;  4QPT A;  4PWD B;  3PX4 A;  2HYI B;  2E1R A;  4HI1 A;  3R5J B;  5LT5 A;  2R92 C;  2M8H A;  4CWB A;  2HIQ A;  2IRU A;  3M2V A;  4KN4 A;  1GMW A;  2JZ5 A;  2KG1 A;  2RS2 A;  1HQE A;  3WDO A;  3WBZ A;  2FHJ A;  3LQV A;  1HPZ B;  2CQ1 A;  3PDN A;  1NB2 A;  4EFA C;  2EVZ A;  2ZZN A;  4KMU A;  3PEH A;  1IJF B;  2B63 A;  2UUA J;  3KDN A;  3GDZ A;  4HH1 A;  4FPI A;  3SEO A;  2JWN A;  4C11 B;  3FKI C;  2H1Y A;  4LQ3 A;  2J5A A;  3CGI A;  4XDC A;  1Y7P A;  1VQ9 S;  4RW9 A;  3CWJ A;  2R3V A;  1S1X B;  1FXL A;  1ZOT A;  2R8K A;  1HYS B;  1FEH A;  1FXR A;  3LAJ A;  4DS4 A;  3KLI B;  1VQO S;  5IOL A;  2HVE A;  3MMB B;  5E3C A;  2M5Y A;  1X9S A;  4AFF A;  2WW8 A;  3IMQ J;  3IRX B;  3CDW A;  2ZHO A;  5L9X A;  5CHC B;  1S59 A;  4NEY A;  4DR7 J;  4A3F K;  2EG2 A;  5ETQ A;  1E6Y B;  4RNM A;  1VHF A;  3K57 A;  1VI7 A;  1F60 B;  1WKL A;  4GRS A;  3F73 A;  3KJF B;  2K7K A;  5A8R B;  2G1D A;  4UST A;  4B9L A;  1GK8 A;  2AYB A;  5C25 A;  4HHU A;  3BBC A;  1SJF A;  1HLW A;  1OSD A;  2PMZ D;  4ZVO B;  1MG7 A;  4DQR A;  4P5B A;  2G2Z A;  1OYD A;  5IC4 B;  4B9U A;  3DLE A;  2QX0 A;  3QRQ A;  2HZC A;  1TP7 A;  5F8M A;  1S49 A;  2ZD1 B;  3PIP Q;  1URN A;  3VAJ A;  4J9M A;  1UJ4 A;  3GFY A;  3J80 U;  2EC2 A;  1HHQ A;  1XEZ A;  1C1C B;  3DC2 A;  4M5M A;  3SI8 A;  3DKD A;  3B54 A;  3MCS A;  1TMJ A;  4OYX A;  1EQR A;  5CAA A;  5DDR C;  3HFV A;  1U1M A;  3AA8 A;  1BGX T;  3GEI A;  3C6T B;  5BYR A;  2FQO A;  2W9C B;  4DSF A;  2VB6 A;  4MIW A;  3DU5 A;  4C8K A;  2F65 A;  2V4J B;  5C3E C;  3IRW P;  1S99 A;  2OPR B;  4QYR A;  1KKH A;  2XMU A;  2BAB A;  1J27 A;  2F8M A;  3AHP A;  3BN4 A;  4DOZ A;  3BM7 A;  2WSE C;  1HWI A;  1PIE A;  3UNY A;  4OFZ A;  3SDE A;  3PW7 A;  1F9N A;  4N77 A;  2FQQ B;  2R93 A;  1RBL A;  4TXS A;  3M8Y A;  3SFU A;  2DIT A;  1KFD A;  3ET6 B;  3CD5 A;  1FJG J;  5CYQ B;  2K1R B;  2VC1 A;  1S0V A;  1NU4 A;  1D3W A;  3I87 A;  5KFV A;  1VQS A;  2GAH C;  3FOF A;  2YPZ A;  2R8I A;  1HNV A;  4BWJ A;  1I3Q C;  3GTQ C;  3BBB A;  2CNL B;  5F8H A;  4A3D C;  4BDP A;  3BSC A;  3S17 K;  4WP3 A;  3RW7 A;  3HM9 A;  4IUF A;  3LP1 A;  1TKX B;  4EEY A;  1P9Q C;  4RLE A;  4CLY A;  3HKW A;  4YHH F;  1I50 C;  4FF4 A;  1H98 A;  1JIH A;  5AE1 A;  3C16 A;  2AX0 A;  3GTO C;  4IH6 A;  2WAQ D;  2YKN A;  4RW7 A;  2HZA A;  2ZKU A;  4MKY A;  3W2V B;  2YNF B;  4YQW A;  3CME S;  2QFI A;  4HT7 A;  2UU9 J;  4LIW A;  1Y1W A;  4ETZ A;  5IXU A;  2J6T A;  4J91 A;  3PCO B;  2NXU A;  3NXZ A;  2XUL A;  3KK1 B;  3GV5 B;  1H73 A;  3RU0 A;  3DRS A;  2ZOM A;  3TJ8 A;  2JRS A;  4C97 A;  1ZTW A;  1WJ9 A;  1PIL A;  5C4J K;  2M4M A;  1FRK A;  2U2F A;  1A7G E;  3UN3 A;  2C3P A;  2MHN A;  2GIF A;  2NLW A;  1VFJ A;  2YKM A;  3ZTR A;  2B4O A;  2WSF C;  3THT A;  3SZZ A;  3HSZ A;  4DV5 J;  1AUD A;  1SKW A;  2AZ3 A;  1X5T A;  3A3P B;  1S9E A;  4B9S A;  4X66 J;  4F4A A;  3HHK A;  4EU0 A;  4CLF A;  3E8O A;  4EWT A;  3G4A A;  2KDO A;  4OYO A;  3DOK B;  5EUH A;  2ACY A;  1NK6 A;  1HWK A;  1S1U A;  3U27 A;  1MNE A;  1RTI B;  4K7Q A;  4XSX A;  1S12 A;  3LA0 A;  3S15 K;  4USU A;  4WU2 A;  1RUS A;  7FD1 A;  2XS5 A;  2IM1 A;  4JYA J;  1S9F A;  4ED1 A;  4IO9 Q;  1S6O A;  4MFB B;  3EXC X;  2C2D A;  2XBP A;  3T1H J;  3GTP C;  4KY3 A;  1IM4 A;  1MWQ A;  1DAX A;  4IOB A;  4GC6 A;  4TY8 A;  3W64 A;  1QUV A;  3OXF A;  2HRT A;  1PO6 A;  2OEK A;  3EZU A;  3IG1 A;  4YUD A;  3GFZ A;  4ZMM A;  1PYS B;  1SFO C;  4J3N A;  4J90 A;  2DTJ A;  1WG1 A;  4WP9 A;  2EFG A;  2WVE A;  4FS1 A;  2EPI A;  1S4E A;  3TQ1 A;  3OQ2 A;  1L3S A;  5HMW A;  2RHS B;  3DLJ A;  3V81 A;  4HH0 A;  1U2C A;  1IS1 A;  1RAD B;  2NUH A;  3DI6 A;  5M2R A;  1KOH A;  1HW9 A;  2J0W A;  2XZW A;  3LPY A;  4NCG B;  5LSR A;  3IBF B;  3MPV A;  3LAN A;  1NLK L;  4I69 A;  2E9R X;  1HBN A;  3AH5 A;  4OL8 A;  4OX6 A;  2JL9 A;  4Z7C A;  3HOU C;  4B3T J;  3QRP A;  1F9H A;  2BX6 A;  4IYQ A;  4RBV A;  2G0J A;  2QYC A;  4X64 J;  1JMT A;  3J7A N;  1FK9 B;  2FVQ A;  4PQA A;  3R2D J;  2LXF A;  1LWE A;  4RWX A;  3QRR A;  2KXH A;  4WYW A;  2P6S A;  4DFJ A;  2X1F A;  1BY9 A;  4ETX A;  2KM8 B;  3FGV A;  4LR2 A;  3G82 A;  3W1Y C;  2RRB A;  4IOC Q;  1N33 F;  3W60 A;  4AXJ A;  5KG3 A;  2R8H A;  3M2R B;  1YWX A;  4TKT A;  1UFK A;  3G2X A;  1JLE A;  3QYY A;  4ZIT A;  3CMA S;  2V0N A;  3PZP A;  1VQ8 S;  4PWU A;  3V6J A;  4DFK A;  1DTQ A;  3VQS A;  4R0E A;  3ILO A;  1C4A A;  5IV4 A;  2GW8 A;  4G7H A;  2M70 A;  4DDQ A;  2FY1 A;  4Q5S A;  2RML A;  3W63 A;  1HR0 F;  3JST A;  4A3C K;  1FFW B;  2JA6 C;  5ETP A;  1RAH B;  3NRB A;  2PO4 A;  4ZLL A;  2EK6 A;  3EPG A;  4DR2 J;  3ETM A;  3KLE B;  2HW3 A;  2HBR B;  4LF2 A;  4NYP A;  4OI4 A;  3MR3 A;  2VFR A;  2UVV A;  1WHV A;  1OS5 A;  4MTP A;  4DU7 A;  5F0W A;  1XZQ B;  4JI2 J;  3M6W A;  5LXY A;  4N76 A;  1X4D A;  4A3B C;  1K0T A;  4N41 A;  3QFW A;  1INN A;  3MXH P;  1PKU A;  2XY5 A;  5ETN A;  4A3E C;  4FDF A;  2BEF A;  3W9H A;  3KUH A;  2R7Z A;  2OEL A;  1W26 A;  4IOA Q;  2DNH A;  3E2E A;  2XNQ A;  3HD1 A;  1PYO B;  2KZM A;  1IN0 A;  3EJM A;  1NJY A;  1WF1 A;  5D4O A;  2ZH3 A;  3P96 A;  4QJV B;  4LBI A;  3WC2 A;  2ZOG A;  2B9X A;  3MED A;  1YJR A;  2AV5 A;  3HXA A;  4H4M B;  5GAG U;  1IXK A;  5CYM A;  2HBY B;  2F1F A;  1OY6 A;  5EGY A;  3OJS A;  2M9K A;  2GJF A;  4PG5 A;  4NEZ A;  3ZFV A;  4KAW X;  3GQC A;  3SZ2 A;  4JV1 A;  4YR2 A;  1CBK A;  2CPX A;  3U02 A;  1MWY A;  4WII A;  3M1V A;  1ZBS A;  4NLD A;  5A8W B;  2H5J B;  3H7H B;  1BQM B;  1YJ7 A;  3CMQ A;  5LSL A;  4O0N A;  3EZ5 A;  1RT3 A;  2EFN A;  4H4K C;  1CUL B;  1YKW A;  3PXG a;  2CVI A;  2XZT B;  1EP4 A;  3HHL A;  3A1Y G;  2W2Q P;  2QL9 B;  4OJH A;  4KE5 A;  2VOD A;  2G1H A;  4TN2 A;  3M4O K;  3M8Z A;  1NME B;  2PDA A;  3BO3 A;  5H1S V;  1RU2 A;  2NZ4 A;  1X4F A;  4IG0 A;  4QIG A;  1R0A B;  4A93 K;  3H42 A;  3TX0 A;  1C0A A;  1XQI A;  4K5S A;  4LJZ A;  4DSE A;  2KYZ A;  4OX9 F;  7FDR A;  3V4M A;  4C8Y A;  3FBF A;  3G4C A;  3G71 S;  3GYN A;  2QYG A;  1TWA A;  2KB2 A;  1OJ4 A;  1BLU A;  4NLX A;  3NG8 A;  1S1T A;  3IXQ A;  2G0I A;  4EO6 A;  9RUB A;  1NZ8 A;  2DNY A;  2DGW A;  1D0E A;  1B4B A;  5HLF B;  1FX2 A;  1NBE B;  1TWG K;  1RTH B;  4KJI A;  1BQN A;  2J9C A;  3SQG B;  2CAD A;  3BYP A;  2HVD A;  2RF2 A;  5I4M A;  1TKD A;  4V19 X;  3O3L A;  4I2Q A;  3MR6 A;  1XZP B;  5HP1 A;  2MJN A;  4M63 A;  2RE1 A;  1L3V A;  2R7T A;  3OSN A;  4O2D A;  1N6Q A;  5ETV A;  2QA4 G;  2RB7 A;  2VG6 B;  1TL3 A;  2DPJ A;  1KLM A;  2HFS A;  3H0G K;  1R9T C;  1UPM B;  4JI0 F;  1HD0 A;  1B70 B;  2NPF A;  1U1N A;  3D28 A;  4MMO A;  1R8B A;  4IFY A;  4JI5 F;  2B3T B;  4P2S A;  3GIK A;  4G65 A;  4RBU A;  2N3O A;  1ISE A;  3GWC A;  3PAC A;  1IKX A;  1Q16 B;  1YBT A;  2DH8 A;  4O0I A;  1F5B A;  3PO2 C;  2OD4 A;  1NHK L;  4ZPW R;  3CD6 S;  2DO0 A;  1M5S A;  3S14 K;  1Q79 A;  5KFP A;  2ATL A;  2E1M C;  2CVE A;  8ATC B;  2V8V A;  1VBK A;  3RAX A;  1T03 B;  4XPE A;  1JNZ B;  4YHH J;  1YJU A;  2DR9 A;  1TV6 B;  3LPX A;  1NM2 A;  3DDK A;  1U1K A;  2R92 A;  5E3R A;  3DHX A;  4LRE A;  3A13 A;  1NJW A;  1J5O A;  2OJ3 A;  3AY0 A;  1CEZ A;  5DZ6 A;  3MFI A;  4ZJQ A;  2CWX A;  1SC6 A;  5FJ8 K;  2V34 A;  2HQG A;  2CNN B;  1RYR A;  3M2V B;  3CUN A;  2XMJ A;  3BGO P;  4C9D A;  2V63 A;  2CQD A;  4USM A;  1HQE B;  2RAQ A;  5DM6 Q;  2XLI A;  2QL5 B;  4Y65 A;  4DX8 H;  5DQG A;  2E2J K;  3FKI A;  3W5Z A;  3ETO A;  4LFB J;  2C2M B;  1RBA A;  5IOS A;  4QYZ J;  2BDP A;  1KHV A;  2LP4 A;  2ADB A;  3L4K A;  1I6H C;  1NK8 A;  1R8C A;  5IP7 C;  4WWS A;  4RW9 B;  3TJA A;  4P2X A;  4YB6 A;  4J5O A;  1XR6 A;  4YEA A;  5LMU J;  3K59 A;  2Z8Q A;  2E2I C;  3FEZ A;  3SSR A;  4LFA F;  2VUG A;  3MEC A;  1ZAW A;  4G3I A;  1QM9 A;  4YG2 A;  1WKK A;  3MTK A;  2CZ9 A;  4DSJ A;  1H74 A;  4ER8 A;  1X4H A;  4DSI A;  2H4W B;  4RUH A;  1HI0 P;  3PJW A;  4NCA A;  2E29 A;  2XMA A;  2I2Y A;  3C19 A;  3CCL S;  5GAH U;  2HZV A;  1USO A;  4WK1 A;  3S16 K;  4C98 A;  1XBW A;  4P5A A;  5C25 B;  3BR8 A;  5KFG A;  2Q79 A;  1F9F A;  2B8P A;  2HFV A;  1M90 T;  3M30 A;  1SIW B;  5J1N A;  3TA2 A;  1OWX A;  1VC5 A;  5L9N A;  5BYS A;  2D3Z A;  4NLQ A;  1RWN B;  3DLE B;  2Q3P A;  1GNK A;  4A3G C;  3NGU A;  6FDR A;  1JLG A;  4QBU A;  5L46 A;  2B63 K;  3R5A A;  3S1R K;  1Q78 A;  1R89 A;  1OMS A;  4CYU A;  3I9Z A;  4QZV B;  3BO2 A;  5CYJ A;  1SV5 A;  1VQ5 S;  2EFO A;  3QQC D;  3VGS A;  3G8Q A;  2I5J A;  2PPB A;  3P49 B;  2J7K A;  3O44 A;  3LGH A;  4CO0 A;  3VCD A;  4DX5 A;  3S0X A;  5KFD A;  1X5P A;  4DSL A;  2RRA A;  4L6V 3;  1Q7Y T;  2DD8 S;  1ZVU A;  5KFK A;  1DLO A;  2GQQ A;  4FYW B;  4KSE B;  5CZV A;  3SDE B;  3NUH A;  2X7I A;  3ENA A;  4NMX A;  2KI2 A;  1F93 A;  5EWF A;  3IWL A;  1NDK A;  3T6B A;  4WJ4 A;  2DY1 A;  5F0U A;  4G7Z A;  5HQL A;  4HR2 A;  1I3Q A;  3HOZ K;  3GTQ A;  5FLX U;  3CDB A;  4KH0 B;  3DLL Q;  3B6B A;  5B0E A;  1N33 J;  1SH3 A;  5FJ4 A;  1HNV B;  1YTY A;  1WI8 A;  4ZP9 A;  1ZYR A;  1IVZ A;  1RI7 A;  1KVJ A;  2E5J A;  4BC7 A;  1I50 A;  4B9M A;  3LP1 B;  1DQ8 A;  1JLB A;  3GTO A;  4C2M C;  2HNZ A;  3RR7 A;  3L7O A;  2X51 A;  4N47 A;  5DDO C;  2UXC F;  5IYC K;  2L3M A;  3C16 B;  3M8S A;  2YKN B;  2HQD A;  3FBE A;  4RW7 B;  2MGZ A;  1B0V A;  1ZAX A;  3FRZ A;  3LGN A;  2VG7 A;  3C15 A;  1VCT A;  2ZBQ A;  4M5L A;  4LBH A;  4G0U A;  1MMD A;  2J7W A;  1URR A;  1T3O A;  1IL2 A;  3UQS A;  3FBC A;  1WC0 A;  3DRS B;  1TAQ A;  4Y2C A;  1IKV A;  4WFZ A;  1R43 A;  2R93 K;  3PO4 A;  4WYL A;  4C8M A;  2QLJ B;  1X4G A;  4EZ9 A;  4EO8 A;  3WHI A;  1S48 A;  4OYM A;  3IR7 B;  2ROG A;  2YKM B;  1GT8 A;  3KJN B;  4O3R A;  1RCX B;  3CPW R;  1D8Z A;  3TUJ C;  2QGF B;  3K5N A;  2XY7 A;  4K59 A;  2FZC B;  2N7C A;  3KKF A;  3DRP A;  3I96 A;  3OFE A;  2QLX A;  1S9E B;  2VPY B;  2HHS A;  2EBG A;  2D69 A;  3R2C J;  2HRU A;  4YR3 A;  3D6F B;  5GAD I;  1XTZ A;  3PTW A;  1FCA A;  1S1U B;  1JLF A;  1V5V A;  4Y3C A;  2PMZ L;  1IM6 A;  3SCL E;  3LAL A;  2WON A;  1GH8 A;  2B9Y A;  2BQR A;  2NVY C;  5IOT A;  2HS3 A;  4XDD A;  3GTP A;  4R0J A;  4BHQ A;  1QVG R;  4K4U A;  4RNH A;  2I38 A;  1LW2 A;  3ILL A;  2YU9 C;  1Y1W K;  1Q81 T;  4EK2 A;  2OEJ A;  5HMX A;  2IVY A;  4UY8 5;  3VGT A;  3QIP A;  4DR1 F;  1SFO A;  4TY8 B;  2OTL S;  2PMW A;  3I4N C;  2JA7 A;  4CIO A;  2V8P A;  2IIH A;  3KG0 A;  1RJJ A;  3K8V A;  4LR9 A;  3I55 S;  3IG1 B;  4DPY A;  2O01 C;  5L1L A;  2I0X A;  5EX0 A;  3MEE A;  1F5A A;  4F8R A;  4DV4 J;  3UR3 C;  1S57 A;  4KAT A;  1L3T A;  4OX9 J;  2XGQ A;  1TL7 A;  4WE1 A;  4K0K F;  1XXA A;  3V81 B;  2UUW A;  3LOU A;  3IN5 A;  3DI6 B;  1RU1 A;  3M3Y C;  4P74 A;  2MKI A;  4USH A;  4OYP A;  3QWU A;  2FJB B;  3HSG A;  4USI A;  2IVM A;  1HBN B;  3TVY A;  3IBC B;  4C7Q A;  2MSS A;  1RWO B;  2J7U A;  2V8G A;  2B7B B;  3TYT A;  1V5I B;  3WZ0 A;  1X7V A;  2XCR B;  4YB1 P;  2OP5 A;  1P8G A;  4YFN A;  3HOW C;  1Q5Y A;  3BQ1 A;  5K8O A;  5IYD C;  1SL0 A;  1LWE B;  1XNR J;  3KK2 A;  4L76 A;  4JI0 J;  2R2S A;  3HVW A;  4QWC A;  4F26 A;  3G82 B;  3IA0 A;  3LTO A;  3DRR A;  3QGH A;  2C28 A;  4Z37 A;  2RIJ A;  5U47 A;  4KB7 A;  2DGT A;  5D0R A;  2BE9 B;  3ZC4 A;  2WAQ L;  1JLE B;  3T5K A;  3FVY A;  4Q2L A;  2LQ5 A;  5C5J A;  3GTK C;  1BD6 A;  5LXR A;  3GIR A;  2MQP A;  1DJ0 A;  1DTQ B;  2WK4 A;  4U6P A;  1U1P A;  2JA6 A;  1NND A;  1B4A A;  2ALY B;  1TK8 A;  3CCE S;  1N0V C;  2XM3 A;  4X6A C;  2B4V A;  3ENV A;  5IT9 U;  1EX8 A;  4H4O A;  5DG7 A;  3HI9 A;  1I5O B;  3CT9 A;  2HND A;  2IMW P;  3PG9 A;  1UVN A;  1O27 A;  1G6B A;  4PG8 A;  1GE9 A;  2L08 A;  5FLM C;  5MAO A;  3CJS A;  2YWG A;  3HKZ L;  1PJ7 A;  2A2D A;  2OFG X;  1FVQ A;  1VC0 A;  2FLO A;  2AYE A;  1KQF B;  2RDD A;  1UWA A;  4A3I K;  2Y8Y A;  2QLF B;  1N56 A;  3NGK A;  3QX3 A;  1B3T A;  4IRD A;  4NCB A;  1QAI A;  4KPY A;  3TA1 A;  4IO1 A;  1NDC A;  1OY8 A;  3BEG B;  1SJ1 A;  3OSP A;  3R7N B;  3NEK A;  4A3M K;  4NLY A;  1R7I A;  1X8D A;  3JTN A;  4CO3 A;  4HL9 A;  5KT3 A;  2CPI A;  4C8N A;  3W65 A;  1HQM A;  2GVZ A;  2LMI A;  1PC4 A;  2HFO A;  2PD1 A;  2KO1 A;  5IQ6 A;  1UW9 A;  3MED B;  1WNE A;  4M5G A;  4IQX A;  4M94 A;  4PWW A;  2J9E A;  4XK8 C;  4P7V A;  2FPH X;  4DSK A;  5CYM B;  5F41 A;  4LFA J;  2C1E B;  2XY6 A;  3PW0 A;  3POT A;  2NSC A;  1VS3 A;  3VAG A;  1IBK F;  3HJF A;  4R8U A;  2ZHB A;  3PJ9 A;  2EFP A;  3MOZ A;  3M1V B;  2E5G A;  4H4K A;  1RT1 A;  2BRK A;  4ZA1 A;  4ZPB A;  1DCO A;  2HLU A;  4W98 A;  4DHV A;  4KT0 C;  4KHP J;  3EDR B;  4C3H K;  1RT3 B;  2KN4 A;  3TFI A;  1PJ5 A;  3TA0 A;  1NK0 A;  1EP4 B;  2V50 A;  4AH6 A;  2DIS A;  3HHL B;  3CJ4 A;  3IS9 A;  4RR5 A;  3T5L A;  4OI6 A;  3J7A 1;  3HHN B;  1N32 J;  3S1M C;  3DNC A;  2J76 E;  1AA1 B;  4Y7N C;  1RHK B;  4IG0 B;  3KLH A;  1QSS A;  1NKE A;  2ABY A;  2Q6C A;  4QIF A;  1NPK A;  4LF7 J;  4JK1 A;  2YWK A;  4EUV A;  1YVF A;  1S1T B;  1RQ0 A;  3FSI A;  3G6E S;  1P6T A;  3S1Q K;  2BAC A;  1I51 B;  5DG9 A;  4J9S A;  1EAY C;  1I94 F;  1PYT A;  2B8Q A;  1BQN B;  3BH7 B;  4ZP8 A;  3HK2 A;  2DNQ A;  4CI0 B;  2R2U A;  4I2Q B;  5HP1 B;  4WFN Q;  4G1I A;  3JB9 k;  2GO9 A;  3B4D A;  1PGZ A;  4GKJ F;  2MQQ A;  1VGY A;  1MU2 A;  3MM8 A;  1R9T A;  2HSE B;  3IC1 A;  3D68 A;  1N6Q B;  3ITH B;  4FZB A;  2L9W A;  3T3F A;  1V3Z A;  1B0T A;  4ECS A;  1TL3 B;  4QR0 A;  1J6X A;  2JA8 K;  5KFO A;  1KLM B;  1KS2 A;  5DRK A;  2D1C A;  4AL6 A;  3MUR P;  3OL9 A;  1V3R A;  4A93 C;  5KFA A;  3CXC R;  3P3D A;  2Z2L A;  4IFY B;  1FRJ A;  2JVO A;  4Q0B A;  1IKX B;  2FLP A;  3N3Y A;  3HOX K;  3UD3 P;  3SMZ A;  4P71 A;  1UAW A;  4EZ6 A;  3I4M C;  1OSC A;  5IYB K;  5HI7 A;  1TMM A;  2NS1 B;  2OLW A;  1RA7 A;  1TWA K;  3WOD A;  1T8E A;  2ZH1 A;  2QTW A;  4MEX A;  2QMU B;  4FVC A;  3D1Q A;  2DNP A;  2E66 A;  1ROF A;  4FNH A;  2D74 B;  3WIU A;  3J7Y U;  2O5J A;  2JJ4 D;  1J5O B;  3RTV A;  1AFI A;  4DG1 A;  3LP0 A;  3OTO F;  1MW7 A;  2YXL A;  2MQN A;  2Y0B B;  3KYL A;  1S6Q A;  2EI5 A;  4RX6 A;  3B78 A;  1ZZF A;  2WB1 D;  4M8L A;  5LMN F;  2W8K A;  2VBW A;  4PXD A;  2N4C A;  2ZVS A;  3BYR A;  3M2U A;  3MML B;  2FJD B;  1IUJ A;  5IP9 C;  2KT2 A;  2VFV A;  4EBE A;  4ED8 A;  2CQ0 A;  3Q2S C;  3MEK A;  4LF4 F;  1RCO B;  3ELH A;  2VBZ A;  2E1A A;  3GR1 A;  4ANE A;  3SV4 A;  2E2I A;  3D54 A;  3R7S B;  3KHG A;  2J8A A;  5ETS A;  3Q2T C;  2GSO A;  2YKA A;  2W24 A;  1TWF C;  4LT6 A;  3VGV A;  3QT5 A;  1WWH A;  3MEC B;  5JFE A;  4B3M F;  1F2G A;  2LQ9 A;  4ZLP A;  1WC4 A;  1K44 A;  1IWA A;  3V2U C;  4A8K A;  2IY5 B;  2R92 K;  4QU7 A;  2A3J A;  4KC6 A;  5EWE A;  1HQU A;  3UPF A;  1ELO A;  5JVO A;  3MDF A;  4BLA A;  1LEO A;  4RW8 A;  5A0Y A;  1Y4Z B;  1GTE A;  2V4Q A;  3N6M A;  5SUH A;  3M30 B;  3RB3 A;  3K7A C;  5DS7 A;  2XCA A;  4RW6 A;  1IE0 A;  5EHH A;  3OUY B;  5AE2 A;  1VBY A;  3FKI K;  4PQU A;  5ETM A;  5M2P A;  5J2P A;  1JLG B;  2WOM A;  1UL3 A;  5KFR A;  2QL7 B;  4DFM A;  1W7W A;  1LWX A;  5J1P A;  3DDN A;  5SZT A;  1Q0N A;  3I4P A;  3Q8U A;  2KFN A;  1FWK A;  2RS8 A;  1BUX A;  1SV5 B;  3I82 A;  4OYW A;  2R42 A;  2I5J B;  4DJB A;  4JBC A;  4DUY F;  5IWA F;  1U1L A;  2R2T A;  2CYY A;  4LSN A;  1NPR A;  3PW2 A;  2FVP A;  3ILI A;  4ZDN A;  4CH7 A;  3EMT A;  3ISZ A;  1DLO B;  2ZIT A;  3FEX B;  2FHK A;  1WC1 A;  4WK3 A;  3UD4 P;  1H7X A;  4R25 A;  3J81 Y;  3F56 A;  2G4B A;  3P5B P;  5IM0 A;  2VA2 A;  1DBD A;  3V4I A;  5H9E K;  5IC6 B;  1TKZ A;  5HRO A;  4ZVE A;  3BP8 C;  2PGC A;  2LLZ A;  4OHV A;  2KU7 A;  4C2M A;  4O4G A;  1WSV A;  4JI3 J;  2OTJ S;  1K8A T;  2J0S D;  2XMM A;  5B0G A;  2AJQ A;  2XHW A;  1W2I A;  1JLB B;  3L95 X;  3RBX A;  2HNZ B;  3FQK A;  1M0S A;  2J9D E;  4MIA A;  1YZ7 A;  4J9L A;  1L3U A;  2WSC C;  5C3E K;  5CH7 B;  5J1E A;  4ZN3 A;  2MGZ B;  4PCQ A;  5GVQ A;  2VG7 B;  3C15 B;  1WDT A;  3O8W A;  2GX8 A;  2ACM A;  2HHX A;  3MTJ A;  1HL6 A;  2Z0G A;  1VMB A;  2CDR B;  2PHC B;  2W2O P;  2CW0 A;  1ZPV A;  2H48 B;  3H98 A;  1TFW A;  2BQ3 A;  3CCT A;  3IBW A;  2OH2 A;  3P8B B;  4OZN A;  4KHM A;  2ZC3 A;  5F9L A;  1DUR A;  2IM0 A;  4MT1 A;  4B3S F;  3EPI A;  4LMZ A;  1IKV B;  2MLZ A;  4IR1 A;  4GTL A;  2QFJ A;  4X4O A;  4YME A;  1FRH A;  1NJZ A;  2VF3 A;  3RZA A;  1SKR A;  4ZKA A;  5BR8 F;  3FCV A;  4EGL A;  2XMV A;  1T11 A;  2YH0 A;  4TQR A;  4DQQ A;  4OZ5 A;  3RYL A;  1I3Q K;  4A3J C;  3GTQ K;  1RWP B;  4ZS6 A;  3PW5 A;  3A8I A;  1U1R A;  3MD3 A;  5KFI A;  4DBQ A;  5G4D A;  3R9L A;  3FCH A;  4A3D K;  2IC3 A;  3NLC A;  2ZH5 A;  4YP3 A;  3TP2 A;  1RE1 B;  2OAU A;  3QWP A;  3N01 A;  3DRP B;  5GME A;  1NSP A;  3W3S A;  4NYO A;  1I50 K;  5DGB A;  3G9C A;  1U2F A;  3W62 A;  3GTO K;  1JLF B;  2NVY A;  2CPZ A;  1IBK J;  2ZJQ Q;  2RHQ B;  4N56 A;  4J37 A;  1APS A;  2WON B;  4XIU A;  4DUZ J;  3SYZ A;  3VAI A;  2YU9 A;  3MPW A;  1NSQ A;  1LW2 B;  4JI7 J;  2Z4P A;  4V19 J;  1A0O B;  4LSL B;  4LOW A;  1X9W A;  1N52 B;  2UUC F;  5G0R A;  3QIP B;  1SCJ B;  2A0F B;  4NL5 A;  1IQZ A;  1XMO F;  3D9B A;  3W9I A;  4CLZ A;  4C4W A;  2PFF B;  3OV7 A;  1WEZ A;  3MEE B;  4UOC A;  3Q8Y A;  4CTA A;  1C4C A;  4DPO A;  1TL7 B;  4WE1 B;  1TZ0 A;  1Q86 T;  1JOE A;  3GTM C;  4TY9 A;  2DR6 A;  3MZI A;  2LU1 A;  4CLT A;  3G6V A;  3V6H A;  3AQP A;  1TFY A;  5THW A;  2V4R A;  5F3T A;  2C3Y A;  2W9B A;  1CG2 A;  4DL3 A;  3EVW A;  2EBE A;  5IS2 A;  1I94 J;  2DRD A;  5L1J A;  1D09 B;  2FJV A;  1P1L A;  2AJ2 A;  4X4V A;  1SJ3 P;  1JJ2 R;  3OVA A;  2FHO B;  2FGC A;  4B9T A;  3G6X A;  4GKJ J;  3UCZ P;  3FFI A;  3OR2 A;  1FRM A;  3CJT A;  2DNK A;  2VHG A;  5CAB A;  3JYT A;  3N6N A;  2I9S A;  3KK2 B;  1LXJ A;  2HFZ A;  1OY9 A;  4L3N A;  1RK8 A;  3OJU A;  2J9D A;  4RWW A;  1FHT A;  3GTK A;  3DRR B;  1SFO K;  2KXF A;  4I7F A;  2QIF A;  2JH3 A;  2XCO A;  3L09 A;  1MN9 A;  1HNI A;  2LA6 A;  3ENQ A;  4EBC A;  4JV0 A;  2H3E B;  1FVS A;  4BBY A;  3PO3 C;  3GTG C;  3K17 A;  1JXE A;  1HD1 A;  2H4Y B;  2BAN A;  4WZM A;  2D7S A;  2FJW A;  1RAE B;  3ENW A;  2HAI A;  4H4O B;  3MUM P;  5EDW A;  2HVZ A;  3S1N C;  2HND B;  4UUX A;  3D6H B;  1U4B A;  3RRG A;  5HQ8 A;  1H38 A;  4A4J A;  1K0V A;  2CPH A;  2NQP A;  2BKO A;  3HOU K;  2XLJ A;  3CJR A;  5KFM A;  2MZR A;  2MJU A;  1RAB B;  3PRD A;  3MOJ B;  2BKP A;  4RU2 A;  3CJK A;  4XLP A;  2GV1 A;  3C2P A;  1N36 J;  2C3U A;  3CCS S;  1F0X A;  2YWE A;  2CQH A;  2RH3 A;  1IQT A;  2MKH A;  2IFX A;  5KG4 A;  3AOD A;  3KNA A;  5K8M A;  3QJJ A;  2KRB A;  4CM0 A;  3M05 A;  2ZH4 A;  4UOG A;  4AUK A;  5C24 B;  4NZ0 A;  3GIJ A;  1AXQ A;  4DR4 F;  5C4X C;  3IAM 9;  4U9R A;  1RYS A;  2BR0 A;  3H5Y A;  4ZPV R;  5LOQ A;  4LF4 J;  3EIC A;  2A69 A;  2GVZ B;  1QE1 A;  2M0G B;  2Y9H A;  2RQK A;  1YNN A;  2AIR B;  1EH1 A;  2YTC A;  1TK0 A;  3TVZ A;  3K5O A;  1SC1 B;  1FNM A;  3ZO7 A;  4DL5 A;  3IWN C;  1RT2 A;  2JA6 K;  2VAS A;  3POT B;  3UFC X;  1M5V C;  4M1K A;  4BCA A;  2LA4 A;  2MEW A;  3KLF A;  4B3M J;  4OYI A;  2A2C A;  1WSR A;  3RBE A;  4F25 A;  4R8U B;  4Y52 C;  2Q43 A;  3PYF A;  5L1K A;  4Y6I A;  2V68 A;  1AW0 A;  1ACM B;  2X1A A;  3GII A;  1RT1 B;  3OL7 A;  3BKT A;  1Q1K A;  2Z30 B;  2BZ2 A;  1GMU A;  3VAL A;  4A3B K;  1FJG F;  3N0V A;  4QPX A;  3MUT P;  3ISN D;  3IR5 B;  3UCU P;  2BW7 A;  4A3E K;  2AEJ A;  1RTD B;  2FJX A;  3BSN A;  2BQU A;  4UW2 A;  3RRK A;  3IS9 B;  2EFV A;  4ZN1 A;  3THV A;  3PO5 A;  3NS5 A;  5B0A A;  2RSQ A;  1VJW A;  3CJ2 A;  1GMV A;  3SQO P;  2CJ9 A;  3KLH B;  5EGE A;  2VPZ B;  5KT2 A;  2RDJ A;  2BW2 A;  1EFW A;  4DMZ A;  4F4Y A;  3ZZ0 A;  3F44 A;  3LGM A;  5D4L A;  2VBX A;  1GFW B;  2VG5 A;  1DFD A;  3H4B A;  1F7U A;  3JSR A;  4DUY J;  2F9J A;  5IWA J;  2UU9 F;  2XWX A;  1RHU B;  1BWE A;  2GQC A;  3GJR B;  2ZE2 B;  4RPF A;  1S0N A;  2POK A;  4C3H C;  2G13 A;  1WOS A;  4GTD A;  4KV8 A;  4UOH A;  3HJV A;  3GCW P;  3CCU S;  2GSN A;  5IZH A;  1MU2 B;  3MM8 B;  3VV2 B;  5IV3 A;  2MY7 A;  2EKN A;  2CFA A;  3JSB A;  2W9A A;  2K3I A;  2D41 A;  3PHT A;  2BYC A;  2ASJ A;  3GEE A;  1WTF A;  4M95 A;  2PII A;  1B4S A;  2YWH A;  5ETL A;  1UKU A;  3AT1 B;  2Y8W A;  3FK4 A;  4L73 A;  2ROP A;  4ES3 A;  4RJV A;  1AUS L;  2IVF B;  4OIQ A;  4Q0B B;  5GAE I;  3KMS A;  3E01 A;  4WIL A;  2CJK A;  2Y0S L;  4A3K C;  3U1M A;  4KGV B;  4P52 A;  1SH2 A;  3BO4 A;  2ROE A;  4F4K A;  3OTB A;  2V6A A;  4AXI A;  1CJU A;  4KN7 A;  4M5D A;  2BOA A;  3HHD A;  3H3V L;  5I3U A;  4X2B A;  5DO2 A;  4ZJL A;  3OXL A;  4DG1 B;  4ZHR A;  1GEH A;  3WX4 A;  3LP0 B;  4TU8 A;  2N82 B;  3W5X A;  2FD2 A;  3MMJ A;  3JXO A;  4TYA A;  5TMF A;  4PPD A;  1S6Q B;  2ZWO A;  4I6A A;  3CJ5 A;  1BGW A;  3PFE A;  1KHW A;  1IBL F;  2JA8 C;  2DXE A;  2ZUG A;  2W1B A;  2GQ2 A;  4UF4 A;  3M2U B;  1R9T K;  2JFD A;  1J2V A;  3BJY A;  2HNY A;  4WFY A;  2ERR A;  4ZVF A;  4KGZ B;  1F9E B;  3GTL C;  4GT9 A;  1FRL A;  4DL7 A;  5D8H B;  4F0K A;  4E0D A;  4KTQ A;  4BKW A;  2QA2 A;  2XWY A;  1TWF A;  3PO2 K;  2FDN A;  1WEY A;  3S2D C;  2RRN A;  5DET A;  4CO4 A;  3Q8V A;  1SUQ A;  2GC8 A;  1S79 A;  1E6V A;  2NPI A;  2OFH X;  4UZC A;  5CD4 A;  2YKP A;  3CCW A;  4WXO A;  2KM8 C;  2D3U A;  3RG6 A;  2HLT A;  3OD2 A;  3HFK A;  3FDS A;  4B3T F;  2O66 A;  2MST A;  3HX9 A;  1KR4 A;  4X64 F;  3X3U A;  2L9N A;  1UJ5 A;  2W2P P;  4LF8 F;  2RU3 A;  1HQU B;  2NXC A;  3FUY A;  4OIR A;  4QIW D;  1TR0 A;  3S2H C;  4HAC A;  4C8O A;  2Z58 B;  4I6W A;  3ZNJ 1;  1WQH A;  4P75 A;  4RW8 B;  3I5A A;  5A0Y B;  3BB5 A;  4FYX B;  4O44 A;  1ITP A;  1D9D A;  1YZ6 A;  2MB0 B;  3GP9 A;  2VJV A;  1Y5L B;  3MMC A;  3NKY A;  4RW6 B;  1VRU A;  1I6H K;  2YBV A;  4PQU B;  5J2P B;  1N4L A;  1BJT A;  4YDD B;  5C7P A;  5IP7 K;  2WOM B;  1O0P A;  5EGH A;  4ZJO A;  2A68 A;  1JJC B;  2CG4 A;  1RA6 A;  1XWL A;  2FGO A;  4LR8 A;  2AW0 A;  2E2I K;  2F4F A;  1KD1 T;  3R7B B;  5E33 A;  2R7X A;  5I3Q A;  3IFE A;  4C0O C;  4KAS A;  4JI6 F;  1LW0 A;  3EDQ B;  2I8E A;  4LSN B;  1IBA A;  2VPW B;  4LF9 F;  4JI2 F;  2MMY A;  3LAM A;  1S9G A;  3HPO A;  1RWK B;  2R8G A;  4WFB Q;  4G7O A;  2WRM A;  2LXU A;  5BJR A;  1Q82 T;  2ZUF A;  1T9U A;  4HHJ A;  2BA9 A;  1AB8 A;  4J9U E;  3M9M B;  2V8D A;  5IM0 B;  4A8Q A;  2OPQ A;  1ZM3 A;  4A3G K;  3V4I B;  1HMV A;  4N5S A;  4C3I C;  1TKZ B;  4TQS A;  5HRO B;  4OQJ A;  1PBU A;  2IA0 A;  4I68 A;  2VDH A;  1RAF B;  3QZ8 A;  4QU6 A;  4F02 A;  4DPT A;  1CVJ A;  5K9F A;  4O4G B;  1SI9 A;  2HGL A;  1USM A;  1UET A;  5I3P A;  3RB6 A;  1N8R T;  2MXY A;  3GJS B;  3NNH A;  4BLG A;  3VZH A;  1QJH A;  1K83 C;  5K5M A;  4I6Y A;  3H5X A;  2WB1 L;  5ADZ A;  2WBR A;  1JLC A;  3AQO A;  4A8O A;  2WVD A;  5J1E B;  1VQN S;  1O2B A;  4USV A;  1CJT B;  4ECY A;  3ZZZ A;  4F0M A;  3K7R A;  5JVG Q;  1SKU B;  4ZPC A;  5E3Q A;  3MR2 A;  2HPU A;  4FYY B;  3H40 A;  3ZZY A;  1LK7 A;  5E7O B;  4OIX A;  3PV8 A;  4FXV A;  3Q83 A;  3FC9 A;  4GTC A;  3L4J A;  4OHY A;  1FER A;  3CCR S;  1F1B B;  1K1S A;  2MQM A;  1KLN A;  3EWG A;  2R7O A;  3CD7 A;  3TW0 A;  1S4F A;  4DR4 J;  2KYX A;  1M5H A;  2MKK A;  3IGN A;  4X84 A;  4EBD A;  2W8L A;  4KR0 B;  2P9E A;  4WFX A;  1WD6 A;  1FX4 A;  4PKD B;  1IJE B;  4ELV A;  4MIB A;  1G1X A;  5KFT A;  4C48 A;  4FF2 A;  4WCE Q;  1M5P C;  4C2M K;  2APO A;  2E2H C;  2NCK L;  2HBZ B;  2OSR A;  2JNJ A;  3CC7 S;  1F3V A;  3ZZP A;  2IJR A;  4RUA A;  3H25 A;  3R8Y A;  1U8W A;  4J9Q A;  1RBO B;  1NK4 A;  4G1P A;  2KJW A;  1NH8 A;  3JQM A;  3QSI A;  1UWB A;  2GMH A;  3PIO Q;  4QWE A;  2VFS A;  2GZO A;  4TU7 A;  1TKT B;  2VDI A;  5E3P A;  3P45 B;  3U1N A;  4PAB A;  3HF5 A;  1Y5I B;  1S10 A;  2OML A;  3NP5 A;  2GML A;  1YJV A;  3LWM A;  2YQ1 A;  4HDG A;  3AJ1 A;  2P8T A;  1UMJ A;  2DGV A;  1XMB A;  2ZVI A;  2MTL A;  2LFV A;  2IBO A;  2AEM A;  4I56 A;  4OIP A;  4NOI A;  1TTH B;  2Z2Z A;  2HVI A;  3GTM A;  4FBT A;  4CTA B;  5HBM A;  3GFH A;  4F3M A;  3FBB A;  3O6Q A;  2LQJ A;  3CJQ A;  3DGV A;  4X62 J;  4AYB L;  2DHA A;  1QAX A;  3DFE A;  3NCR A;  4ECV A;  3G8S A;  4USJ C;  2DB1 A;  1SQG A;  3T5J A;  3SBM A;  2JEG A;  4KHR A;  2W9B B;  1L5U A;  2NVY K;  1G4C A;  2I1R A;  2CPF A;  3Q8Q B;  4OYZ A;  1R27 B;  4IRC A;  3K5L A;  1ICE B;  3NGR A;  2ASL A;  1RHJ B;  1YX2 A;  2KVI A;  2RGR A;  2JLF A;  2YU9 K;  1GTH A;  3PX6 A;  2FYX A;  1Z1Z A;  4C0H A;  4GTE A;  5IOR A;  4K4V A;  2F9D A;  2DBB A;  4LFB F;  3FFI B;  3OR2 B;  5DDQ C;  2YKO A;  1LWF A;  2EKY A;  3ZXW A;  3GE9 A;  3JYT B;  2D3O R;  3I5C A;  3I4N K;  1UVK A;  2VQE J;  1OYE A;  3BDP A;  4DFP A;  4L72 B;  3D6T B;  1NK5 A;  4C3L A;  1O29 A;  3IGV A;  1QAY A;  3R6L B;  1TUG B;  1HQ2 A;  3GTG A;  3MAA A;  2E5L J;  4I7F B;  5F9N A;  5FLX Y;  4A8M P;  1MRO A;  2B51 A;  4K4S A;  4LRA A;  1HNI B;  1U09 A;  4HTJ A;  3NMA A;  5LL6 d;  2AZ1 A;  4AQY F;  5LMU F;  2HK2 A;  2QA4 S;  2PSZ A;  3NNC A;  4K8R A;  2BAN B;  1ZXO A;  4GVL A;  3F41 A;  1UVI A;  3DRX A;  1F6T A;  2RQC A;  3HXM A;  3M3Y K;  1FE0 A;  3TOQ A;  3JQJ A;  3GSI A;  2F7V A;  2LQ8 A;  4ED0 A;  3ZZR A;  5DG8 A;  3FOE A;  3DOM A;  1Q53 A;  1D9A A;  4URQ U;  5DZ7 A;  3BRE A;  5HAO A;  1R31 A;  2JX2 A;  3CJK B;  3DLH A;  3I9V 9;  4ILD A;  2P2C B;  3G87 A;  3QGG A;  3HOW K;  2W7O A;  4ITS A;  2QC3 A;  5IYD K;  1U24 A;  1IBL J;  4JI4 J;  1GXT A;  1Q5V A;  5C2C A;  3CAG A;  3T9N A;  3GTJ C;  3QT8 A;  2D3O 1;  1OO0 B;  3VA7 A;  4Q43 A;  2B6A A;  2F40 A;  3UNG C;  2IA6 A;  3NCP A;  2E9Z A;  3GTK K;  1QE1 B;  1HHS A;  3SZY A;  3UCG A;  2C42 A;  4X6A K;  1REV A;  1YIT S;  2HQC A;  4A8S A;  1XER A;  1S1V A;  2U1A A;  3KLG A;  1U6B A;  5TMC A;  4NA1 A;  1RT2 B;  5KG6 A;  3RUB L;  4OMF G;  4ZLJ A;  3DXJ A;  3NCQ A;  2P9C A;  3KLF B;  2M8D B;  5FLM K;  3K5P A;  4ED2 A;  4UT4 A;  1WCM C;  2JHE A;  3RZO C;  4KB4 A;  3DLB A;  2GJI A;  1FNO A;  4OJ1 A;  4ZVR B;  5KTQ A;  4MKB A;  2O3D A;  4LF8 J;  5J2N A;  5T14 A;  5D77 A;  3HHL D;  1P27 B;  2DNZ A;  3LWL A;  4P10 A;  1SBR A;  5GMD A;  3PJX A;  2GJ2 A;  3FCW A;  1XMQ F;  4AE5 A;  2XCQ A;  2BE2 A;  3S8S A;  1KN6 A;  5GMK a;  2F5G A;  2M88 A;  3EM1 A;  2KTQ A;  3EVO A;  3T9Z A;  1WEL A;  4A47 A;  2KT5 A;  4NI2 A;  4OYB A;  5B09 A;  4NLP A;  4J9R A;  4MK9 A;  3M9O B;  3UVJ A;  2CPE A;  3R5D A;  5D15 A;  2JFK A;  2P8I A;  2YPY A;  5AE3 A;  4MJK A;  1MWZ A;  2N7Y A;  1RKJ A;  5FDL A;  4F7V A;  4XPC A;  1S76 D;  1YG0 A;  4U7C A;  1LFW A;  2RU9 A;  2XYP B;  3SCJ E;  1CJK A;  1T9Y A;  2VG5 B;  4OIO A;  5HQM A;  2QG9 B;  3OL8 A;  4JI6 J;  4TU9 A;  4BWM A;  4A8X A;  3SSQ A;  3FMW A;  3N28 A;  5B0B A;  4LF9 J;  4ZCI A;  1RTI A;  4ED3 A;  2MZT A;  4KV8 B;  1U1Q A;  4AD6 A;  4IG3 A;  4P72 A;  1FI4 A;  3MM5 A;  2PA8 D;  4KMA A;  3OR1 A;  3CVK A;  2I6W A;  2XCP A;  3E3X A;  5H9E J;  1RP5 A;  4U8Y A;  5HSP A;  5HN0 A;  2ZH9 A;  4UZB A;  2E1C A;  4P2M A;  3S1M K;  2VQF J;  2QLW A;  2NSB A;  4Y7N K;  3ICL A;  4DF4 A;  3PVX A;  1RWM B;  2XB2 D;  3PEJ A;  4DS5 A;  1TWH C;  5CCM A;  3V6D A;  2IDE A;  2H5E A;  1PSD A;  3MM7 A;  5KFE A;  3E01 B;  3CC2 S;  4K4W A;  1NB7 A;  3NGS A;  3RB4 A;  1UA0 A;  5GAD U;  1X0P A;  3N0B A;  5E3A A;  3Q22 A;  2V94 A;  4IFV A;  3VZI A;  4W90 B;  4Y00 A;  2XMK A;  1Y5N B;  1JNR B;  3BDE A;  5LM7 E;  4OI2 A;  2UUT A;  5IT9 Y;  1CJU B;  1F2H A;  4M5D B;  3PRB A;  5I3U B;  2VFT A;  1T9T A;  4ZCL A;  2CXE A;  4ZHR B;  4X4R A;  3CF5 Q;  4UTG A;  1VH2 A;  3G4S S;  4MK7 A;  1UVL A;  1TEL A;  5M3F K;  4RNN A;  9ATC B;  1R8H A;  2H65 B;  1X31 C;  1FTC A;  3U1L A;  2AGQ A;  3H59 A;  3BGF A;  2HNY B;  2M7S A;  2FJE B;  4QIV A;  4ENO A;  3SIP B;  3OT9 A;  4LQ9 A;  3MWB A;  4DV4 F;  2DNN A;  4DLG A;  1FWL A;  4X4N A;  4URG A;  4BLB A;  2V6T A;  1MML A;  3T19 A;  4B9V A;  5KFZ A;  4P73 A;  4GFQ A;  5M2U A;  3ZZT A;  2CJB A;  3I4M K;  1NDP A;  4CRJ A;  1OIA A;  1SUQ B;  1E6V B;  3KHL A;  3SCK E;  3HMJ G;  1YCL A;  2QV6 A;  3NMR A;  3BN7 A;  1Q8L A;  2DGO A;  1O5J A;  2XI3 A;  4P2F A;  3CW2 C;  2XC9 A;  3R1H A;  1FDB A;  2GS8 A;  2CG8 A;  1N5Q A;  4KKO A;  3ERE D;  2N3L A;  2DT9 A;  5K8N A;  4DN0 A;  3EVM A;  1T9W A;  3C46 A;  3L9Z A;  3FNN A;  4Q8F A;  1U47 A;  1XNR F;  4HAC B;  1S7H A;  2KL8 A;  1QDU B;  1VBX A;  2FC9 A;  3MHY A;  2B9E A;  4YS2 A;  5I42 A;  4O44 B;  2IAJ A;  3PRV A;  4NYZ A;  5IP9 K;  4NZ6 A;  4PXE A;  3MMC B;  5B0D A;  2W01 A;  4KFB A;  3H20 A;  4CCH A;  3NNA A;  1IBM F;  1VR6 A;  4CO5 A;  4X4U A;  4I67 A;  1VRU B;  1VK8 A;  2R7Q A;  3U7J A;  4CLW A;  2HHT A;  4IKA A;  3D7S B;  1TL1 A;  2CNO B;  1N0U A;  5KT7 A;  1UFW A;  1RHM B;  3MR5 A;  1TWF K;  1LNQ A;  1TVR A;  3EYZ A;  1RDR A;  4ELT A;  2O5I A;  1U8S A;  2VIC A;  3HOV C;  2WBM A;  1HNX F;  2R7Z C;  1S6U A;  3DOL A;  1FD8 A;  1N5S A;  1R8A A;  2X3G A;  1NH7 A;  1LW0 B;  1XK8 A;  4NLU A;  2UV8 A;  3PR5 B;  2YNG A;  1O25 A;  2NVX C;  1UA1 A;  2LQB A;  5HAN A;  2DNM A;  1S9G B;  3D3C J;  4ECX A;  3CDA A;  3EQL A;  2LEC A;  1SB6 A;  4ZVH A;  2BJ8 A;  3VAF A;  3MPD A;  3GB0 A;  1VIO A;  4LK1 A;  4C0B A;  4M5K A;  2CJA A;  4B08 A;  2AT1 B;  2X1G A;  3K7A K;  1YGY A;  3FSX A;  2ALZ A;  4PYD A;  1RAO A;  2ZFZ A;  1FFS B;  2OPQ B;  2EWH A;  4LBP A;  2CFX A;  1HMV B;  4PZV A;  2HRY A;  3RB0 A;  1X0F A;  1ZTT A;  3EZO A;  2GIR A;  4YB5 A;  4AQY J;  4U67 Q;  4RU9 A;  1K83 A;  3LUY A;  4J7C A;  3CJ0 A;  2IJN A;  3EE3 A;  2DH9 A;  2IM3 A;  2NR0 A;  4DDF A;  4OI3 A;  4DQS A;  5CJ9 A;  1CLF A;  1HBU A;  3OHA A;  4AND A;  2FQT A;  1JLC B;  5AXL A;  2B5J A;  3J7Z 5;  4HEA 9;  2E7W A;  3K0J A;  3QAU A;  4B3O A;  5E68 A;  3QFH A;  2BM1 A;  2MZQ A;  1VQ7 S;  5KFC A;  2MKC A;  1TUW A;  4ECT A;  4KHP F;  2B0G A;  2NVQ C;  4BBS C;  3W66 A;  3VQT A;  2IRY A;  3OVB A;  2ZOF A;  5KFJ A;  5KFH A;  3GMG A;  5AXK A;  1FE4 A;  1EQ0 A;  2FY8 A;  4U7U K;  1MMN A;  2ZUE A;  1HHT P;  3TUP A;  2G2Y A;  4MQ9 A;  2RVJ A;  4ZH4 A;  1N32 F;  5F3Z A;  1VQ6 S;  1K47 A;  4OI0 A;  1M5O C;  2O67 A;  1Y11 A;  5A8K A;  3K5M A;  1YLX A;  4RMF A;  3TR5 A;  2R2R A;  2XO7 A;  2C2R A;  3F0N A;  3W2W A;  3H4D A;  4LF7 F;  1X9M A;  1SMY A;  4KQZ A;  2E2H A;  3T00 A;  1DCH A;  3OLB A;  2QT7 A;  1FKO A;  2VC0 A;  3HZE A;  2G0C A;  3OLA A;  4O3O A;  2QMW A;  5KOX A;  2N4D A;  3FMB A;  1CC8 A;  3IAS 9;  2GGP A;  4QIW L;  2ZKT A;  5KG2 A;  2VJU A;  3GEH A;  3MCN A;  2MQ8 A;  3QGI A;  4NZ7 A;  1EAR A;  2V2Z A;  1UWB B;  3TFH A;  2VKR A;  1WAC A;  3I31 A;  1T03 A;  1HI8 A;  1RTJ A;  1VGX A;  3A8E A;  3ZTS A;  4DV2 J;  2HUR A;  2RT3 A;  2JC1 A;  2PI4 A;  4NXN J;  2YY3 A;  1VQ4 S;  3C3L A;  2A10 A;  4MH8 A;  2AJ0 A;  1LOU A;  1XMQ J;  1KRP A;  4ZVS B;  3GV8 B;  2ZBI A;  2XS7 A;  1K73 T;  4I64 A;  4UQT A;  3QZ7 A;  2AP6 A;  3LF0 A;  4A3J K;  4V1A k;  3C14 A;  2C3M A;  4JUZ A;  4ECZ A;  3N6L A;  3TZZ A;  1Z2L A;  2K06 A;  2BRL A;  5HBM B;  2E7V A;  3CE8 A;  3HHE A;  2F63 A;  3S7R A;  3C66 A;  2L48 A;  4MAK A;  1K9M T;  4N8O A;  4ILR A;  3A8J A;  1Q7L B;  4PAA A;  1TAU A;  5B08 A;  3AXM A;  3I32 A;  1IWG A;  2W7P A;  5EN1 A;  4ZIV A;  5E2Q A;  4ANC A;  2DHH A;  4JV5 J;  3RAM A;  4L3K A;  4G1Q A;  1V9O A;  3JSY A;  1TWC C;  1KSP A;  2LYV A;  1NEE A;  1Q8I A;  2RUG A;  2K8G A;  2V9K A;  2D6F C;  2R7W A;  1FES A;  2RDI A;  4WTY A;  1FJE B;  3FSY A;  3H0P A;  1LWF B;  2PFD A;  2DKO B;  1UTA A;  2O1P A;  1ARO P;  1RSC A;  4Q4Z A;  2OPS A;  3G86 A;  3MAA B;  4ZCK A;  4G6V B;  4CM2 A;  1MRO B;  3SXL A;  2XSJ A;  4ES2 A;  4DV0 F;  2CJX B;  4KGK A;  1FJC A;  4QCL A;  3SFG A;  2XEX A;  5IQQ A;  3MGJ A;  1FNX H;  3GTM K;  1RWV B;  4A8Y A;  2E5H A;  2GMJ A;  1LQ9 A;  2DR7 A;  4ED5 A;  2JLE A;  2WVF A;  5D3G A;  1XN9 A;  2VOO A;  3EGN A;  1VIX A;  4ZLN A;  3PYG A;  2AHO B;  2AD9 A;  1YDL A;  5M3M K;  2VU5 A;  2ZH6 A;  1UW4 A;  3DOM B;  4A3L C;  2CDQ A;  4S0M A;  3MMA A;  2B4P A;  2C2Z B;  4TNO A;  1RIS A;  1O2A A;  3AH6 A;  3GTJ A;  1ZM2 A;  2F4V J;  2KFY A;  1WTB A;  4WKR A;  1VJE A;  1ZAV A;  3HVR A;  4FXW A;  1RU0 A;  1SKS A;  3VWS A;  1HAR A;  4ZVG A;  2K7J A;  1SJ4 P;  1UZD A;  2OGU A;  2PEH A;  3EXY A;  4XTT A;  3CDU A;  1NK9 A;  2B6A B;  3M4X A;  5DQH A;  3CO9 A;  4GKK F;  1X4A A;  2FZG B;  1JKH A;  4KMD A;  2LDY A;  3CIZ A;  4NXM J;  4LUB A;  2AJ1 A;  3BSO A;  3PO3 K;  3GTG K;  2ZWP A;  1L0W A;  5CA5 A;  2MPU A;  4M5I A;  4B17 A;  4JOU A;  2W4D A;  2UP1 A;  1REV B;  3VF0 B;  2DGQ A;  1S1V B;  3KLG B;  3HUL A;  3S1N K;  4YY3 J;  5DGA A;  3PM9 A;  1NKB A;  2KVQ E;  2VUM C;  1YHQ S;  1WCM A;  3RBD A;  3US5 A;  3TTG A;  1B7Y B;  1LV5 A;  3QT7 A;  1EKR A;  4ID5 A;  2HHV A;  1S5Z A;  2R9L A;  1CPZ A;  1WOP A;  3BS9 A;  2ZM6 F;  1ZH5 A;  4M5H A;  4PUO A;  2CWK A;  3WC0 A;  2JVR A;  3S6E A;  4F04 B;  2YNH A;  4QWB A;  5J2N B;  1V6H A;  4GTF A;  4F4Z A;  4KM8 A;  3GZ7 A;  4EMD A;  1JXL A;  2CRL A;  1VHI A;  4ZK7 M;  2CIM A;  5ETK A;  2JEI A;  2CQ2 A;  5C4X K;  4D3H A;  2BE2 B;  5ETR A;  4BXX C;  3EGV A;  1IBM J;  3PFO A;  1KBR A;  4NE9 C;  3DU6 A;  3O1L A;  1XR5 A;  4FYD A;  3GON A;  1ZPW X;  1WHY A;  4JI3 F;  3LW5 C;  4NI2 B;  1QTN B;  1PAU B;  3KMQ A;  3WIV A;  3UVJ B;  3OHB A;  3HKZ D;  3A3O B;  2HHW A;  4BS2 A;  2HQF A;  3P5T L;  4LLG A;  5FDL B;  3KJV A;  4ECU A;  3UE2 A;  5JJB A;  2QSW A;  2FLN A;  3AB4 B;  1HNX J;  1KNZ A;  3NL0 A;  1CJK B;  4X4S A;  4BY7 C;  4O4R A;  3D0G E;  1NO8 A;  2BE7 D;  4Y52 K;  1T95 A;  1ULR A;  1YRU A;  4U8V A;  1WC3 A;  4KIA A;  4MK8 A;  3HP6 A;  3T5H A;  2RKI A;  2KHC A;  1YJT A;  1HW8 A;  3JQK A;  3WX8 A;  4IG3 B;  4FM9 A;  3NOC A;  3MM5 B;  1RAA B;  4ECR A;  1PC5 A;  1KQS R;  3OR1 B;  1B7F A;  4KYZ A;  3TO8 A;  2FTR A;  4H54 A;  4CLS A;  4QW8 A;  2JDJ A;  2DHG A;  5D4N A;  4NLR A;  3TJ9 A;  1GXL A;  1TWH A;  2XO6 A;  3M6U A;  2HWT A;  4DL2 A;  2EXU A;  3CCJ S;  2NZC A;  2CPY A;  2BJD A;  2DH7 A;  3V6D B;  5CZX A;  4CNY A;  2BJE A;  3CQZ C;  1VLY A;  3MM7 B;  3E51 A;  1T3N A;  4KH1 B;  1UZH A;  1VK3 A;  4C3K A;  1HI1 A;  4NA2 A;  2X3D A;  4DCP B;  2JA7 C;  2ZZM A;  4IFV B;  4C8Z A;  2M52 A;  1VQL S;  5FII A;  2DPI A;  4DUZ F;  1KC8 T;  2YVS A;  4HLB A;  2NVT C;  2PE8 A;  1NAQ A;  4FBU A;  4JI7 F;  4LSZ B;  2NXJ A;  4PG6 A;  2UXB F;  2CQP A;  2HHH F;  4UOF A;  1U6Z A;  2PEB A;  4LJM A;  3KG1 A;  2WB4 A;  3D5M A;  4A48 A;  2ZH7 A;  2CQ3 A;  4KPC A;  3RZD C;  3O2I A;  3UI3 A;  1DRZ A;  5JMN A;  1VC6 A;  1U25 A;  1U26 A;  1UJ6 A;  2V8H A;  5JVH Q;  2IYI A;  1H2T Z;  4K4T A;  4A3K K;  3DGP A;  1S0O A;  1BQX A;  1GX6 A;  2GA7 A;  2C2E A;  3A4T A;  3HVA A;  1KVI A;  2XHC A;  3GSD A;  3CTR A;  2MZJ A;  3KJQ B;  1Y1V C;  1DHM A;  2RF2 B;  4KKO B;  4OJG A;  1ZZN A;  3BUE A;  1R8P A;  5H9F K;  3GCX P;  1H0H B;  2KHD A;  3CJ8 A;  1FF2 A;  4IRK A;  1IKW A;  5K14 A;  3GYG A;  2BOP A;  3H5U A;  1R6Y A;  4YN3 B;  3BSA A;  1HBO A;  1JLA A;  2AWZ A;  5I42 B;  2IAJ B;  1AZS A;  3OXG A;  1YBU A;  3KOA A;  3CD0 A;  1JJ4 A;  3QBC A;  5E0O A;  4KFB B;  3GTL K;  2DYA A;  4I2P A;  5ETT A;  1HWU A;  4JI1 F;  2PMH A;  1EET A;  3S2D K;  3LO3 A;  1TL1 B;  3ULH A;  4HT5 A;  4OLP A;  3N79 A;  4O3N A;  5BYQ A;  1U45 A;  5HVG A;  3FHZ A;  1TVR B;  2HGM A;  2CJY B;  1WHX A;  2MKY A;  5CD4 H;  2NYI A;  4KB2 A;  2NVX A;  4ECQ A;  2PA8 L;  1YBA A;  3DOL B;  4Q7A A;  4WBF A;  2PT0 A;  3OBI A;  4HI2 A;  4E2F B;  3R6G B;  4C3J C;  2YNG B;  1C0U A;  1YJ9 S;  1N36 F;  2JOQ A;  3HOY K;  3KHR A;  3S2H K;  4ZCM A;  4OJ3 A;  1RT7 A;  4ATN A;  3EX7 B;  3ZTO A;  3KG4 A;  1PCA A;  2X1B A;  3G96 A;  5C44 C;  4GVB A;  2ZHA A;  5A6P A;  3D1O A;  1RAC B;  3UN5 A;  4DWI A;  2GO8 A;  4K4Y A;  1RT6 A;  3UWT A;  4ZVU B;  3B4M A;  4NLV A;  1F5C A;  2K2P A;  4IH7 A;  2DGU A;  3C6U A;  4HYK A;  2J0Q D;  4CT8 A;  2YQ0 A;  3LAP A;  3VAK A;  3PHE A;  3ADA C;  5D78 A;  4DV0 J;  1DQ9 A;  1S7I A;  3BGU A;  3JTO A;  4X4P A;  3KLV A;  4CLP A;  1T94 A;  2DCU B;  4Q8E A;  2GAG C;  1VLO A;  1HBU B;  2DRA A;  2OMO A;  3AAW B;  2ZEJ A;  2P6T A;  1A9N B;  2DNL A;  2V6S A;  1Y00 A;  2B5J B;  3NWR A;  1JQG A;  4B3O B;  2IJF A;  4MKA A;  3TAM A;  4C8L A;  2ILY A;  2YX4 A;  3D3B J;  5T7L A;  1IR2 A;  4BBR C;  3T01 A;  1SH0 A;  1T05 A;  3BF4 A;  2J8S A;  2QZ8 A;  5KFW A;  4GC7 A;  3T1A A;  4Y0F A;  1EK8 A;  2P5V A;  3A8K A;  1LWC A;  3V5R A;  2J6U A;  2F3J A;  1QUP A;  4QWD A;  3DHW C;  3MF5 A;  1M1K T;  3AOB A;  4NLG A;  5A8K B;  4GKK J;  2VOP A;  2NYH A;  4C3I K;  4FF1 A;  3C8Y A;  4NLS A;  2AKW B;  3W2W B;  1VYA A;  3ITH A;  2WW4 A;  2R7V A;  3TZX A;  1FXD A;  2D9P A;  5HJX A;  2WVC A;  4CYU B;  2AX1 A;  2JA5 C;  2AJ4 A;  1HA1 A;  1FKO B;  4LFC F;  4DV1 F;  2W4P A;  3UN2 A;  3SCI E;  3TAQ A;  4K2J A;  3QNW B;  1K83 K;  4B9N A;  3GYX B;  1UCN A;  2GGP B;  3RAQ A;  3TUI C;  4YFX A;  2ZH2 A;  1SVD A;  2HS0 A;  5D0G A;  4NAS A;  4IDK A;  3X1L B;  3CCV S;  2GVD A;  4ED6 A;  1TL5 A;  1FKA F;  3BR9 A;  5KFN A;  4DUT A;  3QMQ A;  2ZM6 J;  4WJB A;  3KNG A;  3R5C A;  1RTJ B;  3BQ0 A;  4TVA B;  1FDN A;  2KXN B;  2XGP A;  3GIM A;  2EC0 A;  2J0X A;  3Q8R B;  3CO0 P;  5A2Q Y;  3FJ2 A;  1QY7 A;  4OI1 A;  3O5T B;  4RKU C;  5KT5 A;  4HHH A;  2W2M P;  1SL2 A;  5CHP A;  3S1T A;  5L1I A;  4KGM A;  3DDI A;  3DLK A;  3GIL A;  3C14 B;  2A1B A;  4OZ0 A;  1M1H A;  2HMI A;  4F4W A;  2FC8 A;  5GAE U;  3H2V E;  3K2Y A;  2FVR A;  3G8T A;  2Z2Y B;  2E2H K;  2VPX B;  3QAE A;  2A6E A;  3IR6 B;  1HFE L;  1N88 A;  3UDE A;  4RNO A;  1YIJ S;  4CQ1 A;  3B8H A;  4KBI A;  2B7C B;  5EX3 A;  1TWC A;  4LK0 A;  2DO4 A;  3I6P A;  3L4B C;  2EW9 A;  1UVM A;  3UDC A;  2AEF A;  5IFM A;  4G1Q B;  3CC4 S;  3M6V A;  4YDX A;  1WF0 A;  1C0T A;  1FFG B;  3DN9 A;  8AT1 B;  3CED A;  3HO1 A;  2VD3 A;  1DTT A;  4LIR A;  4DN9 A;  3FRY A;  3IWX A;  4DPW A;  6FD1 A;  2AGO A;  2XQC A;  1YI2 S;  2Y1R I;  4MKV A;  1B64 A;  5B0C A;  4DR3 F;  1OQ6 A;  1DQA A;  1SPB P;  5HK4 A;  3GR0 A;  1T7P A;  3W8P A;  4FVM A;  2FB0 A;  1BDF A;  2DNR A;  2COL A;  4C45 A;  4QR1 A;  2OPS B;  1FT8 A;  2AYM A;  2XSJ B;  3TAR A; 
#chains in the Genus database with same CATH homology
 1WSV A;  3GEE A;  1XZQ A;  3AD8 C;  1WOR A;  3GEH A;  1PJ7 A;  1V5V A;  3GEI A;  1XZP A;  1WOS A;  3A8I A;  3GSI A;  1WOO A;  1XZQ B;  2GAG C;  1VLO A;  1VRQ C;  3A8K A;  3TTG A;  1YX2 A;  4PAB A;  4P9S A;  5L46 A;  3TFH A;  1PJ6 A;  1XZP B;  3A8J A;  3TFI A;  3AD7 C;  2GAH C;  3AD9 C;  1PJ5 A;  1X31 C;  3GIR A;  4PAA A;  3ADA C;  1WSR A;  1WOP A;  3TFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...