1VRQC

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords Sarcosine oxidase alpha subunit
total genus 50
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1vrqC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1vrqC01
3GEIA 1WOOA 4P9SA 1WOPA 3A8IA 3A8JA 1XZQB 3GEHA 3TTGA 2GAGC 1XZQA 1XZPB 1YX2A 1PJ6A 3GEEA 3A8KA 1WORA 1PJ7A 3AD8C 3TFJA 3AD9C 1VLOA 2GAHC 1V5VA 3ADAC 1X31C 1PJ5A 4PAAA 3TFIA 1WSVA 3AD7C 1WOSA 3TFHA 3GIRA 1WSRA 1XZPA 3GSIA 5L46A 1VRQC 4PABA
chains in the Genus database with same CATH superfamily
5H9FJ 4NLOA 3DM2B 3H2UB 4F26A 3R5AA 4LLGA 3T41A 4Q2LA 2A2CA 3M6XA 1HQUB 4P7VA 2R9LA 4M5LA 1U09A 1INNA 4OIXA 3H0PA 1Y1VC 2IJRA 1TFYA 3POTB 2IRXA 1F7UA 4ZVQB 4PYDA 1K44A 3TA2A 2XSJB 4ZVPB 5F8JA 1SH2A 2HZVA 3RZOC 1VK8A 4AD6A 5L38A 3G4AA 2UV8A 3OQ2A 1HNXJ 4JI1F 1NZ8A 4NL5A 4CP5A 4KM8A 1WC1A 1DCOA 2MY8A 1X4HA 3UCUP 4A8YA 2W9CB 4DPYA 3IFEA 3MPUB 2DGTA 4R8UA 4C6AA 1CJTA 1AXQA 1KS2A 3P96A 3MECB 2XO7A 2CNNB 5LXYA 1ZZFA 1JJ4A 2OD4A 4QWAA 2BACA 4R0JA 4RW7A 3MAQA 2ZH1A 2Y9HA 5DO2A 2B5JA 2GSNA 1MWQA 1MWZA 1YJUA 5L39A 4DV2J 4LRBA 4WF9Q 2I5JB 3FKIA 2GMJA 4USHA 3RB4A 1B7FA 3QJPA 4YFNA 3MR7A 5BYQA 4AT1B 4GVBA 1BWEA 5JJBA 4DS5A 5IYCK 3DM2A 3FBEA 3DXJA 3DC2A 5LSLA 5LMUJ 4B3MF 2N7YA 2UXBF 3KLEB 3D6FB 4B3SJ 4DG1A 1D3WA 4A3CC 4DV7J 3HP6A 1TZ0A 1P9YA 4QR2A 9RUBA 3TFHA 3UN5A 3ZZ0A 3LGNA 2OMLA 4KARA 1RAIB 4OZ1A 1U1QA 2HHTA 4WFNQ 1T02A 1UVJA 4X4VA 1XQIA 4NCGA 2K7JA 3TUIC 2VG6A 3ZNJ1 2KDOA 1YHQS 5KFTA 3FEYB 2SXLA 4U67Q 2MSSA 5EWFA 2QA1A 1LW2B 4DCJB 3UN2A 3LOUA 4CO0A 1N34F 3IBWA 3KMSA 4OL8A 2DBBA 4A3DK 3ENVA 2MY7A 1LFWA 3MMBA 2FHJA 4RBVA 2YX4A 2C2RA 3KUGA 3MM5A 3ELHA 2DRDA 4I6YA 4LF6F 4WJ3M 2IM0A 3WC2A 1IBKF 2OEJA 1R9TK 2V2VA 2MKCA 2DY9A 4USWA 1CSJA 2WW8A 4IR1A 3LP2A 3BB5A 2H48B 3ZZTA 3V6HA 1MG7A 3PEJA 1W26A 4DSFA 2OJ3A 2K1RB 5IT4A 1ZA1B 2UP1A 3OHAA 2AJFE 3EM1A 3ZTQA 3KLEA 1S9EB 5A2QY 2JC0A 2UUCF 1BDFA 1TWHK 3HVRA 2QSWA 1NKEA 1GXTA 4J5OA 1I6JA 4ZP7A 4W4MA 2DD8S 3CD5A 1Z4UA 3ISNC 3K17A 3PO4A 4MIBA 5DDOC 1SMYA 1APSA 3MOZA 4JI8J 4QPTA 4JI7J 2JEIA 2XI2A 1UJ4A 5KFQA 5HBMB 2WONA 1JLCB 2O1PA 3U27A 1PILA 3M32B 2IMWP 4DR3F 2CDQA 1VQ8S 2B63C 1DHMA 2OAUA 3JXOA 4XIUA 2J8AA 3KLGA 3EQLA 3I5AA 3ICLA 5IYCC 2ERRA 2P9GA 1HR0F 4RW8A 1QE1A 3MMCB 4X66J 4DR4J 5LMNJ 1NJIT 3J81U 1TUWA 1FTCA 3HOZK 1WKJA 1HQ2A 2OGUA 1M1GA 1AROP 2QYGA 2HW3A 1NJZA 1UEUA 1PC5A 2DR6A 3J7ZT 1KTQA 4X4PA 4P10A 3G71S 2DIUA 2P9EA 4NXNJ 2R2RA 2U2FA 3BSAA 5KFIA 4J9MA 1TL1A 3CF5Q 3KK2A 2DB1A 4ZVTB 4IRCA 1S1XB 2XY6A 1QUPA 5CQGA 3T5KA 2MKYA 3S1MC 1B0PA 3CD6S 1IBMF 1WC6A 2BE2B 4O3QA 1XMQF 2C42A 1Z1ZA 2QMUB 2MEWA 4MK8A 4BBRK 5A0YB 4GC7A 3MMAA 4K5RA 1NK7A 1HNWF 1I5OB 2KM8B 3AXKA 2P2CB 1SKSA 2V4RA 2KT3A 1DTTB 3DLGA 2B8QA 5J2NA 1VQ5S 1ZTWA 4CI0B 3JQMA 2BM1A 4C8KA 3GU0A 3KHLA 3DRPA 4PAAA 4QU6A 4PZVA 1GXLA 1SKUB 1IE0A 3BF4A 1Y10A 3VR1A 4HKQA 2MGZA 3JQKA 4QCLA 1YBAA 2PI4A 5FJ4A 2XSJA 4WP9A 4A3LC 3QRRA 3ZTPA 2WHOA 3MEDB 4ZVUB 2XZDB 2W7VA 2M7SA 4F3OA 4KAIA 3IMQJ 2LU2A 3V5RA 2JLGA 1ICEB 2N4CA 5JVGQ 2UXCJ 1HWJA 3BGRA 1VC5A 2PD1A 3DI6B 4LRCA 4R8UB 1VQMS 2NVTC 1BJTA 1N6QB 1HBNB 1FXDA 3OL8A 1YLXA 4CYUB 4WFYA 3GTKK 5KFVA 3UQSA 1V3RA 2OPPB 5BR8J 1NDKA 3IS9A 1U6FA 2B8PA 5I3UA 2ZFHA 1HI8A 2ZOMA 4IOBA 1S72S 2MQPA 3SBMA 4CTAA 4HT5A 2R2UA 2E2HA 2EBGA 3OR2B 4OX6A 4DN0A 3R5CA 3G87A 3UO0A 2G1DA 3OVBA 3DGPB 2UUWA 1VJWA 4X6AC 4JK1A 5GVQA 4B9MA 4CM2A 3AQPA 2O5DA 3GYNA 3NS7B 2CIMA 4OX7A 2W7PA 4F4ZA 4C8OA 2OHDA 3W66A 3HHDA 2F8HA 4LF8F 4IO1A 1MROA 1VISA 4M8LA 2CJBA 2VJVA 1N0VC 1TQLA 5CZVA 3GQCA 1FWKA 2DGUA 2JLFA 3HF5A 1FXLA 3M30A 4GKKF 3CCWA 2E66A 3GTJK 2GNKA 5A8RB 4KGXB 2KH9A 2YVSA 3Q22A 3FQLA 4C3HK 1QY7A 5J2PA 3NP5A 3S17C 4KRWA 1TWAA 2OLWA 4IDKA 3C6UA 2WAQL 4J9UE 4BY7C 3EWGA 1U49A 4M5DA 2VG5B 4A3JK 2LU1A 1R7IA 1VQLS 2HWIA 7AT1B 4NI2B 4KH1B 4PPZA 2J7WA 4DS4A 3I4PA 4ETZA 2VONA 4C97A 2KT5A 3HLUA 4ZVRB 3OREA 4NZ7A 1A6LA 4DPXA 4L6V3 3DRSB 5B09A 3MUTP 4Z7CA 3ONQA 4AL7A 2AYGA 1SJRA 1XPPA 3PR4A 1AFJA 4KB7A 2Y1JA 3POTA 3MMCA 2ZH2A 2R92K 3MMLB 5DM6Q 5ETQA 3S14C 4YDDB 1NHUA 3BDEA 1M0SA 3NMRA 3PRBA 3NG8A 2E7XA 4KFBA 1J27A 1X4BA 4ZPAA 5EDWA 4X62J 1H72C 1X4GA 1K8AT 1IBLJ 2E1CA 4C0HA 2WSFC 2V8HA 1YG0A 3DFEA 4ZP9A 3FRZA 2M88A 3P5TL 4KBIA 3T1YF 4BXXK 2E9ZA 1VMBA 1T9YA 4ZKAA 2B7BB 4WPAA 3K5MA 3MPDA 3GEHA 1FKOB 2K3KA 4WZQA 1UA0A 2ZH9A 4LRDA 5KFNA 2R4FA 3GFHA 4IG0B 3ILIA 3H90A 1RTDB 1VQOS 2CPEA 4BWMA 2BM0A 2CPZA 3A1YG 2BANB 4HTIA 2VV5A 2YQ3A 3RAMA 1JLQA 2HVHA 4LIWA 4WKRA 3GSDA 1RT4B 3BP3A 1BQMA 3FK4A 1CJKA 1HWIA 3T9NA 2ZUAA 4DDQA 1TU0B 2MKSA 2KTQA 4C2MK 3TANA 2C3UA 2JA7A 2HWTA 2NLWA 3Q2TC 3L95X 3GTQK 3GTGA 2V2KA 3GIMA 1PAUB 2ILZA 1C1BA 1F9EB 5JVOA 3TZXA 4AFFA 1EP4A 4BBSC 2B63A 1BHNA 3UD4P 1UFLA 2Y0SD 4AL5A 3EJMA 1AB4A 3VF0B 1S9FA 2FQQB 3BH6B 3HXAA 5F8HA 2NVTK 3PEHA 3UR3C 1Y0HA 1U0HA 4OX9F 2ZOGA 1K0VA 2AGQA 1E6YB 4CNYA 4DL4A 5E33A 1O2AA 4RO0A 1USOA 4MEYA 3HOVK 3T9ZA 5IYDC 2J0WA 1S79A 2HNDA 1VQ6S 3GJRB 4Q8FA 2VFTA 5B0DA 2QO3A 4ZVOB 2IC3A 1MW7A 3HSZA 4LF5F 2CNLB 2EI5A 2KL8A 4WE1B 4HI2A 4U96A 2LLZA 5HMZA 3MCNA 2YNFA 2CJQA 3DXBA 3BH7B 4OYBA 4DFPA 3RRKA 2EPIA 2N3OA 3PJ9A 4P2SA 1ITPA 1RHRB 4KIAA 3DLBA 3DHXA 1FJGF 2IFXA 4OI6A 3TEHB 2DNLA 2QFIA 4K4ZA 1KQFB 1Y5LB 1KHVA 2RAQA 1NKCA 5KT2A 2BUNA 3LGHA 3H4BA 3CJRA 1VBXA 3AH6A 1SQFA 2PHCB 1S97A 2HGLA 3JSRA 3BP8C 2B7CB 1WIHA 1YSJA 3E2EA 4YHHJ 3LP0B 1WKLA 1IBAA 2ZVIA 4EEYA 3CWJA 2BQRA 1ZZNA 5G4DA 2YKNB 4U6PA 4M5DB 3O8WA 5A2QU 3D1OA 1IKVB 3DRYA 2R7RA 2PO4A 4HLBA 3HMJG 1SIZA 2W25A 1RT7B 1MROB 1Y00A 2FJBB 3H98A 2G13A 1HQMA 1IKYA 2G2YA 2QL9B 2W2QP 3ILLA 1PAEX 2AU0A 5J1NA 2Y8YA 2YX1A 4FNHA 1RP5A 2GVDA 4QWCA 3WIVA 1LWFB 2VFVA 3UD5A 1KONA 1EP4B 2YWFA 3GZ7A 5FDLA 2AEFA 2F1FA 2ZKUA 1R31A 3AD7C 3HOUC 1JMTA 4JI4J 1SV5B 2VD3A 3EXYA 2Z2MA 3EZUA 5HLFA 1R0CB 1NK4A 1TWCA 3I9V9 2G4BA 2F9JA 3PJXA 2QMWA 2B9XA 1RUSA 2NVYC 1O51A 2LFVA 3RR8A 2VUMA 4A48A 2A68A 2JRSA 1TV6A 1FKPA 4K2XA 5KFLA 1N32F 3J81Y 1RWPB 2ZD1B 3W5ZA 2R2SA 4BXXC 1QSLA 1D0EA 4K4WA 4FKXA 1Q82T 4OZ5A 3G6VA 3ZZRA 4DUYJ 1AZSB 1Y3KA 4RPFA 1R3NA 3TA1A 3MM8B 3K58A 1FDAA 4I1TA 2PEHA 5E68A 3G86A 2GMLA 2V6AA 4GRSA 1Y1WK 2JL9A 3BBBA 4DQQA 3LANA 2B3TB 3WC0A 4DSKA 3UD3P 1FRIA 1HW8A 1B70B 2GJ2A 5TMCA 2EFOA 3THPA 3N3YA 1D9DA 4FYWB 1U6BA 2P5VA 3HSJA 3I0RA 3HSGA 2F65A 3ISZA 3I9ZA 5T14A 4UT4A 2ZE2A 1T03B 1T05B 2GO9A 1LEOA 3MCMA 5ETNA 2Z56B 4ZS6A 4DBQA 2RKIB 3PYGA 2W9AA 1UTAA 2E5GA 1CS4A 2NXNA 1X5OA 4JI2J 1IKXA 4B3OA 2ZC3A 3DRXA 1GMUA 4DSJA 1IR0A 3FMWA 1YJWS 4WJ4A 1FEHA 2KHDA 1C0TA 1SBRA 2AWZA 8ATCB 1LV5A 5K14A 1CULA 1TKXB 2R93K 4L75A 1TAQA 3HOYK 4B9VA 2J9CA 4UOFA 1UFKA 2KZZA 4QW8A 3W63A 5GAHU 1LKZA 3PHEA 5F8LA 1LXNA 5HI7A 4ECVA 4NYZA 2I2YA 3NNHA 4X6AK 2UUBJ 5LM7E 2YKNA 3LGMA 2R93C 5GAHI 1TL7B 3S1QK 1RBOB 3W2WB 3CJQA 4I64A 3CCES 3SMZA 4LQ3A 4OHWA 1DQ8A 2FZGB 2KG0A 4USIA 5FD1A 4GO7X 1RT6A 2HK3A 3SI8A 3ZZZA 3CXCR 3AXMA 2O5JA 1WG4A 3G4CA 3NS6A 2CQ1A 3FCVA 1FRLA 3QYYA 2JVOA 3KHGA 2JSXA 2LDYA 4OI4A 4LF9F 1IQ0A 1FK9A 1FFWB 2ZNYA 1RT6B 2C2ZB 1KQ4A 2J6SA 2ZNZA 1VGYA 1EI6A 1WACA 1TWGA 1S7HA 2J5AA 1XMOF 1EX8A 1UZHA 1CJUB 3C14B 3DDNA 5M2UA 1LWCB 4HYKA 3U1MA 4LF7F 1RB0A 6FDRA 4NLXA 2RVJA 2JX2A 3AD9C 1HWUA 1O27A 2OKQA 3S15C 1RWUA 3ETMA 3MTKA 2W2PP 4LR7A 3OEPA 2JVRA 2Q43A 2BABA 3TUZC 2XS7A 3OLAA 2GVDB 3J7A1 4LF9J 3L7OA 2A2DA 2PN6A 2ALYB 1VLOA 2VBWA 3D1HA 4FKYA 1RWMB 1JKHA 2GZOA 2HURA 1I6VA 4A3LK 2RF2B 1RT3A 1RT7A 2HFZA 1X4EA 3M8ZA 4O4GA 5L9NA 2NXCA 4KY3A 4CO5A 2YNIA 2XM3A 1UJ5A 3GTPK 3OV7A 2AYMA 4HDGA 3HHNB 1DRZA 1S0MA 1X0PA 3QPIA 4QOTA 2XCRB 2Q79A 2HBQB 4WE1A 4OIQA 1IQTA 2J7UA 3TUPA 5ETSA 2QV6A 4A93C 3VVTA 3A4TA 4WP8A 2HLUA 5KT3A 4PPDA 3G2XA 3EDRB 4C8YA 3DOKB 4OZ2A 4DV5J 3TNVA 4RW4A 2UUAJ 2W24A 3OW2R 2JC1A 1EK8A 4J3NA 1NPRA 3QZ7A 2DNNA 4IH5A 2MKHA 4QR0A 3ITHB 1N36F 1JLCA 3D0HE 4J9KA 1S48A 1U24A 3OPKA 1T94A 3V4IB 5K20B 1N54B 4DFJA 1ZM3A 3V6JA 2FVQA 2OPQA 3DN9A 2KVQE 5A8WB 1Q8KA 1M5SA 1WF2A 1X60A 4A8OA 4XCHA 3BPSP 1H7WA 3IRWP 1T8EA 2HQGA 2VFSA 3GE9A 5C4XK 4WU2A 4EBCA 2IA6A 1M90T 3GTLC 2R2TA 3D1QA 2ZH6A 2FJVA 1RLCL 1WI8A 4WU3A 1O26A 1DD5A 2PEBA 4A46A 1S1TA 5GAEI 1WG1A 2DIVA 2R8JA 2X1BA 3T1AA 4RMFA 4BY1C 4HDHA 4EO6A 5ETOA 1U26A 3G6XA 1SC1B 3MM9A 4RU2A 2GAGC 1IJEB 2RH6A 2CQBA 5K8NA 2UU9J 4WZMA 3KLFA 1U1NA 5E3PA 4ILMA 4BDPA 1RT5A 1WSRA 3GPAA 1BMQB 2NVXC 3AA8A 3RAXA 5M5YK 4CIOA 2B56A 3MEGA 1CJTB 2PSZA 3PRDA 3W9JA 3F73A 3KUHA 1RBAA 3H59A 3DHWC 4NMLA 2CZVC 5LSRA 4LT6A 5DG7A 2VFRA 3OXGA 1YJNS 1LOUA 1DTTA 4K4YA 2P9CA 3PX6A 5H9EK 4CH1A 2CUYA 3PTWA 3TFIA 1LK5A 4M95A 3J7YI 4CO4A 2JA7C 1UVMA 3P3DA 2D7SA 2XG8A 3W8PA 3ZZYA 4KGVB 3NAIA 2IYGA 5IOLA 2JDJA 5A6WA 2RF2A 2B6AA 4NXNF 5E2QA 3TZYA 4LK0A 2DYAA 1U45A 1EJ7L 2W7AA 1FJGJ 4O44A 3RZDC 1S57A 4GKKJ 1I3OB 4JP8A 2IYIA 4RW9B 3L7UA 2EFQA 4AQYJ 5ETPA 2XC9A 2V6TA 4IUFA 1DAXA 5LJ5Y 3RB6A 3TVZA 2YKPA 2GJFA 2QE5A 2RE1A 5IP7K 2YKMA 3ITHA 2DRBA 1SC6A 1VRQC 4X4RA 3C3LA 3ZTRA 3VGSA 2OFHX 2PIIA 1KHWA 3AY0A 4A3CK 2RNEA 1EB0A 2JA8K 2CQ3A 1S9GA 3LUYA 5D78A 3W60A 2CPXA 3IM9A 2XMTA 4EI2A 2ALZA 4USMA 2FHOB 4H4KA 4NCBA 4V19X 3R1LA 3A13A 1W25A 1I94F 2RDJA 1MMLA 1HD1A 2OIHA 4NRUA 2E2HC 3V6DA 5AXNA 5F8NA 4RZRA 1U6ZA 2VB6A 5KFJA 1Q8LA 2RMLA 2D1CA 3CVKA 1RTJA 4C4WA 3M7VA 2XMAA 3MM9B 4IQMA 4DG1B 2Y3PA 2BRKA 2QLJB 2EBBA 2E2HK 3V6DB 4LF2A 2RU3A 4F4AA 5CYMB 3PO2C 1GX5A 5EWEA 5CD4H 1QDUB 3KTQA 1NAQA 4X64F 4N5SA 3W3SA 5KG4A 3VZIA 1YJVA 3PX4A 4DPUA 1TELA 3BUEA 1O5JA 2CJYB 1F3VA 2MQNA 4EU0A 3CQZA 4C8ZA 2MKJA 5C3EK 3W65A 4WYWA 1ZQ1C 5DRKA 3G8SA 4LSLB 1WHYA 5B0FA 2MLXA 4M94A 4OJ1A 1TWGC 5GAGU 4DV1F 4KKOA 3SYZA 2A6EA 1XMOJ 5JMNA 5CZXA 3QO9A 5JFEA 3AOCA 2X3DA 2JFDA 5LMNF 3MCSA 2CJKA 3D5MA 2GAHC 3MEGB 5C44K 3PY8A 2HNZA 2H9ZA 2Y1RI 2HQ3A 4WXWA 1A7GE 1L3TA 5AE1A 4JV5J 5LT5A 3HOWK 3OXFA 2HHXA 4JYAF 5DS7A 2CXEA 2M8DB 5D8HB 4X4SA 3UCZP 1MU2B 1F7VA 3VAHA 3A8IA 3BN4A 4NCAA 3LTOA 3AAWB 1JLEB 2WSEC 2DGVA 5E3AA 3Q8YA 4OI3A 2HFSA 2IPOB 3HOWC 3P8BB 4DR4F 1F5CA 2GX8A 4Z37A 4IO9Q 4KHMA 1C1CA 4KFBB 3LQVA 4FXVA 2B4UA 1R6VA 1KWMA 2KJVA 4LFAF 3KLHA 1WCMA 4HHHA 2HRYA 1GE9A 1CJVB 4DF4A 1ZPWX 1ZA2B 4QIFA 3ILJA 2V34A 1PYOB 4NA1A 4WXOA 4O0IA 1U0HB 5DGBA 4CLKA 1XN9A 3OTBA 5E3QA 3DGVA 1FX4A 2RGRA 4M5KA 2QIFA 4Y34A 1KFSA 2CQ4A 2QL7B 4XK8C 3LH2S 1Q81T 2NSCA 3CO0P 4A4JA 3M6WA 2XMKA 1OSDA 4QYRA 4ZCMA 4KB2A 4RUHA 1FNMA 2GS8A 3OFHA 3H25A 2A6OA 5KFCA 2ZKTA 5A8KB 4QJVA 4ZLLA 5AE3A 2RH3A 3NMAA 4RX6A 4V19J 1HNXF 1JKHB 3D6TB 2OEMA 3FJ2A 3SXLA 2A1BA 4DQPA 3KK3A 3WODA 1VHFA 1VQNS 1LWEA 4C11B 3E3XA 3JSTA 4I69A 2HNYB 3NXZA 2ZHBA 1RE1B 2PC6A 3I5CA 1JNZB 1VQPS 1NJYA 4I68A 2DR5A 4CM0A 4F8RA 4F04B 4KATA 5F8GA 4G0VA 1WDDA 2ASLA 3GTGC 5BYSA 1RJJA 2PMZD 1REGX 3NS5A 5HQMA 3OVAA 2QLXA 1KEKA 1S77D 4CLWA 3Q83A 4C3LA 1C4CA 4BC7A 3GJSB 2G0CA 4ZLPA 2IJNA 1I94J 2YNGA 1C0AA 1CLFA 5B0AA 1HA1A 2EFNA 3ADAC 2AF6A 2A69A 9ATCB 3I55S 1JLQB 1WOSA 3MTJA 3UN3A 3QJJA 4G7HA 1FEEA 3HOVC 1R6YA 4ZCIA 1TL3B 4TY9A 3DXSX 3BDPA 5J2QA 4G0WA 3PIOQ 2E5LJ 4DX8H 2CPYA 3KK1A 5KFMA 4IRKA 3EVWA 1PBAA 3ZTOA 2DO4A 2MZ1A 4YY3J 1FJCA 4TN2A 1RACB 1CVJA 3C8YA 3TARA 4DR6J 1M1KT 2CJAA 1TUVA 4NLUA 2DH7A 4B3TF 2MKIA 4ZJOA 1VH2A 3M3YK 3CDUA 4HT7A 5BJRA 2DITA 3Q8UA 1XR7A 2W8KA 2IJFA 4ZLNA 4OI2A 5BXIA 1SVDA 1USMA 4DDFA 2W4CA 4A8MP 2UU9F 3C15A 5KFBA 1E6YA 3NWRA 4A3MK 3Q0AA 1RWOB 2BQ3A 3KXDA 2XSFA 5IT0A 2MJNA 3IR6B 3GCXP 3PFOA 5C5JA 4TYBA 1HBUB 2BJ1A 1RAEB 3H3VL 1WC3A 5DG8A 3Q8RB 2D69A 2BJ9A 4C3HC 3ET6B 4NLDA 3BO4A 1Y9OA 4FZVA 5CYMA 3RB0A 1R0AB 1S1WB 4ES2A 5KFKA 3NCPA 1LW0A 2AJQA 3HK2A 2H4YB 2GCFA 1CC8A 4WFBQ 1V5IB 2BKOA 4ZDNA 1GK8A 3C66A 3E51A 5IWAF 3CMQA 4MT1A 1CS4B 2DHAA 3G82A 1N5VA 1X4DA 3FFIB 4F4XA 3MPYA 3BSNA 4OYPA 2JNJA 3DLKA 3TW0A 1FDBA 4NI2A 1B7YB 1ZYRA 4N56A 2OTLS 2AJ0A 4ANEA 2RSQA 4BY1K 1YJ7A 2D9PA 3CCMS 5EUHA 3HZGA 4FM9A 4B17A 3ZC4A 3IM8A 1LWXA 1GMWA 3HFZB 4Q4ZA 1CULB 1A9NB 1WEYA 1U02A 1HPZB 2L9NA 4K5SA 2B4VA 3MWBA 2GQ2A 3I82A 4A8XA 1HYSB 2YU9A 3OD2A 1T7PA 4DUZF 3GTQC 4NWBA 1SPBP 3M9NB 2RQKA 2AMCB 3PW2A 2EC0A 3GFZA 4NRTA 2C2DA 2LDIA 3M4OC 4YMEA 3CEDA 5HJXA 4N8NA 4OHZA 4AE5A 1JLFB 3D66A 3SDEB 1ULRA 3FNNA 1WF1A 1KQKA 2QTWA 4GTCA 2QG9B 2RS8A 5CCLA 3VAGA 1U2RA 4K4UA 4C11A 2R93A 3OT9A 3TI0A 3Q89A 2ZOFA 2BBEA 2DGSA 1NM2A 2CPHA 2OP5A 5J2QB 4C8MA 4RW9A 4ELTA 2DHGA 2QC3A 1QVGR 1AUDA 4NLPA 3LWLA 1HBOA 1TV6B 1N5YB 4GTBA 3L9ZA 4UQTA 4FXWA 1RTIB 4XO0A 1J98A 1B64A 3TAMA 2XZTB 5DETA 1ZS6A 1TVRB 2IBOA 1SC4B 1K47A 4JI3F 2BJDA 2DXDA 1RWXB 2HBZB 2FGCA 2J0QD 1EQRA 1Y5IB 3SCKE 3AT1B 2GIQA 2WBRA 2RRAA 2KYXA 3LAJA 2MHNA 2HMIA 3SFUA 1FNOA 2IVFB 1RTDA 4FS1A 1YITS 4ANCA 2EBEA 4LFCJ 5KFAA 1FO1A 1D8YA 5DDRC 2DJWA 4JB8B 4USVA 2ZJQQ 2A18A 4BLAA 1U4BA 4KB4A 5AXKA 2XY5A 1VI7A 3ET6A 2UUBF 2HVEA 2KVIA 2JA7K 2KXNB 1FJEB 4LK1A 2DHXA 4YDXA 2AD9A 1VDHA 4UOGA 3W62A 3CQZC 1RHQB 2IRYA 1O25A 4ATNA 4PG8A 1R9TA 3C16B 5IQQA 4ELVA 2OTJS 4DR2F 5TMFA 1NBEB 2L9WA 1U2FA 5K5MA 1WHVA 3Q24A 4ID8A 2VG7A 4ZN1A 5HMYA 2F5GA 4NLVA 4MQ9A 2KO1A 3PACA 5KG7A 4P72A 2NXUA 3BBCA 4NLSA 3W9IA 4P6QA 3T5LA 2PPBA 1VHIA 2K8GA 1WUUA 4NE9C 1N33F 3M8QA 3R2CJ 1K0TA 3ULHA 2M3DA 1XNRF 3GIIA 1N88A 5L1JA 4JI1J 1MN7A 2JOQA 4DMZA 1I6HC 2FTRA 2FZKB 3KDNA 1YJ9S 2LP4A 3KNGA 3NOCA 5DLGA 2E5LF 3GONA 3T5JA 1WC4A 3GIJA 1F5BA 3P5BP 1QJHA 1PGZA 3ENQA 1OJ4A 2BJEA 3IC1A 2MMYA 2DNZA 3D54A 4FYVB 2ABYA 4PG6A 2GHPA 3AJ1A 2AEMA 4U7CA 3GJQB 4Q5SA 3HOXC 1G3OA 2E1AA 1N5QA 4KKOB 2ZJPQ 4RW7B 3GILA 3OPFA 4G1QA 1SC3B 4LR2A 4V1Ak 4BLGA 1EARA 3US5A 1EH1A 3MR2A 2CWXA 2M8HA 4M1XA 2VICA 3EYZA 4Y65A 1T9XA 2BX6A 2VH7A 3TX0A 1NB7A 4ZP6A 4ZK7M 2IBKA 2ROEA 5B0GA 5D3GA 4RJVA 1DURA 4PQUA 1Y1WC 2B51A 4O4RA 2C3MA 4RW8B 4DQIA 4DL3A 2GGPA 5L9XA 1FKPB 1RWKB 5E7OB 3R5GA 2P6TA 2QA4G 1Q95G 2BEFA 2LCWA 2XCQA 1NDCA 2XULA 3RGIA 4Y52K 4QPXA 1HHTP 4C3IK 3N6NA 4KE5A 3KOAA 3KWMA 1IW7A 2KFZA 1NSKL 1MN9A 3DOLA 4L72B 1TKDA 4OZ0A 4FDFA 1VC6A 3RG6A 4IG0A 2FB0A 4ED7A 3NNAA 1NKBA 1HL6A 1OY8A 2EK6A 2VBYA 3Q3QA 2ZBRA 2LVWA 3R6LB 3THTA 2ASDA 3DLEB 2MQLA 4DV4F 2VFUA 1FE0A 2WVCA 3TQ1A 3OR2A 5BR8F 4LOWA 2E1MC 2XMJA 3J7AN 1PO6A 4C98A 2VHGA 1NZAA 1ROFA 1C1CB 1B4BA 1AT1B 4F36A 2VPXB 2XO6A 3C6UB 1TWCK 1NH8A 3DMJB 4S0MA 4KHRA 3SQGB 3QT7A 5J2NB 3DLHA 1GFWB 4M1KA 4U7UD 4RUCA 3H3VD 3PYDA 4WP3A 2OFGX 4NOIA 5IP9C 4NLWA 2ZHAA 5AXMA 2DR9A 2ZFZA 4DUYF 1C2PA 3R9LA 4A3GC 4L74A 1OY6A 1NSQA 4AXJA 2J9DE 4JV1A 2C22A 4OQJA 1FWLA 2NXEA 2QEXS 5EGYA 1YX2A 1P6TA 2FHMA 1FCAA 2Z57B 1MMNA 4OHYA 3GG0A 4Z2XA 3SZYA 4XLPA 4IYQA 5I42A 1VBZA 1RTJB 1EHWA 4D3GA 1FTRA 3QIPB 2JLEA 1G7CB 2WSCC 4Z7YA 1VYAA 2BE7D 2C2KB 3LPXA 3S01A 5E41A 5KFDA 1N5TA 4C2MA 2GSOA 1HYSA 1VQ7S 3EGVA 2AYBA 2X1FA 3F0NA 2VG7B 2BYCA 4F4WA 4FF3A 2BW2A 3JTNA 2EKYA 3NCQA 5GMKa 3RZDK 3PG9A 5M2RA 3GTOA 3MECA 1RAFB 3ENWA 4TU9A 5A8KA 3GV7B 2YWGA 5M5XK 2XB2D 3QGHA 1K73T 4JYAJ 2LYVA 2KXFA 2HFVA 4PYAA 1UP1A 3S8SA 1FHTA 2BDPA 3H5XA 1RK8A 1XMQJ 1C0UB 1Y1VA 2DRAA 2NR0A 2ZITA 1RKIA 2AJ1A 4JI0F 5K8OA 1ELOA 1RT3B 3IS9B 2NPIA 1N56A 4DJBA 3M2VA 2HNZB 1M1HA 2XWYA 3PXGa 2WW4A 3CD7A 4PWDA 4KMAA 2V4QA 3EGZA 4RLEA 5ETVA 1ZAWA 5L1KA 3OUYA 2B6AB 2B0GA 3DI6A 1JK9B 3IAS9 5HVHA 2G2OA 2UXBJ 2APOA 5CCMA 3H0GK 4JV2A 4KPYA 2QRRA 3PRVA 2HMIB 4P5BA 4C8LA 4KN7A 1N5SA 3MAAA 1RBLA 4YQWA 1K83C 4WCEQ 3M6UA 4N77A 4QU7A 2RUGA 2VU5A 3OSNA 2CRLA 3MAAB 4X84A 2KFNA 2KZMA 3FRYA 4Y2CA 1KBRA 3HDSA 3DGPA 3R1HA 1IKVA 4G6VB 4ECXA 1J6XA 4Q0BB 4ZVSB 1ACMB 1IR1A 2R8KA 4KMHA 3GTJA 5F41A 1D9FA 5KTQA 4A8WA 2HVIA 2KRBA 2G0IA 3MEDA 3A3OB 4CLFA 1NPKA 1E6VB 2F4VJ 4DOZA 1QD1A 3EMTA 2RDDA 3CC7S 4A8QA 4Q8EA 2OELA 3QWUA 1F0XA 4W92B 1FF2A 4FVCA 2E7WA 4K59A 1O2FB 3DU6A 3H42A 4TLQA 1YI2S 4GC6A 4RU9A 4G3IA 3M8WA 4A3JC 1BY9A 3VVUA 3CJ0A 1LW0B 4HTJA 4P5AA 4UY85 3VCDA 5D0RA 2HGMA 1G6BA 3BQ1A 2CNOB 4YFUA 3KHHA 5H1SV 3DRRB 2IRUA 2YTCA 3PCOB 3RZOK 1UWAA 3L4BC 2VOOA 4QIWD 5FDLB 1Q1KA 1DJ0A 2CQPA 2F40A 3GTPC 4IFYA 3EXCX 3CGIA 1FERA 2ZH4A 1NHKL 5E0OA 5B7WA 1NK6A 3QO9B 3TUJC 1UMJA 1GTEA 1TKZB 1S0VA 2HPUA 2I5JA 2XGPA 2PA3A 4WFXA 1S9EA 2KFYA 2WRMA 1JNRB 1N34J 5CD4A 1URNA 4ZITA 4F4YA 4YOEA 2DPJA 2GFFA 3QLHA 2VQFJ 4CO3A 3BEGB 3OTOJ 2QLWA 2JZ5A 2HAFA 2VQEJ 3VZHA 2IY5B 2FD2A 5THWA 2DNPA 4K4TA 4X62F 2MTLA 4B3RJ 4YY3F 2IM3A 3B78A 5TJ3A 5D4NA 4B3MJ 2HG4A 2V9WA 4E0DA 3PW4A 3R7BB 4BS2A 1G2EA 3A3NB 5HMWA 3I56S 3CJ3A 1ZXOA 1KN6A 4YB1P 2XY7A 4OIPA 4ZLJA 3HM9A 4IG3A 1H3DA 3TFJA 3DMJA 2CJ9A 2BANA 3FC9A 2E9RX 3MEKA 4TU8A 3ETOA 4YB7A 2VA2A 1VQSA 3K5OA 3VV2B 2C3YA 1UL3A 3LA0A 1OQ6A 4QWEA 4HHJA 4GKJJ 3T01A 1S49A 4Y7NK 4KASA 3MAHA 4ZVGA 2PA8D 2ZEJA 3UDLA 2AQ4A 4BCAA 4NLGA 3J7Z5 2LMIA 5B08A 4A3DC 2W2OP 2HHHJ 2HRUA 4NYPA 3QSIA 3I6PA 2NQPA 3SV4A 1DCHA 2CG4A 5CYQA 1HNWJ 2XYHB 1VQ9S 5D0HA 1T9UA 5KG0A 4Y2AA 2MZJA 5HP1B 4LFAJ 3GB0A 4QZVB 3MM6A 3OTCA 4E8UA 2ZWOA 2ZC4A 2FQTA 1X5PA 4ECTA 4B3OB 1REVB 5DDPC 4ECRA 2E7VA 2XNRA 4GKJF 3BKUA 3W2WA 5LJ3Y 4DZDA 3SIPB 5HQ8A 4DX5A 2GHVC 3NUHA 4P9SA 4EUVA 3ZZPA 3BM7A 5IC6B 4O3NA 1VCTA 4DR5F 3UCGA 4G7OA 1HWLA 5KFUA 2BMBA 3FZBA 2DNRA 3MUVP 2ZM6J 4MJKA 4PABA 3RRHA 5K14B 5EGEA 5FLMC 5F8IA 1RHKB 2E44A 3W7BA 4ZIWA 2E29A 4ZH4A 2M70A 4FP9A 3KHRA 3G9CA 2XYGB 3HT0A 1VR6A 3AJDA 4JI8F 1DQAA 3L4JA 1Q7YT 3PDNA 4GMKA 3WX4A 3CUNA 1B99A 5KG3A 1NEEA 2ZH7A 1Y1WA 3S0XA 2YKAA 3FGVA 2F7VA 3G8TA 3C46A 4U7UK 2R42A 1HLWA 4F4KA 5KG5A 2G0JA 2CADA 1F60B 5D0GA 2IVMA 4DI6A 1NPPA 3W64A 4F67A 4UZBA 1URRA 4B9NA 1BLUA 1I3QK 4DN9A 1HHQA 1IVZA 1PC4A 3G6ES 1YIJS 1EQMA 2FC8A 1FRMA 3HJVA 3KG0A 2NZCA 4J9PA 4OX8A 2XMMA 4KSEB 3HPOA 4GTDA 1GAOA 3TAPA 4DL6A 1RA6A 5KFRA 1RWVB 5DM7Q 4DR7J 5J1EB 3F41A 3QAEA 3JB9k 4YHHF 3QT5A 1BE4A 1UEVA 2R7XA 3H0GC 3QMQA 1CJKB 3B4DA 1H2VZ 2MGZB 2FC9A 4KM9A 2BOAA 1IJFB 3W9HA 3KG1A 2VASA 1U8WA 3WIUA 3TJAA 1S6QB 3R5JB 2LA6A 3GIRA 2BJ7A 2VIHA 1S59A 1KP6A 1KLNA 2K1RA 1TVRA 2FQOA 1RQ0A 4MKBA 2V8GA 3NOGA 2EW9A 2A0FB 2BA9A 1ZTTA 4O23A 5SZTA 4ECSA 1L3KA 3V81A 2RKIA 3D3BJ 1JXEA 3RW7A 3KNAA 3KJVB 4ED3A 4F02A 2AGOA 4KPCA 2F4VF 4KGZB 4JI5F 2XCPA 2FJDB 3CJKA 4TY8A 4Y00A 3UR0A 1XR6A 4NYOA 2LQBA 3J81j 3HHEA 2IM1A 3H20A 4LSNB 2V63A 8AT1B 4ZPTR 4YP3A 3D28A 2BZ2A 4A3EC 1PBUA 4NZ0A 5IOTA 5CHCB 5CABA 3NGUA 5IV4A 3QQCD 2VOPA 2DGWA 2LEPA 4U9RA 4OHVA 2K2PA 5AE2A 2Q6CA 4MYTA 3I96A 3NNCA 2ASYA 2QJ3A 2X7IA 4DCPB 1FRKA 4DV0J 1UEKA 5LL6d 4DL7A 5I3QA 4F0MA 1JLAA 4FF4A 5C3EC 5KFYA 4JI6F 2OPPA 3T6BA 4IDKB 5D6GA 4K2JA 2JWNA 3T5HA 3DOMA 1UV7A 4X4QA 2NSBA 1RAHB 1RDRA 5HROB 1TK8A 2XMUA 4PG5A 4LUBA 4RNMA 2H3EB 3FSYA 1SL2A 4UQGA 4QYZK 1PG5B 4RWWA 4P71A 2MQOA 1I50C 5D0EA 3QJLA 2I1RA 4I56A 2AHOB 1HD0A 4LFCF 4OV1A 5J2MB 2K3IA 3D67A 2VQEF 4F0HA 3G8QA 2JA5A 1B0VA 3HVTA 1NMEB 4JI5J 3HKZL 5DG9A 3N4WA 3GTMK 4KYZA 4H4KC 3MMJA 3IR5B 2Z58B 1V3ZA 1FRXA 2DKOB 4CYUA 3I4MC 3O5TB 4N41A 5AJ3J 2BJ3A 3OR1A 4LVOP 2VKZG 2WVBA 2F3JA 1N4LA 2H54B 1FKOA 1S6PA 3RBEA 3KMQA 4KHPJ 3THVA 2H51B 1NSPA 4I7FA 4WTOB 3MOJB 2IAJB 3CDBA 4NEZA 1K83A 2HFUA 1PJ6A 2CVEA 1FXRA 2V6SA 1WQFA 2WB1L 4EZ9A 3M2UB 3WHIA 1HARA 1V9OA 4QIVA 2CYYA 5E3RA 2UVRA 3KFWX 4A47A 3QNWB 3PVXA 1LNQA 3SSSA 3G6YA 4Y6IA 3P6YC 1WD6A 5GMEA 3BO3A 2KXHA 5KFZA 2N3LA 4XDDA 4XPCA 5M5WK 2F4FA 3K5LA 3CJ5A 3FSIA 2B9YA 3LAPA 4DR1J 2HRTA 3D7SB 3H4DA 1JOEA 4URSA 1VJQA 3J80U 5F9NA 2DNGA 3O44A 3HFKA 4KT0C 4OIRA 1M5PC 3OL9A 4YN3B 3TWZA 5HBMA 4DSEA 2GVZB 3EVOA 1CJUA 3C14A 3W8GA 1N0UA 2QA4S 3CQZK 1B4SA 4LF1A 4JV0A 4IOAQ 4ZCLA 3M3YC 4G1PA 3TEGA 1RI7A 2EKNA 4H4MA 3E01B 5EGHA 2QYCA 3HOXK 3K2YA 3NGDA 5C24A 1S0OA 1SH3A 4ED5A 2XHWA 1YDLA 3HVAA 3MXHP 4P2MA 5KFPA 2LXIA 3PJWA 4CRJA 4FVMA 1X9SA 4OYMA 1RAJA 4P7TA 3OSPA 2MSTA 1U25A 2BE9B 3VAMA 1F3FA 2QN6B 2GIRA 1JLGB 1J5EJ 1I6HK 2FLPA 2V4JA 2I6WA 2LA4A 1IWAA 1S1TB 4RNHA 1VRUB 4IKAA 1FDDA 3AD8C 4F3MA 4ZP8A 3NWGA 3U1NA 2RQCA 3GYXB 1JJCB 2J0XA 1Z2ZA 4K0KF 2Q66A 4WILA 2AKWB 1Q79A 4YR2A 2V50A 2EC2A 3TZZA 2XNQA 4KH0B 5A76A 1SV5A 3DOMB 1SFOK 4DR1F 3KUEA 4DX7A 2BKNA 2ILYA 3FEZA 5CH7B 5T7LA 1X8DA 1RHMB 4JUZA 4DQSA 2ZZTA 1ZPVA 2KRRA 4J9NA 3MZIA 3GTLK 1OQ3A 4BKWA 3IRXB 4URGA 1S1UB 4DPTA 5JXSA 3CCLS 1O2BA 5GADU 2V94A 2MZRA 3M4OK 3KLHB 1UWBA 5C4JK 2HNYA 2Y3YA 2WONB 3I0SB 3TJ8A 4I2QA 4ZHRB 2W4PA 2P6SA 1FESA 2KT2A 2V2ZA 3HD1A 1XXCA 3F44A 2PI5A 1SFOA 4RW6B 2CKWA 3J80Y 4MIWA 2IIHA 4HHUA 2GA7A 4IFVB 2XQCA 5DJBA 1Y7PA 1VBYA 3PIPQ 1HFEL 1HIYA 3V4GA 2D3UA 1BGWA 1HHSA 3R2DJ 2OH2A 4ES1A 3EVMA 1QVFR 2MB0B 3MM7A 3WDOA 1U48A 1EQ0A 3Q2SC 2E1PA 5GADI 4WKYA 2KU7A 3OUYB 3IWXA 2LQ9A 2WVEA 3DYAA 6AT1B 1KFDA 4Y52C 2JA6C 4EBEA 2M9KA 4J9VA 5ETLA 4RNOA 3OFEA 2HHVA 5IP7C 2N4DA 4ID5B 3T3FA 2KJWA 3NY0A 3HHLD 3TTGA 5DLFA 4OLOA 2UVUA 2X51A 3OTEA 4DU7A 3O1LA 2M5YA 5K8MA 3RB3A 2R8IA 4EFAC 3LP1B 4HR2A 1X9WA 4USTA 4TY8B 2PMHA 4FS2A 1YK9A 3GP9A 2P8IA 3OHBA 1H2TZ 4ZVFA 3OL7A 4LREA 1L3SA 3HSDA 3D6HB 1XK8A 2O5IA 4NEYA 2DNMA 3B4MA 1VIXA 1XMBA 1UWBB 1VS3A 1ZETA 2CFAA 2E2IC 3CCJS 4DV2F 1TKXA 2XHCA 1M5HA 5HL7Q 4EMDA 5D4DA 1IR2A 4KDDA 1QE1B 4L76A 5C42A 2QSFA 1YBUA 1U1MA 1BQXA 2Q3PA 1XZQB 2H5IB 2WBMA 1S1VA 2HNDB 5KFEA 4H4OB 2HS4A 2R7OA 1HMVA 1NK8A 2ZJRQ 4O2DA 2YKQA 5J2PB 3S1NC 2ROPA 4CZCA 4ZPDA 1KLMA 3FKIC 1BD6A 4F50A 2YWKA 4DF8A 4O0NA 2HBRB 3OJSA 1YWXA 2GW8A 3ISND 1J5EF 4GTFA 4IRDA 1RCOB 2G1HA 2J6UA 5G0RA 1QAXA 4HH1A 1X9MA 1TR0A 2R7SA 4DXLA 3C15B 3HOYC 1OO0B 1X5SA 1HKAA 4ITSA 2I0XA 2B9WA 3ZXWA 4QW9A 3HXMA 4USUA 2FGOA 1D9AA 1SKWA 3R97A 2ATCB 1TWFA 2COLA 1T0TV 1HBUA 3EZOA 2MLZA 1Q78A 4CDIA 2ZH8A 2FVCA 3T02A 5KFGA 3N0CA 1ZM9A 2NUHA 5FLMK 5HQLA 4BBSK 3L7PA 1B4AA 3JSMB 2DNOA 4M5NA 3HJFA 2C3PA 1TMMA 1WORA 3Q8VA 1U0SA 3IAM9 1VJEA 3L09A 3TP2A 2UV8G 1VQYA 2E5HA 4M5HA 3CCVS 3V81B 1AYEA 4LQYA 3DOLB 4J37A 2DK2A 1WI6A 3GFYA 1HNIB 1EETA 5ETRA 1YKWA 4RUBA 2FDNA 2YQ0A 1L0WA 2ZHOA 2AT1B 3S2HK 3V2UC 4GTLA 2XWXA 3BJYA 3FVYA 3BREA 2VODA 2R7TA 3V6KA 2XI3A 3CJ8A 3QFHA 2NVYK 2ZBCA 3MFHA 1VLYA 4EO8A 3D0GE 3R3TA 1O28A 1NXIA 4LF5J 1R0BG 3I4NK 3IN5A 4ED1A 1JQGA 3TOQA 2F8MA 3BKTA 3EGWB 3M8QB 6FD1A 2ZWPA 2YH0A 4DLGA 4X66F 3JYTB 3KKFA 2ZUGA 4ED2A 4KC5A 2OO4A 3K5PA 2MDAA 4ED8A 2JEJA 5HJYA 1F9FA 4O3OA 3R7NB 4G65A 4NLYA 1N33J 4C9DA 1REVA 4PWUA 1JJ2R 3GTYX 5AT1B 3S1RC 1VBKA 1LWFA 3MCOA 1JWWA 5CA5A 3LALA 3BPDA 4ZIVA 4XTTA 2V69A 3DRSA 3KYLA 3NCRA 5E5NA 2YNIB 5KG2A 2OPQB 2ZH3A 3QIPA 5JVHQ 3MURP 1N52B 4C3KA 5IV3A 3F56A 1P9QC 1YZ7A 5C25B 2OSRA 3UDCA 2DEIA 2JA5C 2FZCB 1XERA 3IP0A 4NMXA 1YBTA 3ZFVA 2V68A 3R8YA 2ZZNA 4CCHA 1OS5A 1FVSA 5MLCV 1N36J 3BGLA 3O3LA 1HI0P 5FLXY 1NHVA 1W2BR 1S1VB 5C2CA 2NREA 1UA1A 3ZTSA 4MK7A 1TK5A 4OV6A 4YEAA 5L1LA 5KG6A 2HBYB 4P73A 1UVKA 3DDKA 1NO8A 2IAJA 1RT4A 2RDIA 5ADZA 2WZ1A 2D3ZA 1FI4A 5IYDK 4OYZA 4UOHA 4YG2A 1IBLF 5F0UA 1EIYB 2DPIA 3IGNA 1RGVA 2CQCA 1IM6A 4NLTA 2CQGA 1WCMK 4CWBA 2HHUA 3CO9A 4B3RF 1IS1A 1RISA 2VC0A 3DU5A 1AW0A 4GTEA 1CPZA 1UETA 1FD8A 1XWLA 2VUMK 5F8MA 5DZ7A 4WWSA 3C6TA 4KGKA 2HFNA 5IYBK 3AOAA 3HCXA 1R89A 3LO3A 3UI3A 4HACB 2ADCA 5IP9K 4XSZA 1D8ZA 4Q44A 4WK1A 1SH0A 1RT5B 3N01A 3DLJA 3V4IA 3M8SA 2HEKA 2EEYA 4LRAA 1KOHA 2JA6A 2MZTA 4FPIA 2ADBA 5KT6A 1FRHA 2VZ9A 1JVIA 3PX0A 1XNQJ 2NCKL 2IM2A 2CQ0A 2R7VA 4ETXA 1F2HA 5D4LA 3IPJA 2DY1A 1NCLA 4O44B 1KD1T 4DLEA 4D3HA 4JBCA 4OYAA 2BR0A 4WJBA 4NXMF 1SJ4P 4P74A 4DPWA 1N6QA 4WK3A 3MDFA 3JYTA 4KN4A 3SCIE 5D15A 3N0BA 4DR3J 2DR7A 4H4MB 4OYWA 3RZAA 1I3QC 5SUHA 3I0RB 1BQNB 4WFZA 4GT9A 2JA6K 3GG1A 5I3PA 2C28A 1RU2A 3U02A 2YX7A 3H5YA 3UFCX 1ISEA 1FJ7A 3WQPA 2UUAF 4ILLA 3H7HB 3BQ2A 3RW6A 2XLJA 3TAQA 4CLZA 1AFIA 4K8RA 5RUBA 4X65F 1OY9A 2IVYA 1NK5A 2JEGA 3GEIA 3TVKA 1DY3A 3VWSA 1I50A 4R5PB 2NVXA 1R27B 3S2HC 1QTNB 4ES3A 3VAKA 1WEZA 4LFBJ 4P75A 4J91A 4C45A 3H0GA 2GIFA 3S7RA 3KJQB 5IOSA 4CT8A 3QAUA 4A3KC 1RA7A 1VGXA 5EHHA 4N47A 3GTMA 1V5VA 1X31C 3AOBA 1NK9A 1JLFA 4LFBF 3BSOA 4XAKA 2ZZMA 3R27A 3AB4B 1TKZA 5IWAJ 3S6EA 2EG2A 4PUOB 4BLBA 3HOZC 4I0WA 2RUSA 1HQEB 1PJ7A 1F1BB 3KK2B 4X2BA 5EWGA 2UVWA 3UDVA 2CPDA 2RB7A 1VIOA 1WC5A 2ZBIA 1NLKL 2W9BA 1NK0A 1HW9A 2POKA 3RJMB 3QFWA 4URQU 3MEEA 3AHPA 1YRXA 1HBNA 1F9HA 4UUWA 1R0AA 2VC1A 4QYZJ 1QAJA 4DV5F 1OPIA 1HQUA 3B54A 3BGRB 3EE3A 4ZVEA 1Q7LB 2HVDA 1EKRA 2ACYA 5KT7A 3N6LA 3FHZA 2NVXK 4ZJLA 2HGNA 2XGQA 2PMZL 1J5OA 2L9DA 3B82A 1S1UA 2JHEA 4HACA 1Q86T 2RRNA 3BYPA 1S0NA 4XLNA 1XR5A 3N5BA 1PSDA 1RT1B 2VA3A 3FKIK 5DQIA 1S6PB 3MR3A 1WHXA 3CD0A 2CQIA 2VQFF 3QGPA 4J9OA 3C2PA 1TWHC 1RZMA 3IRXA 2QX0A 1T11A 3JS9A 2E5IA 4KO0A 3PZPA 4I2PA 2AIRB 5DQGA 3SV3A 5L1IA 2ZE2B 3H5SA 4H54A 4OFZA 4U95A 3MD1A 4A3KK 4MYUA 1WQHA 3PV8A 4LR9A 1HQEA 2V4JB 4DU8A 4QJVB 4M5IA 4ENOA 3TYTA 1W7WA 2QT7A 1JB0C 5I3UB 1RT2B 3QX3A 4ZMMA 1RYRA 3QLHB 5IQ6A 4LR8A 2D3O1 1H7XA 3W61A 4WIQA 1P8GA 3MM6B 2BV3A 5KFHA 3FBBA 4RWXA 4PXBA 3NGRA 1TWGK 3QGIA 4OYOA 2QGFB 3CE8A 4PCQA 3BO2A 3SSQA 5KFFA 2EWHA 2ZBQA 4ELUA 2WAQD 5HATA 2Z30B 2HIYA 5CXTA 1S6UA 4I2QB 4ZHRA 4MFBA 3CDEA 3DLGB 3QGGA 3S1MK 2V8DA 1SI9A 1DCPA 1FX2A 5D3GB 1N32J 4DL5A 1BC6A 4IFVA 1KKHA 4FPRA 3IWLA 3K57A 1H73A 1SQEA 2HHHF 2P5MA 2HHPA 2Z4PA 2CVIA 1T95A 3EGNA 1S7IA 4B08A 4A8SA 1DZ5A 4JV5F 5T41A 1CJVA 1WWHA 1HI9A 2YKOA 2O01C 3SCLE 1S6OA 1FVQA 2CQDA 5C4JC 1WTBA 4L3KA 5IT9U 1JLBB 1XZQA 4M5GA 2JEFA 3FUYA 1QUVA 2R8GA 4BY7K 3IG1A 1BS2A 2M2BA 3W2VB 4XDCA 4Y28C 4LF4J 2KB2A 5HO4A 3H40A 2OMOA 3OXLA 1UAWA 2ZH5A 5ETKA 1UCNA 3EUNA 1S76D 3W2VA 2DT9A 5HL8A 3GCWP 3GTKA 3FFIA 1C1BB 1LK7A 1NB2A 4YUDA 3CCZA 4GZYA 1FD2A 4C3MA 1KR4A 4DEZA 4E98A 2PDAA 3MPVA 3IA0A 1VQ4S 1VRUA 3NGTA 2QA2A 3GV5B 2CDRB 2I9SA 2GHWA 4K4VA 4G7ZA 2W8LA 4QBUA 1EAYC 2DCUB 3MD3A 2Z0GA 2PGCA 3CSKA 4I67A 4FYDA 2AW0A 1HBMB 3S16C 1RT2A 4C48A 4MFBB 2GV1A 2UXDF 4BBYA 2V0NA 4AYBL 3BKFA 4FZBA 2NVYA 3CJKB 2DXEA 3M05A 4JI0J 1YQHA 3FSXA 3FOEA 1P1TA 2HQDA 2XTJP 3E01A 4R5PA 4ICLA 3CCTA 3C19A 1ZBTA 4LSLA 3PFEA 2W2NP 3IO1A 4OZNA 2EVZA 1AB8A 1UVNA 3PNIA 1VOMA 3NKYA 1R9TC 1FRJA 2HZCA 4WIIA 1R8HA 5HVGA 1J2VA 4A8FA 5F9LA 3ZO7A 4ED4A 2FUG9 4HVZA 3N0VA 4DV6F 3G4SS 2YPYA 1WF0A 3M1VB 3NEKA 3FOFA 4B9TA 1QLNA 1O24A 4WFAQ 3G82B 3T19A 2RIJA 1YCLA 1UFWA 3K0JA 4NCGB 5C42B 3CULA 2U1AA 4Q43A 1YNJA 3CJ2A 4IOCQ 4NA3A 4CLLA 3FBFA 1K9MT 2R8HA 1Q4RA 3GMGA 2MYFA 4DPOA 3TO8A 4AQYF 1U1RA 4ERDA 4PRFA 2MLYA 2FLLA 4J90A 3U7JA 1Y3JA 1GQEA 2MQMA 4BHQA 2FVRA 4J9RA 4NLRA 1RABB 4K50A 1NUEA 3CTRA 3IGVA 1HNZJ 2HK2A 2MZQA 3HZEA 1RHUB 2CWKA 1F2GA 3HVTB 2J9EA 7FDRA 1RCXB 4Q45A 4MEXA 4C3JC 1RU1A 1RTZA 3S2DK 1XXBA 1XIQA 1I1GA 4ER8A 1N8RT 2DISA 5EX0A 2F9DA 3QBCA 1T3OA 1F5AA 4DFMA 3EPIA 3OLBA 2FY8A 1Q5VA 2X1AA 2F8EX 3M4XA 4KMUA 1UW4A 1S6QA 3TRGA 1J6WA 1I50K 1WNEA 3CB4A 1N5YA 3Q86A 1QSSA 3JTOA 2HQIA 1SUQA 2VPWB 1IWGA 4OYIA 2DGXA 4NA2A 4NZ6A 4Q7AA 4RKUC 1WSVA 2EFPA 1T3NA 1EFWA 4I4BA 2Y0SL 4QWDA 3LW5C 2V9KA 4JI4F 1C0UA 5AXLA 2CAJA 5KOXA 5A8RA 2V5HG 4RNNA 5KT5A 3BR9A 1O0PA 2OD6A 3NRBA 4F7VA 5EX3A 1JLBA 2R3VA 1JLEA 1T03A 4DV3F 3T00A 1KLMB 3BN7A 4GO5X 4IQXA 2BE5A 2FJEB 3S1TA 2G9OA 1C0TB 3FZ2A 1HBMA 2ASJA 3CCSS 4DV3J 1S5ZA 1KTVA 4F3QA 2Y8WA 2DEJA 1RXOB 3CJSA 5D77A 3M8RA 2M52A 2XLKA 3KJVA 2MKKA 3X1LB 1RTHA 3NL0A 4MKVA 2I38A 5LMUF 3CDWA 4ILDA 1SJ1A 2R7WA 3ENAA 5C24B 1O6XA 3D3CJ 2HQFA 3QSYB 1F93A 3GTOC 1NSAA 5KOWA 2DNQA 5CYQB 1GH8A 1RTIA 4UUXA 5AJ3F 1QM9A 1MNEA 3K7AK 1DBDA 2PA8L 2CA9A 3R5BA 3IXQA 4RR5A 2FPHX 3DCAA 3NGSA 4ZJQA 1I3QA 1CG2A 2L48A 1GEHA 3VTIA 4C2MC 3HHKA 2BE2A 3BQ0A 3PKYA 2YU9K 1V6HA 2C3OA 5ETMA 3R6GB 5HSPA 4TQSA 1EETB 1KQGB 2GO8A 1SQGA 2K06A 2Y1LB 2JFKA 4KQZA 5GAEU 2HWHA 2OPSA 3DYAB 2YNHA 2ZDOA 4B9UA 3M8PB 3GYGA 3K5NA 4NOHA 1RSCA 4DSLA 3D4JA 3FEXB 1G4CA 1H6KX 3RUBL 2CZ4A 2AX0A 1LWEB 2YKMB 1O8BA 2E2JC 2IA0A 1GT8A 2N82B 2XS5A 4OJGA 4E2FB 4IFYB 2QZ8A 2WK4A 2IDEA 3T1HJ 4AYBD 5B0EA 1VC0A 3EICA 1ZH5A 1TP7A 3H5UA 2YWHA 1XC9A 3I0SA 3PO3C 4U8VA 1R43A 4LF7J 1RT1A 2RT3A 4MTPA 2VKRA 4A8KA 3N5FA 3D0IE 4ECWA 1ZAVA 1P27B 1O29A 4N8OA 1RU0A 1I51B 5KT4A 3MEEB 2QLBB 4M5MA 1FT8A 2R7ZA 3OVSA 4RBTA 2YNGB 2D41A 3S14K 3NLCA 4JOUA 3UNYA 5KFWA 2OPRA 1TUGB 4DSIA 1R8AA 1JQWA 4UZCA 1V3SA 1OPZA 1Q16B 3RBDA 1UPMB 2XCOA 3RBZA 2OSQA 1GTHA 2IC3B 3E8OA 3CCUS 4OLPA 3VAJA 3RTVA 2R92A 2H5JB 3I5BA 4CLSA 4Q5VA 2RHSB 1TWFK 2G2ZA 1PKUA 3O6QA 3OJUA 2BW7A 3VALA 1S4EA 5A8WA 1WKKA 3HHLC 3W5YA 1SJ3P 4DR6F 2KKHA 1IN0A 2XCAA 1OYEA 3V4MA 3KLVA 3S17K 2RU9A 4IH7A 1M5VC 2E2JK 3ERED 4MH8A 3DLEA 4TLRA 3ZNUA 3CMAS 3A12A 2VL1A 1GMVA 5HROA 4RW4B 4NX9A 3EDQB 2KG1A 1LFPA 3CC2S 4AH6A 4TYAA 1PYSB 1HNVA 4H4OA 3TX8A 3VGTA 3KJNB 3N79A 2W1BA 3FKBA 3MM7B 4NASA 2HZAA 4O4GB 3KG4A 4CTAB 2MXYA 4YS2A 5J2MA 2ZD1A 3GWCA 1JLAB 3OBIA 4DV7F 2R7ZK 3A8EA 2DXFA 1JXLA 4J7CA 3DKDA 3CIZA 4XPEA 1SJQA 2FVSA 3SQGA 5ETTA 2M4MA 1CQMA 3JSBA 1YZ6A 1TL7A 2DTJA 1S99A 1XBWA 5IT9Y 1NRKA 3GLJA 1YNNA 2HVZA 4UTGA 4LF4F 4KAWX 2HLTA 3UE2A 3NAHA 1FNXH 2VJUA 3M2RA 4J9LA 1UKUA 4MKAA 4DX6A 1R8PA 1R8CA 5M3FK 3KLIA 3BGFA 4EYIB 4DFKA 2MQQA 3M30B 1YRUA 1WG5A 1D1UA 2FY1A 5IS2A 2MJUA 1S9GB 3GFXA 3LP2B 3TVYA 3MM5B 1GNKA 1RTHB 2FYXA 4FXDA 5LOQA 3K7RA 2Y1IA 5A0YA 4AUKA 3HD2A 4QIWL 3M8PA 4QR1A 4XSXA 2NZ4A 3NBPA 1NNDA 4OZLA 2ZM6F 2XBPA 3VHQA 2PFFB 3AA9A 2CG8A 4CLUA 4JI7F 1IKWA 1SXLA 3GTJC 3WX8A 1VK3A 5FLXU 2DVIA 4DUZJ 5C44C 2FJWA 2HAIA 1FE4A 5HVFA 4UY8T 2Q6BA 1H38A 1LXJA 2YPZA 3I4NC 4I7FB 1JIHA 3PYFA 4MK9A 4DUTA 1BUXA 1PYTA 1H74A 1UJ6A 2CPJA 1U47A 2W7OA 2E2IA 1BGXT 3EX7B 2CFXA 3BYRA 4DHVA 1DQ9A 3QZ8A 1TL1B 3CNQP 1DTQB 3QRQA 1RADB 4JI6J 2E5JA 3SFGA 1WELA 3A8KA 2MHEA 4HI1A 3C16A 2W2MP 4BBRC 1MSWD 1VRTA 2NPFA 4HH0A 1TWFC 2YWEA 3QRPA 1IKXB 1Q8IA 3JQJA 5KAKA 1LQ9A 4PR6A 5GMDA 1K1QA 3IBCB 2ROGA 3Q8QB 4L73A 1LWCA 3B8HA 2UXDJ 1WQGA 5C4XC 3TJ9A 3N28A 2ZUFA 5CAAA 3PO2K 4JI3J 3FBCA 4KV8A 2OEKA 2FVPA 1XXAA 1NDLA 1OIAA 4X64J 1B0TA 2BJ8A 4MIAA 4KV8B 1TWAK 5DGAA 4FN5A 1Y5NB 3VGUA 3QATA 2VPZB 4NXMJ 3QIDA 3LWMA 1AUSL 2JA8C 1U7LA 3BR8A 4K7QA 5DZ6A 1KSPA 3LAKA 2EXUA 4DR7F 3U1LA 4B02A 1KVJA 4CLYA 3M6VA 1SFOC 1DLOB 3AQOA 3FCWA 5IORA 3MGJA 3EPGA 4N7TA 1CC7A 3DLLQ 1GX6A 4LBIA 1NJXA 4FBTA 2HS0A 3DRPB 4ID5A 4PKDB 1P1LA 4EK2A 4J9QA 1E6VA 4B3SF 1KVIA 2CW0A 2QFJA 2NYHA 1XZPA 2D9OA 2ACMA 2J6TA 5A6PA 4ECUA 2RHQB 1ZM4A 4C7QA 4TKTA 5H9FK 2DCLA 3SDEA 2CNKB 3S1NK 5LXRA 2RILA 1K83K 4YFKA 2C2NA 3UWTA 2UZAA 5IFMA 3ZZUA 4O3RA 4PQAA 4LVNP 2YU9C 3BGOP 4K0KJ 1IUJA 5EN1A 2CZ9A 2BOPA 3X3UA 1M5OC 1HR0J 2PFDA 2DNKA 3CW2C 4LBHA 4GVLA 4P2XA 3D2WA 3A3PB 3SZZA 3TR5A 5U47A 1ZM2A 2EFVA 3RYLA 1XNRJ 2NXJA 3PHTA 2K7KA 4TNOA 3JAMU 4YR3A 2NS1B 4C0BA 2AEJA 1XJWB 1YJTA 2R7UA 3O2IA 4FNIA 2C2OB 3MMAB 1TKTA 2O67A 4CLPA 4FF2A 2FJAB 4RUAA 2AX1A 1TAUA 3LP0A 1RKJA 1U1LA 2A3JA 3MR6A 3GSIA 3H2LA 1VQKS 1JJHA 4KR0B 4RNFA 5M2PA 2C1EB 3A8JA 2VG5A 4OHXA 3D68A 2BXJA 4DV0F 1J5OB 4PG4A 1BXNA 3L4KA 4Q2MA 1QTMA 3KLFB 4B9LA 5M3MK 3M8YA 2UUCJ 4A3BC 2B63K 1WHWA 4IG3B 1WDTA 2UUTA 1MLAA 2VUGA 2WOMA 3OR1B 1DLOA 2W4DA 2RQMA 1ZAXA 3MFIA 3GJTB 2XYPB 1QAIA 1RYSA 3PR5B 5B0CA 2HKEA 1FA0A 5CHPA 5C7PA 2RRBA 4A3GK 4X4OA 4TU7A 2ZBPA 4EZ6A 3PKMA 1H2UX 2HYIB 5JUMA 2RD5C 3RR7A 2GQQA 1UW9A 3R7SB 3OTDA 4UW2A 5K8PA 4M63A 2H5EA 4F25A 4LQ9A 4EYHB 3PYEA 1L3UA 4WTYA 5F3TA 2HHQA 3HHLB 2AZ3A 5IOQA 4CLTA 1YRTA 3K59A 1DTQA 3GV8B 4PWWA 5L46A 2MZSA 4YB6A 3J7YU 5BYRA 3CIMA 2JH3A 1RWWB 4LIRA 2XMVA 2DGOA 3TZWA 4LJZA 3PM9A 3CJTA 4ICLB 4K4SA 4C0OC 3CDAA 4DZ6A 1UZDA 4ILRA 1IBKJ 2AV5A 5HAOA 1R8BA 3ILOA 3LPYA 4MAKA 1TTHB 3BBFA 1ZOTA 1VRTB 4M5JA 3HX9A 1DFDA 1T9VA 2HS3A 3AFGA 2YY3A 2DNHA 2LXFA 5I4MA 4LSZB 4I6WA 2B43A 4LBPA 5T7LB 2BVZA 1T9WA 3HKWA 3Q8PB 2YNHB 1YTYA 4DR5J 4PXCA 3PW5A 2RS2A 4R25A 1U1KA 3PW7A 2FJXA 4UOCA 2PE8A 3JTPA 1XNQF 4PQUB 1Q53A 1KRPA 4O3SA 2KM8C 4X65J 2QLFB 1QAYA 2WCXA 4CH0S 3GIKA 3GTPA 5ITHA 2I8EA 1SUQB 1S1WA 3DDIA 1WTFA 1QSYA 1FK9B 4QQBA 1F9NA 1JXVA 2J0SD 1TWAC 3SEOA 4B9SA 4G1QB 5F3ZA 5IZHA 1LW2A 3T6JA 4NLQA 3VAIA 2IHR1 1G1XA 2UXCF 1KQSR 4A3IC 1D09B 3I31A 1IL2A 2DNYA 1G51A 4IH6A 5DQHA 2W9BB 2LEBA 3T1HF 4QWBA 2V2QA 1FFGB 4R0EA 4ANDA 4N76A 4RW6A 2FLOA 1NDPA 3P49B 4PUOA 3UVJA 2GSUA 1MWYA 2QL5B 5KG1A 3AB2B 2ATLA 1WJ9A 2XEXA 3S1QC 1TL4A 3CCRS 1HNIA 4DWIA 1RLDA 4G1IA 3LP1A 3LF0A 1SB6A 4ZCKA 4ECQA 4O3PA 2J76E 4DCOB 2L08A 2X3GA 1L5UA 4PEOA 5H9EJ 2L41A 2AP6A 4CO2A 4KJIA 3IBFB 2R7ZC 3WZ0A 2L3MA 1JX4A 4ECYA 2LECA 3D6MB 2GC8A 4B3TJ 1X4CA 2LQJA 2FHJD 2H1YA 2KN4A 4FF1A 2WB1D 3HHLA 3LAMA 4A3BK 2CFAB 3FQKA 5L8RC 2Z2ZA 4CT9A 2NVQC 1FWPA 3BS9A 3GTGK 3GTQA 1SIWB 1SCJB 4DV1J 3M9MB 3K8VA 3H8YA 2V67A 2HHWA 3G96A 2LEAA 4ZA1A 3I4MK 4ZN3A 4A3FC 5DDQC 1Y4ZB 1NU4A 3VA7A 3MI7X 4OZ3A 1Q0NA 1BWVA 1UPPA 4KGMA 3UNGC 1OSCA 4A3MC 2RJZA 3DRRA 4A3IK 1DARA 1X0FA 3GTKC 3KJFB 1F6TA 2D3OR 2B4OA 1KVKA 3BZQA 1RAOA 3HT3A 4MMOA 1Q5YA 5F0WA 4OZJA 3Q23A 2V8VA 5IC4B 3B6BA 4HEA9 1S4FA 3S1RK 1CQNA 1AZSA 4CH7A 5C2GA 3GDZA 2UVVA 5KFSA 1M5KC 4TQRA 2NYIA 3HVWA 4KMDA 4RL1A 4QIEA 4DQRA 5HLFB 5MAOA 1IKYB 2J7KA 4A93K 3NBPB 2V6UA 2Z2LA 3FDSA 2C2EA 4LF8J 2YH1A 3MF5A 5K9FA 3OTOF 2AJ2A 4PXDA 4AXIA 3QT6A 2D6FC 5HANA 1SJFA 4ZOSA 4EWTA 1NJWA 4C3IC 1Y1VK 4OJ3A 1SL0A 1TFWA 3FMBA 4UF4A 1MU2A 2P8TA 1H0HB 4USKA 5KFXA 2X1GA 2GQCA 1HI1A 3M2VB 4LJMA 2AZ1A 2EG1A 3R5DA 4K4XA 2MQ8A 3IG1B 1ZVUA 2VG6B 4IR9A 4WYLA 3OL6A 1B3TA 2FHKA 3RRGA 3KLIB 1RWNB 3GTMC 4GTAA 2B4PA 4I6AA 1IQZA 5G0RB 3TA0A 2XS2A 1WEXA 3N9UC 1U1PA 1FDNA 2KI2A 2YXLA 2OI2A 1WC0A 1L3VA 2HFOA 3K7AC 1TKTB 4F2RA 3ZZOA 5FIIA 3TAMB 4ALZA 3HULA 1EZZB 4LMZA 1SKRA 1S10A 3W1YC 2E1RA 1NH7A 5IYBC 2KWAA 1WCMC 1HBOB 3MHYA 4A3FK 5E3CA 2LKZA 3SSRA 4YR0A 4Y2MA 3GR0A 1WOPA 2BRLA 1KC8T 1Q8BA 2CPIA 1YGYA 1YVFA 4EGLA 3PO5A 1T05A 3I4HX 4X4UA 2CPFA 4FYXB 2O3DA 4TVAB 3BGUA 5I42B 4LF6J 1H98A 4PWDB 2YWWA 3AH5A 4KHPF 4NPOA 4DV4J 4W90B 1AA1B 5LSOA 4KO0B 4LRFA 2CJXB 4GFQA 2GJIA 3JSYA 1T9TA 4OYXA 4G0UA 3UVJB 1BQNA 5HMXA 1TL3A 4A3EK 2LXUA 2BQUA 1IBCB 2AGPA 4MKYA 4P52A 2VPYB 3N6MA 3S15K 2KYZA 2V8PA 3BSCA 3DLKB 2WVDA 3D9BA 3CCQS 3UW1A 1IKWB 1BQMB 1OYDA 4ED6A 3JAMY 1RAAB 1Y11A 3MM8A 2HHSA 1RHJB 1IBMJ 1HNVB 3RBXA 3QT8A 4PG7A 2PT0A 4FYYB 4AL6A 2XMWA 2VF3A 3RU0A 1OMSA 5IM0B 4GVBB 4ZPVR 2JA5K 1SL1A 8RUCA 3CPWR 2CQHA 2VBXA 2E2IK 4PXEA 1X5TA 3FCHA 1VFJA 3SQOP 1IXKA 4P2FA 4CO1A 2WVFA 4DR2J 1FFSB 4Q0BA 2A6HA 1S12A 3P4UB 5C25A 2VDIA 2AJ4A 1FKAF 2VBZA 2ZVSA 3BV8A 1XEZA 5IM0A 3VGVA 2GVZA 1KDNA 2YBVA 2XLIA 2DR8A 2PMWA 3DOKA 3KDOA 2DGQA 3DNCA 3WBZA 3CMES 1EKSA 1K1SA 2GMHA 2QMXA 2ZUEA 2EFGA 4ZPBA 1HNZF 1MMDA 7FD1A 3CT9A 3GR1A 1ZBSA 2IMOA 2MPUA 3HKZD 1CBKA 5KFOA 5HK4A 2E9TA 1XTZA 3VAFA 3K8WA 1TMJA 1PCAA 3MMBB 3GTLA 4DL0C 4KC6A 1GMWD 1JLGA 3C6TB 4ZVHA 2LQ8A 3PW0A 3OFGA 4RBUA 2AYEA 2Y0BB 4ECZA 2GGPB 3IWNC 4KTQA 3HOUK 3KK3B 2HSEB 4Y7NC 2KHCA 1W2IA 1RAGB 2DHHA 1WOOA 2R92C 4HL9A 4Y2KA 4BWJA 3AODA 2A6MA 2OPRB 2W01A 4OINA 2Q1LA 2J8SA 3KK1B 2N7CA 5D4OA 1KNZA 1OWXA 2WOMB 3M32A 4BC9A 2OUGA 2EK1A 4U8YA 5J1PA 1UVLA 3RAQA 3I87A 4C8NA 2D74B 4Y3CA 3VQTA 4FBUA 4I2PB 2H4WB 4OMFG 1X4FA 4JI2F 2M0GB 2LQ5A 3Q8SB 4OI0A 5CYJA 2JJ4D 1PJ5A 2HQCA 3H2VE 2RQ4A 3VQSA 1HWKA 5GAGI 2YNFB 1U2CA 2YQ1A 3S2DC 1ZYQA 2DHSA 1CEZA 3PO3K 2WB4A 5FJ8K 4C3JK 4CNZA 3GEEA 4F2SA 4F0KA 4ED0A 3CC4S 2B5JB 4W98A 1X7VA 3NGKA 2DH8A 4WBFA 3HFVA 3I32A 2VDHA 5IXUA 2FLNA 3P45B 4TXSA 1U1OA 3M1VA 2NVQK 1A0OB 3SZ2A 4X4TA 4EBDA 4L3NA 3CJ4A 3M2UA 1UVIA 2W9CA 1YJRA 1TWHA 4YFXA 1J6VA 3OFFA 1GXUA 1S1XA 3UDEA 2FIUA 3MUMP 1KOOA 3CAGA 3EZ5A 2F63A 3L3CA 5HN0A 3T1YJ 2B9EA 4OI1A 2ZDPA 3HI9A 4ZPWR 4DV6J 4QIGA 3W5XA 3TQEA 3SCJE 4LSNA 2IDLA 4X4NA 3MPWA 2WTFA 2CQ2A 1PIEA 4ZPCA 1Z2LA 3LPEA 2Z2YB 1U8SA 4CQ1A 3K89A 2A10A 2R7QA 1HMVB 5HP1A 1XZPB 4Y2IA 4Y0FA 4DL2A 2DH9A 2OPSB 1X4AA 5B0BA 2DO0A 4OX9J 4J9SA 3IR7B 1N48A 2C2MB 1C4AA 1TL5A 2VUMC 2HIQA 1TK0A 3QWPA 2Z8QA 4USJC 5J1EA 2XZWA 3KLGB 4OJHA 2NUUG 3UPFA 3M9OB 2O66A 3M2RB 5CJ9A 4YB5A 3GTOK 3AJ2A 5D4PA 3MR5A 3JSMA 2H65B 1TWCC 1HPZA 2BKPA 4OIOA 2J9DA 3S16K 3HO1A 1IM4A
chains in the Genus database with same CATH topology
3GEIA 1WOOA 4P9SA 1WOPA 3A8IA 3A8JA 1XZQB 3GEHA 3TTGA 2GAGC 1XZQA 1XZPB 1YX2A 1PJ6A 3GEEA 3A8KA 1WORA 1PJ7A 3AD8C 3TFJA 3AD9C 1VLOA 2GAHC 1V5VA 3ADAC 1X31C 1PJ5A 4PAAA 3TFIA 1WSVA 3AD7C 1WOSA 3TFHA 3GIRA 1WSRA 1XZPA 3GSIA 5L46A 1VRQC 4PABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEI A;  1WOO A;  4P9S A;  1WOP A;  3A8I A;  3A8J A;  1XZQ B;  3GEH A;  3TTG A;  2GAG C;  1XZQ A;  1XZP B;  1YX2 A;  1PJ6 A;  3GEE A;  3A8K A;  1WOR A;  1PJ7 A;  3AD8 C;  3TFJ A;  3AD9 C;  1VLO A;  2GAH C;  1V5V A;  3ADA C;  1X31 C;  1PJ5 A;  4PAA A;  3TFI A;  1WSV A;  3AD7 C;  1WOS A;  3TFH A;  3GIR A;  1WSR A;  1XZP A;  3GSI A;  5L46 A;  1VRQ C;  4PAB A; 
#chains in the Genus database with same CATH topology
 5H9F J;  4NLO A;  3DM2 B;  3H2U B;  4F26 A;  3R5A A;  4LLG A;  3T41 A;  4Q2L A;  2A2C A;  3M6X A;  1HQU B;  4P7V A;  2R9L A;  4M5L A;  1U09 A;  1INN A;  4OIX A;  3H0P A;  1Y1V C;  2IJR A;  1TFY A;  3POT B;  2IRX A;  1F7U A;  4ZVQ B;  4PYD A;  1K44 A;  3TA2 A;  2XSJ B;  4ZVP B;  5F8J A;  1SH2 A;  2HZV A;  3RZO C;  1VK8 A;  4AD6 A;  5L38 A;  3G4A A;  2UV8 A;  3OQ2 A;  1HNX J;  4JI1 F;  1NZ8 A;  4NL5 A;  4CP5 A;  4KM8 A;  1WC1 A;  1DCO A;  2MY8 A;  1X4H A;  3UCU P;  4A8Y A;  2W9C B;  4DPY A;  3IFE A;  3MPU B;  2DGT A;  4R8U A;  4C6A A;  1CJT A;  1AXQ A;  1KS2 A;  3P96 A;  3MEC B;  2XO7 A;  2CNN B;  5LXY A;  1ZZF A;  1JJ4 A;  2OD4 A;  4QWA A;  2BAC A;  4R0J A;  4RW7 A;  3MAQ A;  2ZH1 A;  2Y9H A;  5DO2 A;  2B5J A;  2GSN A;  1MWQ A;  1MWZ A;  1YJU A;  5L39 A;  4DV2 J;  4LRB A;  4WF9 Q;  2I5J B;  3FKI A;  2GMJ A;  4USH A;  3RB4 A;  1B7F A;  3QJP A;  4YFN A;  3MR7 A;  5BYQ A;  4AT1 B;  4GVB A;  1BWE A;  5JJB A;  4DS5 A;  5IYC K;  3DM2 A;  3FBE A;  3DXJ A;  3DC2 A;  5LSL A;  5LMU J;  4B3M F;  2N7Y A;  2UXB F;  3KLE B;  3D6F B;  4B3S J;  4DG1 A;  1D3W A;  4A3C C;  4DV7 J;  3HP6 A;  1TZ0 A;  1P9Y A;  4QR2 A;  9RUB A;  3TFH A;  3UN5 A;  3ZZ0 A;  3LGN A;  2OML A;  4KAR A;  1RAI B;  4OZ1 A;  1U1Q A;  2HHT A;  4WFN Q;  1T02 A;  1UVJ A;  4X4V A;  1XQI A;  4NCG A;  2K7J A;  3TUI C;  2VG6 A;  3ZNJ 1;  2KDO A;  1YHQ S;  5KFT A;  3FEY B;  2SXL A;  4U67 Q;  2MSS A;  5EWF A;  2QA1 A;  1LW2 B;  4DCJ B;  3UN2 A;  3LOU A;  4CO0 A;  1N34 F;  3IBW A;  3KMS A;  4OL8 A;  2DBB A;  4A3D K;  3ENV A;  2MY7 A;  1LFW A;  3MMB A;  2FHJ A;  4RBV A;  2YX4 A;  2C2R A;  3KUG A;  3MM5 A;  3ELH A;  2DRD A;  4I6Y A;  4LF6 F;  4WJ3 M;  2IM0 A;  3WC2 A;  1IBK F;  2OEJ A;  1R9T K;  2V2V A;  2MKC A;  2DY9 A;  4USW A;  1CSJ A;  2WW8 A;  4IR1 A;  3LP2 A;  3BB5 A;  2H48 B;  3ZZT A;  3V6H A;  1MG7 A;  3PEJ A;  1W26 A;  4DSF A;  2OJ3 A;  2K1R B;  5IT4 A;  1ZA1 B;  2UP1 A;  3OHA A;  2AJF E;  3EM1 A;  3ZTQ A;  3KLE A;  1S9E B;  5A2Q Y;  2JC0 A;  2UUC F;  1BDF A;  1TWH K;  3HVR A;  2QSW A;  1NKE A;  1GXT A;  4J5O A;  1I6J A;  4ZP7 A;  4W4M A;  2DD8 S;  3CD5 A;  1Z4U A;  3ISN C;  3K17 A;  3PO4 A;  4MIB A;  5DDO C;  1SMY A;  1APS A;  3MOZ A;  4JI8 J;  4QPT A;  4JI7 J;  2JEI A;  2XI2 A;  1UJ4 A;  5KFQ A;  5HBM B;  2WON A;  1JLC B;  2O1P A;  3U27 A;  1PIL A;  3M32 B;  2IMW P;  4DR3 F;  2CDQ A;  1VQ8 S;  2B63 C;  1DHM A;  2OAU A;  3JXO A;  4XIU A;  2J8A A;  3KLG A;  3EQL A;  3I5A A;  3ICL A;  5IYC C;  2ERR A;  2P9G A;  1HR0 F;  4RW8 A;  1QE1 A;  3MMC B;  4X66 J;  4DR4 J;  5LMN J;  1NJI T;  3J81 U;  1TUW A;  1FTC A;  3HOZ K;  1WKJ A;  1HQ2 A;  2OGU A;  1M1G A;  1ARO P;  2QYG A;  2HW3 A;  1NJZ A;  1UEU A;  1PC5 A;  2DR6 A;  3J7Z T;  1KTQ A;  4X4P A;  4P10 A;  3G71 S;  2DIU A;  2P9E A;  4NXN J;  2R2R A;  2U2F A;  3BSA A;  5KFI A;  4J9M A;  1TL1 A;  3CF5 Q;  3KK2 A;  2DB1 A;  4ZVT B;  4IRC A;  1S1X B;  2XY6 A;  1QUP A;  5CQG A;  3T5K A;  2MKY A;  3S1M C;  1B0P A;  3CD6 S;  1IBM F;  1WC6 A;  2BE2 B;  4O3Q A;  1XMQ F;  2C42 A;  1Z1Z A;  2QMU B;  2MEW A;  4MK8 A;  4BBR K;  5A0Y B;  4GC7 A;  3MMA A;  4K5R A;  1NK7 A;  1HNW F;  1I5O B;  2KM8 B;  3AXK A;  2P2C B;  1SKS A;  2V4R A;  2KT3 A;  1DTT B;  3DLG A;  2B8Q A;  5J2N A;  1VQ5 S;  1ZTW A;  4CI0 B;  3JQM A;  2BM1 A;  4C8K A;  3GU0 A;  3KHL A;  3DRP A;  4PAA A;  4QU6 A;  4PZV A;  1GXL A;  1SKU B;  1IE0 A;  3BF4 A;  1Y10 A;  3VR1 A;  4HKQ A;  2MGZ A;  3JQK A;  4QCL A;  1YBA A;  2PI4 A;  5FJ4 A;  2XSJ A;  4WP9 A;  4A3L C;  3QRR A;  3ZTP A;  2WHO A;  3MED B;  4ZVU B;  2XZD B;  2W7V A;  2M7S A;  4F3O A;  4KAI A;  3IMQ J;  2LU2 A;  3V5R A;  2JLG A;  1ICE B;  2N4C A;  5JVG Q;  2UXC J;  1HWJ A;  3BGR A;  1VC5 A;  2PD1 A;  3DI6 B;  4LRC A;  4R8U B;  1VQM S;  2NVT C;  1BJT A;  1N6Q B;  1HBN B;  1FXD A;  3OL8 A;  1YLX A;  4CYU B;  4WFY A;  3GTK K;  5KFV A;  3UQS A;  1V3R A;  2OPP B;  5BR8 J;  1NDK A;  3IS9 A;  1U6F A;  2B8P A;  5I3U A;  2ZFH A;  1HI8 A;  2ZOM A;  4IOB A;  1S72 S;  2MQP A;  3SBM A;  4CTA A;  4HT5 A;  2R2U A;  2E2H A;  2EBG A;  3OR2 B;  4OX6 A;  4DN0 A;  3R5C A;  3G87 A;  3UO0 A;  2G1D A;  3OVB A;  3DGP B;  2UUW A;  1VJW A;  4X6A C;  4JK1 A;  5GVQ A;  4B9M A;  4CM2 A;  3AQP A;  2O5D A;  3GYN A;  3NS7 B;  2CIM A;  4OX7 A;  2W7P A;  4F4Z A;  4C8O A;  2OHD A;  3W66 A;  3HHD A;  2F8H A;  4LF8 F;  4IO1 A;  1MRO A;  1VIS A;  4M8L A;  2CJB A;  2VJV A;  1N0V C;  1TQL A;  5CZV A;  3GQC A;  1FWK A;  2DGU A;  2JLF A;  3HF5 A;  1FXL A;  3M30 A;  4GKK F;  3CCW A;  2E66 A;  3GTJ K;  2GNK A;  5A8R B;  4KGX B;  2KH9 A;  2YVS A;  3Q22 A;  3FQL A;  4C3H K;  1QY7 A;  5J2P A;  3NP5 A;  3S17 C;  4KRW A;  1TWA A;  2OLW A;  4IDK A;  3C6U A;  2WAQ L;  4J9U E;  4BY7 C;  3EWG A;  1U49 A;  4M5D A;  2VG5 B;  4A3J K;  2LU1 A;  1R7I A;  1VQL S;  2HWI A;  7AT1 B;  4NI2 B;  4KH1 B;  4PPZ A;  2J7W A;  4DS4 A;  3I4P A;  4ETZ A;  2VON A;  4C97 A;  2KT5 A;  3HLU A;  4ZVR B;  3ORE A;  4NZ7 A;  1A6L A;  4DPX A;  4L6V 3;  3DRS B;  5B09 A;  3MUT P;  4Z7C A;  3ONQ A;  4AL7 A;  2AYG A;  1SJR A;  1XPP A;  3PR4 A;  1AFJ A;  4KB7 A;  2Y1J A;  3POT A;  3MMC A;  2ZH2 A;  2R92 K;  3MML B;  5DM6 Q;  5ETQ A;  3S14 C;  4YDD B;  1NHU A;  3BDE A;  1M0S A;  3NMR A;  3PRB A;  3NG8 A;  2E7X A;  4KFB A;  1J27 A;  1X4B A;  4ZPA A;  5EDW A;  4X62 J;  1H72 C;  1X4G A;  1K8A T;  1IBL J;  2E1C A;  4C0H A;  2WSF C;  2V8H A;  1YG0 A;  3DFE A;  4ZP9 A;  3FRZ A;  2M88 A;  3P5T L;  4KBI A;  3T1Y F;  4BXX K;  2E9Z A;  1VMB A;  1T9Y A;  4ZKA A;  2B7B B;  4WPA A;  3K5M A;  3MPD A;  3GEH A;  1FKO B;  2K3K A;  4WZQ A;  1UA0 A;  2ZH9 A;  4LRD A;  5KFN A;  2R4F A;  3GFH A;  4IG0 B;  3ILI A;  3H90 A;  1RTD B;  1VQO S;  2CPE A;  4BWM A;  2BM0 A;  2CPZ A;  3A1Y G;  2BAN B;  4HTI A;  2VV5 A;  2YQ3 A;  3RAM A;  1JLQ A;  2HVH A;  4LIW A;  4WKR A;  3GSD A;  1RT4 B;  3BP3 A;  1BQM A;  3FK4 A;  1CJK A;  1HWI A;  3T9N A;  2ZUA A;  4DDQ A;  1TU0 B;  2MKS A;  2KTQ A;  4C2M K;  3TAN A;  2C3U A;  2JA7 A;  2HWT A;  2NLW A;  3Q2T C;  3L95 X;  3GTQ K;  3GTG A;  2V2K A;  3GIM A;  1PAU B;  2ILZ A;  1C1B A;  1F9E B;  5JVO A;  3TZX A;  4AFF A;  1EP4 A;  4BBS C;  2B63 A;  1BHN A;  3UD4 P;  1UFL A;  2Y0S D;  4AL5 A;  3EJM A;  1AB4 A;  3VF0 B;  1S9F A;  2FQQ B;  3BH6 B;  3HXA A;  5F8H A;  2NVT K;  3PEH A;  3UR3 C;  1Y0H A;  1U0H A;  4OX9 F;  2ZOG A;  1K0V A;  2AGQ A;  1E6Y B;  4CNY A;  4DL4 A;  5E33 A;  1O2A A;  4RO0 A;  1USO A;  4MEY A;  3HOV K;  3T9Z A;  5IYD C;  2J0W A;  1S79 A;  2HND A;  1VQ6 S;  3GJR B;  4Q8F A;  2VFT A;  5B0D A;  2QO3 A;  4ZVO B;  2IC3 A;  1MW7 A;  3HSZ A;  4LF5 F;  2CNL B;  2EI5 A;  2KL8 A;  4WE1 B;  4HI2 A;  4U96 A;  2LLZ A;  5HMZ A;  3MCN A;  2YNF A;  2CJQ A;  3DXB A;  3BH7 B;  4OYB A;  4DFP A;  3RRK A;  2EPI A;  2N3O A;  3PJ9 A;  4P2S A;  1ITP A;  1RHR B;  4KIA A;  3DLB A;  3DHX A;  1FJG F;  2IFX A;  4OI6 A;  3TEH B;  2DNL A;  2QFI A;  4K4Z A;  1KQF B;  1Y5L B;  1KHV A;  2RAQ A;  1NKC A;  5KT2 A;  2BUN A;  3LGH A;  3H4B A;  3CJR A;  1VBX A;  3AH6 A;  1SQF A;  2PHC B;  1S97 A;  2HGL A;  3JSR A;  3BP8 C;  2B7C B;  1WIH A;  1YSJ A;  3E2E A;  4YHH J;  3LP0 B;  1WKL A;  1IBA A;  2ZVI A;  4EEY A;  3CWJ A;  2BQR A;  1ZZN A;  5G4D A;  2YKN B;  4U6P A;  4M5D B;  3O8W A;  5A2Q U;  3D1O A;  1IKV B;  3DRY A;  2R7R A;  2PO4 A;  4HLB A;  3HMJ G;  1SIZ A;  2W25 A;  1RT7 B;  1MRO B;  1Y00 A;  2FJB B;  3H98 A;  2G13 A;  1HQM A;  1IKY A;  2G2Y A;  2QL9 B;  2W2Q P;  3ILL A;  1PAE X;  2AU0 A;  5J1N A;  2Y8Y A;  2YX1 A;  4FNH A;  1RP5 A;  2GVD A;  4QWC A;  3WIV A;  1LWF B;  2VFV A;  3UD5 A;  1KON A;  1EP4 B;  2YWF A;  3GZ7 A;  5FDL A;  2AEF A;  2F1F A;  2ZKU A;  1R31 A;  3AD7 C;  3HOU C;  1JMT A;  4JI4 J;  1SV5 B;  2VD3 A;  3EXY A;  2Z2M A;  3EZU A;  5HLF A;  1R0C B;  1NK4 A;  1TWC A;  3I9V 9;  2G4B A;  2F9J A;  3PJX A;  2QMW A;  2B9X A;  1RUS A;  2NVY C;  1O51 A;  2LFV A;  3RR8 A;  2VUM A;  4A48 A;  2A68 A;  2JRS A;  1TV6 A;  1FKP A;  4K2X A;  5KFL A;  1N32 F;  3J81 Y;  1RWP B;  2ZD1 B;  3W5Z A;  2R2S A;  4BXX C;  1QSL A;  1D0E A;  4K4W A;  4FKX A;  1Q82 T;  4OZ5 A;  3G6V A;  3ZZR A;  4DUY J;  1AZS B;  1Y3K A;  4RPF A;  1R3N A;  3TA1 A;  3MM8 B;  3K58 A;  1FDA A;  4I1T A;  2PEH A;  5E68 A;  3G86 A;  2GML A;  2V6A A;  4GRS A;  1Y1W K;  2JL9 A;  3BBB A;  4DQQ A;  3LAN A;  2B3T B;  3WC0 A;  4DSK A;  3UD3 P;  1FRI A;  1HW8 A;  1B70 B;  2GJ2 A;  5TMC A;  2EFO A;  3THP A;  3N3Y A;  1D9D A;  4FYW B;  1U6B A;  2P5V A;  3HSJ A;  3I0R A;  3HSG A;  2F65 A;  3ISZ A;  3I9Z A;  5T14 A;  4UT4 A;  2ZE2 A;  1T03 B;  1T05 B;  2GO9 A;  1LEO A;  3MCM A;  5ETN A;  2Z56 B;  4ZS6 A;  4DBQ A;  2RKI B;  3PYG A;  2W9A A;  1UTA A;  2E5G A;  1CS4 A;  2NXN A;  1X5O A;  4JI2 J;  1IKX A;  4B3O A;  2ZC3 A;  3DRX A;  1GMU A;  4DSJ A;  1IR0 A;  3FMW A;  1YJW S;  4WJ4 A;  1FEH A;  2KHD A;  1C0T A;  1SBR A;  2AWZ A;  8ATC B;  1LV5 A;  5K14 A;  1CUL A;  1TKX B;  2R93 K;  4L75 A;  1TAQ A;  3HOY K;  4B9V A;  2J9C A;  4UOF A;  1UFK A;  2KZZ A;  4QW8 A;  3W63 A;  5GAH U;  1LKZ A;  3PHE A;  5F8L A;  1LXN A;  5HI7 A;  4ECV A;  4NYZ A;  2I2Y A;  3NNH A;  4X6A K;  2UUB J;  5LM7 E;  2YKN A;  3LGM A;  2R93 C;  5GAH I;  1TL7 B;  3S1Q K;  1RBO B;  3W2W B;  3CJQ A;  4I64 A;  3CCE S;  3SMZ A;  4LQ3 A;  4OHW A;  1DQ8 A;  2FZG B;  2KG0 A;  4USI A;  5FD1 A;  4GO7 X;  1RT6 A;  2HK3 A;  3SI8 A;  3ZZZ A;  3CXC R;  3AXM A;  2O5J A;  1WG4 A;  3G4C A;  3NS6 A;  2CQ1 A;  3FCV A;  1FRL A;  3QYY A;  2JVO A;  3KHG A;  2JSX A;  2LDY A;  4OI4 A;  4LF9 F;  1IQ0 A;  1FK9 A;  1FFW B;  2ZNY A;  1RT6 B;  2C2Z B;  1KQ4 A;  2J6S A;  2ZNZ A;  1VGY A;  1EI6 A;  1WAC A;  1TWG A;  1S7H A;  2J5A A;  1XMO F;  1EX8 A;  1UZH A;  1CJU B;  3C14 B;  3DDN A;  5M2U A;  1LWC B;  4HYK A;  3U1M A;  4LF7 F;  1RB0 A;  6FDR A;  4NLX A;  2RVJ A;  2JX2 A;  3AD9 C;  1HWU A;  1O27 A;  2OKQ A;  3S15 C;  1RWU A;  3ETM A;  3MTK A;  2W2P P;  4LR7 A;  3OEP A;  2JVR A;  2Q43 A;  2BAB A;  3TUZ C;  2XS7 A;  3OLA A;  2GVD B;  3J7A 1;  4LF9 J;  3L7O A;  2A2D A;  2PN6 A;  2ALY B;  1VLO A;  2VBW A;  3D1H A;  4FKY A;  1RWM B;  1JKH A;  2GZO A;  2HUR A;  1I6V A;  4A3L K;  2RF2 B;  1RT3 A;  1RT7 A;  2HFZ A;  1X4E A;  3M8Z A;  4O4G A;  5L9N A;  2NXC A;  4KY3 A;  4CO5 A;  2YNI A;  2XM3 A;  1UJ5 A;  3GTP K;  3OV7 A;  2AYM A;  4HDG A;  3HHN B;  1DRZ A;  1S0M A;  1X0P A;  3QPI A;  4QOT A;  2XCR B;  2Q79 A;  2HBQ B;  4WE1 A;  4OIQ A;  1IQT A;  2J7U A;  3TUP A;  5ETS A;  2QV6 A;  4A93 C;  3VVT A;  3A4T A;  4WP8 A;  2HLU A;  5KT3 A;  4PPD A;  3G2X A;  3EDR B;  4C8Y A;  3DOK B;  4OZ2 A;  4DV5 J;  3TNV A;  4RW4 A;  2UUA J;  2W24 A;  3OW2 R;  2JC1 A;  1EK8 A;  4J3N A;  1NPR A;  3QZ7 A;  2DNN A;  4IH5 A;  2MKH A;  4QR0 A;  3ITH B;  1N36 F;  1JLC A;  3D0H E;  4J9K A;  1S48 A;  1U24 A;  3OPK A;  1T94 A;  3V4I B;  5K20 B;  1N54 B;  4DFJ A;  1ZM3 A;  3V6J A;  2FVQ A;  2OPQ A;  3DN9 A;  2KVQ E;  5A8W B;  1Q8K A;  1M5S A;  1WF2 A;  1X60 A;  4A8O A;  4XCH A;  3BPS P;  1H7W A;  3IRW P;  1T8E A;  2HQG A;  2VFS A;  3GE9 A;  5C4X K;  4WU2 A;  4EBC A;  2IA6 A;  1M90 T;  3GTL C;  2R2T A;  3D1Q A;  2ZH6 A;  2FJV A;  1RLC L;  1WI8 A;  4WU3 A;  1O26 A;  1DD5 A;  2PEB A;  4A46 A;  1S1T A;  5GAE I;  1WG1 A;  2DIV A;  2R8J A;  2X1B A;  3T1A A;  4RMF A;  4BY1 C;  4HDH A;  4EO6 A;  5ETO A;  1U26 A;  3G6X A;  1SC1 B;  3MM9 A;  4RU2 A;  2GAG C;  1IJE B;  2RH6 A;  2CQB A;  5K8N A;  2UU9 J;  4WZM A;  3KLF A;  1U1N A;  5E3P A;  4ILM A;  4BDP A;  1RT5 A;  1WSR A;  3GPA A;  1BMQ B;  2NVX C;  3AA8 A;  3RAX A;  5M5Y K;  4CIO A;  2B56 A;  3MEG A;  1CJT B;  2PSZ A;  3PRD A;  3W9J A;  3F73 A;  3KUH A;  1RBA A;  3H59 A;  3DHW C;  4NML A;  2CZV C;  5LSR A;  4LT6 A;  5DG7 A;  2VFR A;  3OXG A;  1YJN S;  1LOU A;  1DTT A;  4K4Y A;  2P9C A;  3PX6 A;  5H9E K;  4CH1 A;  2CUY A;  3PTW A;  3TFI A;  1LK5 A;  4M95 A;  3J7Y I;  4CO4 A;  2JA7 C;  1UVM A;  3P3D A;  2D7S A;  2XG8 A;  3W8P A;  3ZZY A;  4KGV B;  3NAI A;  2IYG A;  5IOL A;  2JDJ A;  5A6W A;  2RF2 A;  2B6A A;  4NXN F;  5E2Q A;  3TZY A;  4LK0 A;  2DYA A;  1U45 A;  1EJ7 L;  2W7A A;  1FJG J;  4O44 A;  3RZD C;  1S57 A;  4GKK J;  1I3O B;  4JP8 A;  2IYI A;  4RW9 B;  3L7U A;  2EFQ A;  4AQY J;  5ETP A;  2XC9 A;  2V6T A;  4IUF A;  1DAX A;  5LJ5 Y;  3RB6 A;  3TVZ A;  2YKP A;  2GJF A;  2QE5 A;  2RE1 A;  5IP7 K;  2YKM A;  3ITH A;  2DRB A;  1SC6 A;  1VRQ C;  4X4R A;  3C3L A;  3ZTR A;  3VGS A;  2OFH X;  2PII A;  1KHW A;  3AY0 A;  4A3C K;  2RNE A;  1EB0 A;  2JA8 K;  2CQ3 A;  1S9G A;  3LUY A;  5D78 A;  3W60 A;  2CPX A;  3IM9 A;  2XMT A;  4EI2 A;  2ALZ A;  4USM A;  2FHO B;  4H4K A;  4NCB A;  4V19 X;  3R1L A;  3A13 A;  1W25 A;  1I94 F;  2RDJ A;  1MML A;  1HD1 A;  2OIH A;  4NRU A;  2E2H C;  3V6D A;  5AXN A;  5F8N A;  4RZR A;  1U6Z A;  2VB6 A;  5KFJ A;  1Q8L A;  2RML A;  2D1C A;  3CVK A;  1RTJ A;  4C4W A;  3M7V A;  2XMA A;  3MM9 B;  4IQM A;  4DG1 B;  2Y3P A;  2BRK A;  2QLJ B;  2EBB A;  2E2H K;  3V6D B;  4LF2 A;  2RU3 A;  4F4A A;  5CYM B;  3PO2 C;  1GX5 A;  5EWE A;  5CD4 H;  1QDU B;  3KTQ A;  1NAQ A;  4X64 F;  4N5S A;  3W3S A;  5KG4 A;  3VZI A;  1YJV A;  3PX4 A;  4DPU A;  1TEL A;  3BUE A;  1O5J A;  2CJY B;  1F3V A;  2MQN A;  4EU0 A;  3CQZ A;  4C8Z A;  2MKJ A;  5C3E K;  3W65 A;  4WYW A;  1ZQ1 C;  5DRK A;  3G8S A;  4LSL B;  1WHY A;  5B0F A;  2MLX A;  4M94 A;  4OJ1 A;  1TWG C;  5GAG U;  4DV1 F;  4KKO A;  3SYZ A;  2A6E A;  1XMO J;  5JMN A;  5CZX A;  3QO9 A;  5JFE A;  3AOC A;  2X3D A;  2JFD A;  5LMN F;  3MCS A;  2CJK A;  3D5M A;  2GAH C;  3MEG B;  5C44 K;  3PY8 A;  2HNZ A;  2H9Z A;  2Y1R I;  2HQ3 A;  4WXW A;  1A7G E;  1L3T A;  5AE1 A;  4JV5 J;  5LT5 A;  3HOW K;  3OXF A;  2HHX A;  4JYA F;  5DS7 A;  2CXE A;  2M8D B;  5D8H B;  4X4S A;  3UCZ P;  1MU2 B;  1F7V A;  3VAH A;  3A8I A;  3BN4 A;  4NCA A;  3LTO A;  3AAW B;  1JLE B;  2WSE C;  2DGV A;  5E3A A;  3Q8Y A;  4OI3 A;  2HFS A;  2IPO B;  3HOW C;  3P8B B;  4DR4 F;  1F5C A;  2GX8 A;  4Z37 A;  4IO9 Q;  4KHM A;  1C1C A;  4KFB B;  3LQV A;  4FXV A;  2B4U A;  1R6V A;  1KWM A;  2KJV A;  4LFA F;  3KLH A;  1WCM A;  4HHH A;  2HRY A;  1GE9 A;  1CJV B;  4DF4 A;  1ZPW X;  1ZA2 B;  4QIF A;  3ILJ A;  2V34 A;  1PYO B;  4NA1 A;  4WXO A;  4O0I A;  1U0H B;  5DGB A;  4CLK A;  1XN9 A;  3OTB A;  5E3Q A;  3DGV A;  1FX4 A;  2RGR A;  4M5K A;  2QIF A;  4Y34 A;  1KFS A;  2CQ4 A;  2QL7 B;  4XK8 C;  3LH2 S;  1Q81 T;  2NSC A;  3CO0 P;  4A4J A;  3M6W A;  2XMK A;  1OSD A;  4QYR A;  4ZCM A;  4KB2 A;  4RUH A;  1FNM A;  2GS8 A;  3OFH A;  3H25 A;  2A6O A;  5KFC A;  2ZKT A;  5A8K B;  4QJV A;  4ZLL A;  5AE3 A;  2RH3 A;  3NMA A;  4RX6 A;  4V19 J;  1HNX F;  1JKH B;  3D6T B;  2OEM A;  3FJ2 A;  3SXL A;  2A1B A;  4DQP A;  3KK3 A;  3WOD A;  1VHF A;  1VQN S;  1LWE A;  4C11 B;  3E3X A;  3JST A;  4I69 A;  2HNY B;  3NXZ A;  2ZHB A;  1RE1 B;  2PC6 A;  3I5C A;  1JNZ B;  1VQP S;  1NJY A;  4I68 A;  2DR5 A;  4CM0 A;  4F8R A;  4F04 B;  4KAT A;  5F8G A;  4G0V A;  1WDD A;  2ASL A;  3GTG C;  5BYS A;  1RJJ A;  2PMZ D;  1REG X;  3NS5 A;  5HQM A;  3OVA A;  2QLX A;  1KEK A;  1S77 D;  4CLW A;  3Q83 A;  4C3L A;  1C4C A;  4BC7 A;  3GJS B;  2G0C A;  4ZLP A;  2IJN A;  1I94 J;  2YNG A;  1C0A A;  1CLF A;  5B0A A;  1HA1 A;  2EFN A;  3ADA C;  2AF6 A;  2A69 A;  9ATC B;  3I55 S;  1JLQ B;  1WOS A;  3MTJ A;  3UN3 A;  3QJJ A;  4G7H A;  1FEE A;  3HOV C;  1R6Y A;  4ZCI A;  1TL3 B;  4TY9 A;  3DXS X;  3BDP A;  5J2Q A;  4G0W A;  3PIO Q;  2E5L J;  4DX8 H;  2CPY A;  3KK1 A;  5KFM A;  4IRK A;  3EVW A;  1PBA A;  3ZTO A;  2DO4 A;  2MZ1 A;  4YY3 J;  1FJC A;  4TN2 A;  1RAC B;  1CVJ A;  3C8Y A;  3TAR A;  4DR6 J;  1M1K T;  2CJA A;  1TUV A;  4NLU A;  2DH7 A;  4B3T F;  2MKI A;  4ZJO A;  1VH2 A;  3M3Y K;  3CDU A;  4HT7 A;  5BJR A;  2DIT A;  3Q8U A;  1XR7 A;  2W8K A;  2IJF A;  4ZLN A;  4OI2 A;  5BXI A;  1SVD A;  1USM A;  4DDF A;  2W4C A;  4A8M P;  2UU9 F;  3C15 A;  5KFB A;  1E6Y A;  3NWR A;  4A3M K;  3Q0A A;  1RWO B;  2BQ3 A;  3KXD A;  2XSF A;  5IT0 A;  2MJN A;  3IR6 B;  3GCX P;  3PFO A;  5C5J A;  4TYB A;  1HBU B;  2BJ1 A;  1RAE B;  3H3V L;  1WC3 A;  5DG8 A;  3Q8R B;  2D69 A;  2BJ9 A;  4C3H C;  3ET6 B;  4NLD A;  3BO4 A;  1Y9O A;  4FZV A;  5CYM A;  3RB0 A;  1R0A B;  1S1W B;  4ES2 A;  5KFK A;  3NCP A;  1LW0 A;  2AJQ A;  3HK2 A;  2H4Y B;  2GCF A;  1CC8 A;  4WFB Q;  1V5I B;  2BKO A;  4ZDN A;  1GK8 A;  3C66 A;  3E51 A;  5IWA F;  3CMQ A;  4MT1 A;  1CS4 B;  2DHA A;  3G82 A;  1N5V A;  1X4D A;  3FFI B;  4F4X A;  3MPY A;  3BSN A;  4OYP A;  2JNJ A;  3DLK A;  3TW0 A;  1FDB A;  4NI2 A;  1B7Y B;  1ZYR A;  4N56 A;  2OTL S;  2AJ0 A;  4ANE A;  2RSQ A;  4BY1 K;  1YJ7 A;  2D9P A;  3CCM S;  5EUH A;  3HZG A;  4FM9 A;  4B17 A;  3ZC4 A;  3IM8 A;  1LWX A;  1GMW A;  3HFZ B;  4Q4Z A;  1CUL B;  1A9N B;  1WEY A;  1U02 A;  1HPZ B;  2L9N A;  4K5S A;  2B4V A;  3MWB A;  2GQ2 A;  3I82 A;  4A8X A;  1HYS B;  2YU9 A;  3OD2 A;  1T7P A;  4DUZ F;  3GTQ C;  4NWB A;  1SPB P;  3M9N B;  2RQK A;  2AMC B;  3PW2 A;  2EC0 A;  3GFZ A;  4NRT A;  2C2D A;  2LDI A;  3M4O C;  4YME A;  3CED A;  5HJX A;  4N8N A;  4OHZ A;  4AE5 A;  1JLF B;  3D66 A;  3SDE B;  1ULR A;  3FNN A;  1WF1 A;  1KQK A;  2QTW A;  4GTC A;  2QG9 B;  2RS8 A;  5CCL A;  3VAG A;  1U2R A;  4K4U A;  4C11 A;  2R93 A;  3OT9 A;  3TI0 A;  3Q89 A;  2ZOF A;  2BBE A;  2DGS A;  1NM2 A;  2CPH A;  2OP5 A;  5J2Q B;  4C8M A;  4RW9 A;  4ELT A;  2DHG A;  2QC3 A;  1QVG R;  1AUD A;  4NLP A;  3LWL A;  1HBO A;  1TV6 B;  1N5Y B;  4GTB A;  3L9Z A;  4UQT A;  4FXW A;  1RTI B;  4XO0 A;  1J98 A;  1B64 A;  3TAM A;  2XZT B;  5DET A;  1ZS6 A;  1TVR B;  2IBO A;  1SC4 B;  1K47 A;  4JI3 F;  2BJD A;  2DXD A;  1RWX B;  2HBZ B;  2FGC A;  2J0Q D;  1EQR A;  1Y5I B;  3SCK E;  3AT1 B;  2GIQ A;  2WBR A;  2RRA A;  2KYX A;  3LAJ A;  2MHN A;  2HMI A;  3SFU A;  1FNO A;  2IVF B;  1RTD A;  4FS1 A;  1YIT S;  4ANC A;  2EBE A;  4LFC J;  5KFA A;  1FO1 A;  1D8Y A;  5DDR C;  2DJW A;  4JB8 B;  4USV A;  2ZJQ Q;  2A18 A;  4BLA A;  1U4B A;  4KB4 A;  5AXK A;  2XY5 A;  1VI7 A;  3ET6 A;  2UUB F;  2HVE A;  2KVI A;  2JA7 K;  2KXN B;  1FJE B;  4LK1 A;  2DHX A;  4YDX A;  2AD9 A;  1VDH A;  4UOG A;  3W62 A;  3CQZ C;  1RHQ B;  2IRY A;  1O25 A;  4ATN A;  4PG8 A;  1R9T A;  3C16 B;  5IQQ A;  4ELV A;  2OTJ S;  4DR2 F;  5TMF A;  1NBE B;  2L9W A;  1U2F A;  5K5M A;  1WHV A;  3Q24 A;  4ID8 A;  2VG7 A;  4ZN1 A;  5HMY A;  2F5G A;  4NLV A;  4MQ9 A;  2KO1 A;  3PAC A;  5KG7 A;  4P72 A;  2NXU A;  3BBC A;  4NLS A;  3W9I A;  4P6Q A;  3T5L A;  2PPB A;  1VHI A;  2K8G A;  1WUU A;  4NE9 C;  1N33 F;  3M8Q A;  3R2C J;  1K0T A;  3ULH A;  2M3D A;  1XNR F;  3GII A;  1N88 A;  5L1J A;  4JI1 J;  1MN7 A;  2JOQ A;  4DMZ A;  1I6H C;  2FTR A;  2FZK B;  3KDN A;  1YJ9 S;  2LP4 A;  3KNG A;  3NOC A;  5DLG A;  2E5L F;  3GON A;  3T5J A;  1WC4 A;  3GIJ A;  1F5B A;  3P5B P;  1QJH A;  1PGZ A;  3ENQ A;  1OJ4 A;  2BJE A;  3IC1 A;  2MMY A;  2DNZ A;  3D54 A;  4FYV B;  2ABY A;  4PG6 A;  2GHP A;  3AJ1 A;  2AEM A;  4U7C A;  3GJQ B;  4Q5S A;  3HOX C;  1G3O A;  2E1A A;  1N5Q A;  4KKO B;  2ZJP Q;  4RW7 B;  3GIL A;  3OPF A;  4G1Q A;  1SC3 B;  4LR2 A;  4V1A k;  4BLG A;  1EAR A;  3US5 A;  1EH1 A;  3MR2 A;  2CWX A;  2M8H A;  4M1X A;  2VIC A;  3EYZ A;  4Y65 A;  1T9X A;  2BX6 A;  2VH7 A;  3TX0 A;  1NB7 A;  4ZP6 A;  4ZK7 M;  2IBK A;  2ROE A;  5B0G A;  5D3G A;  4RJV A;  1DUR A;  4PQU A;  1Y1W C;  2B51 A;  4O4R A;  2C3M A;  4RW8 B;  4DQI A;  4DL3 A;  2GGP A;  5L9X A;  1FKP B;  1RWK B;  5E7O B;  3R5G A;  2P6T A;  2QA4 G;  1Q95 G;  2BEF A;  2LCW A;  2XCQ A;  1NDC A;  2XUL A;  3RGI A;  4Y52 K;  4QPX A;  1HHT P;  4C3I K;  3N6N A;  4KE5 A;  3KOA A;  3KWM A;  1IW7 A;  2KFZ A;  1NSK L;  1MN9 A;  3DOL A;  4L72 B;  1TKD A;  4OZ0 A;  4FDF A;  1VC6 A;  3RG6 A;  4IG0 A;  2FB0 A;  4ED7 A;  3NNA A;  1NKB A;  1HL6 A;  1OY8 A;  2EK6 A;  2VBY A;  3Q3Q A;  2ZBR A;  2LVW A;  3R6L B;  3THT A;  2ASD A;  3DLE B;  2MQL A;  4DV4 F;  2VFU A;  1FE0 A;  2WVC A;  3TQ1 A;  3OR2 A;  5BR8 F;  4LOW A;  2E1M C;  2XMJ A;  3J7A N;  1PO6 A;  4C98 A;  2VHG A;  1NZA A;  1ROF A;  1C1C B;  1B4B A;  1AT1 B;  4F36 A;  2VPX B;  2XO6 A;  3C6U B;  1TWC K;  1NH8 A;  3DMJ B;  4S0M A;  4KHR A;  3SQG B;  3QT7 A;  5J2N B;  3DLH A;  1GFW B;  4M1K A;  4U7U D;  4RUC A;  3H3V D;  3PYD A;  4WP3 A;  2OFG X;  4NOI A;  5IP9 C;  4NLW A;  2ZHA A;  5AXM A;  2DR9 A;  2ZFZ A;  4DUY F;  1C2P A;  3R9L A;  4A3G C;  4L74 A;  1OY6 A;  1NSQ A;  4AXJ A;  2J9D E;  4JV1 A;  2C22 A;  4OQJ A;  1FWL A;  2NXE A;  2QEX S;  5EGY A;  1YX2 A;  1P6T A;  2FHM A;  1FCA A;  2Z57 B;  1MMN A;  4OHY A;  3GG0 A;  4Z2X A;  3SZY A;  4XLP A;  4IYQ A;  5I42 A;  1VBZ A;  1RTJ B;  1EHW A;  4D3G A;  1FTR A;  3QIP B;  2JLE A;  1G7C B;  2WSC C;  4Z7Y A;  1VYA A;  2BE7 D;  2C2K B;  3LPX A;  3S01 A;  5E41 A;  5KFD A;  1N5T A;  4C2M A;  2GSO A;  1HYS A;  1VQ7 S;  3EGV A;  2AYB A;  2X1F A;  3F0N A;  2VG7 B;  2BYC A;  4F4W A;  4FF3 A;  2BW2 A;  3JTN A;  2EKY A;  3NCQ A;  5GMK a;  3RZD K;  3PG9 A;  5M2R A;  3GTO A;  3MEC A;  1RAF B;  3ENW A;  4TU9 A;  5A8K A;  3GV7 B;  2YWG A;  5M5X K;  2XB2 D;  3QGH A;  1K73 T;  4JYA J;  2LYV A;  2KXF A;  2HFV A;  4PYA A;  1UP1 A;  3S8S A;  1FHT A;  2BDP A;  3H5X A;  1RK8 A;  1XMQ J;  1C0U B;  1Y1V A;  2DRA A;  2NR0 A;  2ZIT A;  1RKI A;  2AJ1 A;  4JI0 F;  5K8O A;  1ELO A;  1RT3 B;  3IS9 B;  2NPI A;  1N56 A;  4DJB A;  3M2V A;  2HNZ B;  1M1H A;  2XWY A;  3PXG a;  2WW4 A;  3CD7 A;  4PWD A;  4KMA A;  2V4Q A;  3EGZ A;  4RLE A;  5ETV A;  1ZAW A;  5L1K A;  3OUY A;  2B6A B;  2B0G A;  3DI6 A;  1JK9 B;  3IAS 9;  5HVH A;  2G2O A;  2UXB J;  2APO A;  5CCM A;  3H0G K;  4JV2 A;  4KPY A;  2QRR A;  3PRV A;  2HMI B;  4P5B A;  4C8L A;  4KN7 A;  1N5S A;  3MAA A;  1RBL A;  4YQW A;  1K83 C;  4WCE Q;  3M6U A;  4N77 A;  4QU7 A;  2RUG A;  2VU5 A;  3OSN A;  2CRL A;  3MAA B;  4X84 A;  2KFN A;  2KZM A;  3FRY A;  4Y2C A;  1KBR A;  3HDS A;  3DGP A;  3R1H A;  1IKV A;  4G6V B;  4ECX A;  1J6X A;  4Q0B B;  4ZVS B;  1ACM B;  1IR1 A;  2R8K A;  4KMH A;  3GTJ A;  5F41 A;  1D9F A;  5KTQ A;  4A8W A;  2HVI A;  2KRB A;  2G0I A;  3MED A;  3A3O B;  4CLF A;  1NPK A;  1E6V B;  2F4V J;  4DOZ A;  1QD1 A;  3EMT A;  2RDD A;  3CC7 S;  4A8Q A;  4Q8E A;  2OEL A;  3QWU A;  1F0X A;  4W92 B;  1FF2 A;  4FVC A;  2E7W A;  4K59 A;  1O2F B;  3DU6 A;  3H42 A;  4TLQ A;  1YI2 S;  4GC6 A;  4RU9 A;  4G3I A;  3M8W A;  4A3J C;  1BY9 A;  3VVU A;  3CJ0 A;  1LW0 B;  4HTJ A;  4P5A A;  4UY8 5;  3VCD A;  5D0R A;  2HGM A;  1G6B A;  3BQ1 A;  2CNO B;  4YFU A;  3KHH A;  5H1S V;  3DRR B;  2IRU A;  2YTC A;  3PCO B;  3RZO K;  1UWA A;  3L4B C;  2VOO A;  4QIW D;  5FDL B;  1Q1K A;  1DJ0 A;  2CQP A;  2F40 A;  3GTP C;  4IFY A;  3EXC X;  3CGI A;  1FER A;  2ZH4 A;  1NHK L;  5E0O A;  5B7W A;  1NK6 A;  3QO9 B;  3TUJ C;  1UMJ A;  1GTE A;  1TKZ B;  1S0V A;  2HPU A;  2I5J A;  2XGP A;  2PA3 A;  4WFX A;  1S9E A;  2KFY A;  2WRM A;  1JNR B;  1N34 J;  5CD4 A;  1URN A;  4ZIT A;  4F4Y A;  4YOE A;  2DPJ A;  2GFF A;  3QLH A;  2VQF J;  4CO3 A;  3BEG B;  3OTO J;  2QLW A;  2JZ5 A;  2HAF A;  2VQE J;  3VZH A;  2IY5 B;  2FD2 A;  5THW A;  2DNP A;  4K4T A;  4X62 F;  2MTL A;  4B3R J;  4YY3 F;  2IM3 A;  3B78 A;  5TJ3 A;  5D4N A;  4B3M J;  2HG4 A;  2V9W A;  4E0D A;  3PW4 A;  3R7B B;  4BS2 A;  1G2E A;  3A3N B;  5HMW A;  3I56 S;  3CJ3 A;  1ZXO A;  1KN6 A;  4YB1 P;  2XY7 A;  4OIP A;  4ZLJ A;  3HM9 A;  4IG3 A;  1H3D A;  3TFJ A;  3DMJ A;  2CJ9 A;  2BAN A;  3FC9 A;  2E9R X;  3MEK A;  4TU8 A;  3ETO A;  4YB7 A;  2VA2 A;  1VQS A;  3K5O A;  3VV2 B;  2C3Y A;  1UL3 A;  3LA0 A;  1OQ6 A;  4QWE A;  4HHJ A;  4GKJ J;  3T01 A;  1S49 A;  4Y7N K;  4KAS A;  3MAH A;  4ZVG A;  2PA8 D;  2ZEJ A;  3UDL A;  2AQ4 A;  4BCA A;  4NLG A;  3J7Z 5;  2LMI A;  5B08 A;  4A3D C;  2W2O P;  2HHH J;  2HRU A;  4NYP A;  3QSI A;  3I6P A;  2NQP A;  3SV4 A;  1DCH A;  2CG4 A;  5CYQ A;  1HNW J;  2XYH B;  1VQ9 S;  5D0H A;  1T9U A;  5KG0 A;  4Y2A A;  2MZJ A;  5HP1 B;  4LFA J;  3GB0 A;  4QZV B;  3MM6 A;  3OTC A;  4E8U A;  2ZWO A;  2ZC4 A;  2FQT A;  1X5P A;  4ECT A;  4B3O B;  1REV B;  5DDP C;  4ECR A;  2E7V A;  2XNR A;  4GKJ F;  3BKU A;  3W2W A;  5LJ3 Y;  4DZD A;  3SIP B;  5HQ8 A;  4DX5 A;  2GHV C;  3NUH A;  4P9S A;  4EUV A;  3ZZP A;  3BM7 A;  5IC6 B;  4O3N A;  1VCT A;  4DR5 F;  3UCG A;  4G7O A;  1HWL A;  5KFU A;  2BMB A;  3FZB A;  2DNR A;  3MUV P;  2ZM6 J;  4MJK A;  4PAB A;  3RRH A;  5K14 B;  5EGE A;  5FLM C;  5F8I A;  1RHK B;  2E44 A;  3W7B A;  4ZIW A;  2E29 A;  4ZH4 A;  2M70 A;  4FP9 A;  3KHR A;  3G9C A;  2XYG B;  3HT0 A;  1VR6 A;  3AJD A;  4JI8 F;  1DQA A;  3L4J A;  1Q7Y T;  3PDN A;  4GMK A;  3WX4 A;  3CUN A;  1B99 A;  5KG3 A;  1NEE A;  2ZH7 A;  1Y1W A;  3S0X A;  2YKA A;  3FGV A;  2F7V A;  3G8T A;  3C46 A;  4U7U K;  2R42 A;  1HLW A;  4F4K A;  5KG5 A;  2G0J A;  2CAD A;  1F60 B;  5D0G A;  2IVM A;  4DI6 A;  1NPP A;  3W64 A;  4F67 A;  4UZB A;  1URR A;  4B9N A;  1BLU A;  1I3Q K;  4DN9 A;  1HHQ A;  1IVZ A;  1PC4 A;  3G6E S;  1YIJ S;  1EQM A;  2FC8 A;  1FRM A;  3HJV A;  3KG0 A;  2NZC A;  4J9P A;  4OX8 A;  2XMM A;  4KSE B;  3HPO A;  4GTD A;  1GAO A;  3TAP A;  4DL6 A;  1RA6 A;  5KFR A;  1RWV B;  5DM7 Q;  4DR7 J;  5J1E B;  3F41 A;  3QAE A;  3JB9 k;  4YHH F;  3QT5 A;  1BE4 A;  1UEV A;  2R7X A;  3H0G C;  3QMQ A;  1CJK B;  3B4D A;  1H2V Z;  2MGZ B;  2FC9 A;  4KM9 A;  2BOA A;  1IJF B;  3W9H A;  3KG1 A;  2VAS A;  1U8W A;  3WIU A;  3TJA A;  1S6Q B;  3R5J B;  2LA6 A;  3GIR A;  2BJ7 A;  2VIH A;  1S59 A;  1KP6 A;  1KLN A;  2K1R A;  1TVR A;  2FQO A;  1RQ0 A;  4MKB A;  2V8G A;  3NOG A;  2EW9 A;  2A0F B;  2BA9 A;  1ZTT A;  4O23 A;  5SZT A;  4ECS A;  1L3K A;  3V81 A;  2RKI A;  3D3B J;  1JXE A;  3RW7 A;  3KNA A;  3KJV B;  4ED3 A;  4F02 A;  2AGO A;  4KPC A;  2F4V F;  4KGZ B;  4JI5 F;  2XCP A;  2FJD B;  3CJK A;  4TY8 A;  4Y00 A;  3UR0 A;  1XR6 A;  4NYO A;  2LQB A;  3J81 j;  3HHE A;  2IM1 A;  3H20 A;  4LSN B;  2V63 A;  8AT1 B;  4ZPT R;  4YP3 A;  3D28 A;  2BZ2 A;  4A3E C;  1PBU A;  4NZ0 A;  5IOT A;  5CHC B;  5CAB A;  3NGU A;  5IV4 A;  3QQC D;  2VOP A;  2DGW A;  2LEP A;  4U9R A;  4OHV A;  2K2P A;  5AE2 A;  2Q6C A;  4MYT A;  3I96 A;  3NNC A;  2ASY A;  2QJ3 A;  2X7I A;  4DCP B;  1FRK A;  4DV0 J;  1UEK A;  5LL6 d;  4DL7 A;  5I3Q A;  4F0M A;  1JLA A;  4FF4 A;  5C3E C;  5KFY A;  4JI6 F;  2OPP A;  3T6B A;  4IDK B;  5D6G A;  4K2J A;  2JWN A;  3T5H A;  3DOM A;  1UV7 A;  4X4Q A;  2NSB A;  1RAH B;  1RDR A;  5HRO B;  1TK8 A;  2XMU A;  4PG5 A;  4LUB A;  4RNM A;  2H3E B;  3FSY A;  1SL2 A;  4UQG A;  4QYZ K;  1PG5 B;  4RWW A;  4P71 A;  2MQO A;  1I50 C;  5D0E A;  3QJL A;  2I1R A;  4I56 A;  2AHO B;  1HD0 A;  4LFC F;  4OV1 A;  5J2M B;  2K3I A;  3D67 A;  2VQE F;  4F0H A;  3G8Q A;  2JA5 A;  1B0V A;  3HVT A;  1NME B;  4JI5 J;  3HKZ L;  5DG9 A;  3N4W A;  3GTM K;  4KYZ A;  4H4K C;  3MMJ A;  3IR5 B;  2Z58 B;  1V3Z A;  1FRX A;  2DKO B;  4CYU A;  3I4M C;  3O5T B;  4N41 A;  5AJ3 J;  2BJ3 A;  3OR1 A;  4LVO P;  2VKZ G;  2WVB A;  2F3J A;  1N4L A;  2H54 B;  1FKO A;  1S6P A;  3RBE A;  3KMQ A;  4KHP J;  3THV A;  2H51 B;  1NSP A;  4I7F A;  4WTO B;  3MOJ B;  2IAJ B;  3CDB A;  4NEZ A;  1K83 A;  2HFU A;  1PJ6 A;  2CVE A;  1FXR A;  2V6S A;  1WQF A;  2WB1 L;  4EZ9 A;  3M2U B;  3WHI A;  1HAR A;  1V9O A;  4QIV A;  2CYY A;  5E3R A;  2UVR A;  3KFW X;  4A47 A;  3QNW B;  3PVX A;  1LNQ A;  3SSS A;  3G6Y A;  4Y6I A;  3P6Y C;  1WD6 A;  5GME A;  3BO3 A;  2KXH A;  5KFZ A;  2N3L A;  4XDD A;  4XPC A;  5M5W K;  2F4F A;  3K5L A;  3CJ5 A;  3FSI A;  2B9Y A;  3LAP A;  4DR1 J;  2HRT A;  3D7S B;  3H4D A;  1JOE A;  4URS A;  1VJQ A;  3J80 U;  5F9N A;  2DNG A;  3O44 A;  3HFK A;  4KT0 C;  4OIR A;  1M5P C;  3OL9 A;  4YN3 B;  3TWZ A;  5HBM A;  4DSE A;  2GVZ B;  3EVO A;  1CJU A;  3C14 A;  3W8G A;  1N0U A;  2QA4 S;  3CQZ K;  1B4S A;  4LF1 A;  4JV0 A;  4IOA Q;  4ZCL A;  3M3Y C;  4G1P A;  3TEG A;  1RI7 A;  2EKN A;  4H4M A;  3E01 B;  5EGH A;  2QYC A;  3HOX K;  3K2Y A;  3NGD A;  5C24 A;  1S0O A;  1SH3 A;  4ED5 A;  2XHW A;  1YDL A;  3HVA A;  3MXH P;  4P2M A;  5KFP A;  2LXI A;  3PJW A;  4CRJ A;  4FVM A;  1X9S A;  4OYM A;  1RAJ A;  4P7T A;  3OSP A;  2MST A;  1U25 A;  2BE9 B;  3VAM A;  1F3F A;  2QN6 B;  2GIR A;  1JLG B;  1J5E J;  1I6H K;  2FLP A;  2V4J A;  2I6W A;  2LA4 A;  1IWA A;  1S1T B;  4RNH A;  1VRU B;  4IKA A;  1FDD A;  3AD8 C;  4F3M A;  4ZP8 A;  3NWG A;  3U1N A;  2RQC A;  3GYX B;  1JJC B;  2J0X A;  1Z2Z A;  4K0K F;  2Q66 A;  4WIL A;  2AKW B;  1Q79 A;  4YR2 A;  2V50 A;  2EC2 A;  3TZZ A;  2XNQ A;  4KH0 B;  5A76 A;  1SV5 A;  3DOM B;  1SFO K;  4DR1 F;  3KUE A;  4DX7 A;  2BKN A;  2ILY A;  3FEZ A;  5CH7 B;  5T7L A;  1X8D A;  1RHM B;  4JUZ A;  4DQS A;  2ZZT A;  1ZPV A;  2KRR A;  4J9N A;  3MZI A;  3GTL K;  1OQ3 A;  4BKW A;  3IRX B;  4URG A;  1S1U B;  4DPT A;  5JXS A;  3CCL S;  1O2B A;  5GAD U;  2V94 A;  2MZR A;  3M4O K;  3KLH B;  1UWB A;  5C4J K;  2HNY A;  2Y3Y A;  2WON B;  3I0S B;  3TJ8 A;  4I2Q A;  4ZHR B;  2W4P A;  2P6S A;  1FES A;  2KT2 A;  2V2Z A;  3HD1 A;  1XXC A;  3F44 A;  2PI5 A;  1SFO A;  4RW6 B;  2CKW A;  3J80 Y;  4MIW A;  2IIH A;  4HHU A;  2GA7 A;  4IFV B;  2XQC A;  5DJB A;  1Y7P A;  1VBY A;  3PIP Q;  1HFE L;  1HIY A;  3V4G A;  2D3U A;  1BGW A;  1HHS A;  3R2D J;  2OH2 A;  4ES1 A;  3EVM A;  1QVF R;  2MB0 B;  3MM7 A;  3WDO A;  1U48 A;  1EQ0 A;  3Q2S C;  2E1P A;  5GAD I;  4WKY A;  2KU7 A;  3OUY B;  3IWX A;  2LQ9 A;  2WVE A;  3DYA A;  6AT1 B;  1KFD A;  4Y52 C;  2JA6 C;  4EBE A;  2M9K A;  4J9V A;  5ETL A;  4RNO A;  3OFE A;  2HHV A;  5IP7 C;  2N4D A;  4ID5 B;  3T3F A;  2KJW A;  3NY0 A;  3HHL D;  3TTG A;  5DLF A;  4OLO A;  2UVU A;  2X51 A;  3OTE A;  4DU7 A;  3O1L A;  2M5Y A;  5K8M A;  3RB3 A;  2R8I A;  4EFA C;  3LP1 B;  4HR2 A;  1X9W A;  4UST A;  4TY8 B;  2PMH A;  4FS2 A;  1YK9 A;  3GP9 A;  2P8I A;  3OHB A;  1H2T Z;  4ZVF A;  3OL7 A;  4LRE A;  1L3S A;  3HSD A;  3D6H B;  1XK8 A;  2O5I A;  4NEY A;  2DNM A;  3B4M A;  1VIX A;  1XMB A;  1UWB B;  1VS3 A;  1ZET A;  2CFA A;  2E2I C;  3CCJ S;  4DV2 F;  1TKX A;  2XHC A;  1M5H A;  5HL7 Q;  4EMD A;  5D4D A;  1IR2 A;  4KDD A;  1QE1 B;  4L76 A;  5C42 A;  2QSF A;  1YBU A;  1U1M A;  1BQX A;  2Q3P A;  1XZQ B;  2H5I B;  2WBM A;  1S1V A;  2HND B;  5KFE A;  4H4O B;  2HS4 A;  2R7O A;  1HMV A;  1NK8 A;  2ZJR Q;  4O2D A;  2YKQ A;  5J2P B;  3S1N C;  2ROP A;  4CZC A;  4ZPD A;  1KLM A;  3FKI C;  1BD6 A;  4F50 A;  2YWK A;  4DF8 A;  4O0N A;  2HBR B;  3OJS A;  1YWX A;  2GW8 A;  3ISN D;  1J5E F;  4GTF A;  4IRD A;  1RCO B;  2G1H A;  2J6U A;  5G0R A;  1QAX A;  4HH1 A;  1X9M A;  1TR0 A;  2R7S A;  4DXL A;  3C15 B;  3HOY C;  1OO0 B;  1X5S A;  1HKA A;  4ITS A;  2I0X A;  2B9W A;  3ZXW A;  4QW9 A;  3HXM A;  4USU A;  2FGO A;  1D9A A;  1SKW A;  3R97 A;  2ATC B;  1TWF A;  2COL A;  1T0T V;  1HBU A;  3EZO A;  2MLZ A;  1Q78 A;  4CDI A;  2ZH8 A;  2FVC A;  3T02 A;  5KFG A;  3N0C A;  1ZM9 A;  2NUH A;  5FLM K;  5HQL A;  4BBS K;  3L7P A;  1B4A A;  3JSM B;  2DNO A;  4M5N A;  3HJF A;  2C3P A;  1TMM A;  1WOR A;  3Q8V A;  1U0S A;  3IAM 9;  1VJE A;  3L09 A;  3TP2 A;  2UV8 G;  1VQY A;  2E5H A;  4M5H A;  3CCV S;  3V81 B;  1AYE A;  4LQY A;  3DOL B;  4J37 A;  2DK2 A;  1WI6 A;  3GFY A;  1HNI B;  1EET A;  5ETR A;  1YKW A;  4RUB A;  2FDN A;  2YQ0 A;  1L0W A;  2ZHO A;  2AT1 B;  3S2H K;  3V2U C;  4GTL A;  2XWX A;  3BJY A;  3FVY A;  3BRE A;  2VOD A;  2R7T A;  3V6K A;  2XI3 A;  3CJ8 A;  3QFH A;  2NVY K;  2ZBC A;  3MFH A;  1VLY A;  4EO8 A;  3D0G E;  3R3T A;  1O28 A;  1NXI A;  4LF5 J;  1R0B G;  3I4N K;  3IN5 A;  4ED1 A;  1JQG A;  3TOQ A;  2F8M A;  3BKT A;  3EGW B;  3M8Q B;  6FD1 A;  2ZWP A;  2YH0 A;  4DLG A;  4X66 F;  3JYT B;  3KKF A;  2ZUG A;  4ED2 A;  4KC5 A;  2OO4 A;  3K5P A;  2MDA A;  4ED8 A;  2JEJ A;  5HJY A;  1F9F A;  4O3O A;  3R7N B;  4G65 A;  4NLY A;  1N33 J;  4C9D A;  1REV A;  4PWU A;  1JJ2 R;  3GTY X;  5AT1 B;  3S1R C;  1VBK A;  1LWF A;  3MCO A;  1JWW A;  5CA5 A;  3LAL A;  3BPD A;  4ZIV A;  4XTT A;  2V69 A;  3DRS A;  3KYL A;  3NCR A;  5E5N A;  2YNI B;  5KG2 A;  2OPQ B;  2ZH3 A;  3QIP A;  5JVH Q;  3MUR P;  1N52 B;  4C3K A;  5IV3 A;  3F56 A;  1P9Q C;  1YZ7 A;  5C25 B;  2OSR A;  3UDC A;  2DEI A;  2JA5 C;  2FZC B;  1XER A;  3IP0 A;  4NMX A;  1YBT A;  3ZFV A;  2V68 A;  3R8Y A;  2ZZN A;  4CCH A;  1OS5 A;  1FVS A;  5MLC V;  1N36 J;  3BGL A;  3O3L A;  1HI0 P;  5FLX Y;  1NHV A;  1W2B R;  1S1V B;  5C2C A;  2NRE A;  1UA1 A;  3ZTS A;  4MK7 A;  1TK5 A;  4OV6 A;  4YEA A;  5L1L A;  5KG6 A;  2HBY B;  4P73 A;  1UVK A;  3DDK A;  1NO8 A;  2IAJ A;  1RT4 A;  2RDI A;  5ADZ A;  2WZ1 A;  2D3Z A;  1FI4 A;  5IYD K;  4OYZ A;  4UOH A;  4YG2 A;  1IBL F;  5F0U A;  1EIY B;  2DPI A;  3IGN A;  1RGV A;  2CQC A;  1IM6 A;  4NLT A;  2CQG A;  1WCM K;  4CWB A;  2HHU A;  3CO9 A;  4B3R F;  1IS1 A;  1RIS A;  2VC0 A;  3DU5 A;  1AW0 A;  4GTE A;  1CPZ A;  1UET A;  1FD8 A;  1XWL A;  2VUM K;  5F8M A;  5DZ7 A;  4WWS A;  3C6T A;  4KGK A;  2HFN A;  5IYB K;  3AOA A;  3HCX A;  1R89 A;  3LO3 A;  3UI3 A;  4HAC B;  2ADC A;  5IP9 K;  4XSZ A;  1D8Z A;  4Q44 A;  4WK1 A;  1SH0 A;  1RT5 B;  3N01 A;  3DLJ A;  3V4I A;  3M8S A;  2HEK A;  2EEY A;  4LRA A;  1KOH A;  2JA6 A;  2MZT A;  4FPI A;  2ADB A;  5KT6 A;  1FRH A;  2VZ9 A;  1JVI A;  3PX0 A;  1XNQ J;  2NCK L;  2IM2 A;  2CQ0 A;  2R7V A;  4ETX A;  1F2H A;  5D4L A;  3IPJ A;  2DY1 A;  1NCL A;  4O44 B;  1KD1 T;  4DLE A;  4D3H A;  4JBC A;  4OYA A;  2BR0 A;  4WJB A;  4NXM F;  1SJ4 P;  4P74 A;  4DPW A;  1N6Q A;  4WK3 A;  3MDF A;  3JYT A;  4KN4 A;  3SCI E;  5D15 A;  3N0B A;  4DR3 J;  2DR7 A;  4H4M B;  4OYW A;  3RZA A;  1I3Q C;  5SUH A;  3I0R B;  1BQN B;  4WFZ A;  4GT9 A;  2JA6 K;  3GG1 A;  5I3P A;  2C28 A;  1RU2 A;  3U02 A;  2YX7 A;  3H5Y A;  3UFC X;  1ISE A;  1FJ7 A;  3WQP A;  2UUA F;  4ILL A;  3H7H B;  3BQ2 A;  3RW6 A;  2XLJ A;  3TAQ A;  4CLZ A;  1AFI A;  4K8R A;  5RUB A;  4X65 F;  1OY9 A;  2IVY A;  1NK5 A;  2JEG A;  3GEI A;  3TVK A;  1DY3 A;  3VWS A;  1I50 A;  4R5P B;  2NVX A;  1R27 B;  3S2H C;  1QTN B;  4ES3 A;  3VAK A;  1WEZ A;  4LFB J;  4P75 A;  4J91 A;  4C45 A;  3H0G A;  2GIF A;  3S7R A;  3KJQ B;  5IOS A;  4CT8 A;  3QAU A;  4A3K C;  1RA7 A;  1VGX A;  5EHH A;  4N47 A;  3GTM A;  1V5V A;  1X31 C;  3AOB A;  1NK9 A;  1JLF A;  4LFB F;  3BSO A;  4XAK A;  2ZZM A;  3R27 A;  3AB4 B;  1TKZ A;  5IWA J;  3S6E A;  2EG2 A;  4PUO B;  4BLB A;  3HOZ C;  4I0W A;  2RUS A;  1HQE B;  1PJ7 A;  1F1B B;  3KK2 B;  4X2B A;  5EWG A;  2UVW A;  3UDV A;  2CPD A;  2RB7 A;  1VIO A;  1WC5 A;  2ZBI A;  1NLK L;  2W9B A;  1NK0 A;  1HW9 A;  2POK A;  3RJM B;  3QFW A;  4URQ U;  3MEE A;  3AHP A;  1YRX A;  1HBN A;  1F9H A;  4UUW A;  1R0A A;  2VC1 A;  4QYZ J;  1QAJ A;  4DV5 F;  1OPI A;  1HQU A;  3B54 A;  3BGR B;  3EE3 A;  4ZVE A;  1Q7L B;  2HVD A;  1EKR A;  2ACY A;  5KT7 A;  3N6L A;  3FHZ A;  2NVX K;  4ZJL A;  2HGN A;  2XGQ A;  2PMZ L;  1J5O A;  2L9D A;  3B82 A;  1S1U A;  2JHE A;  4HAC A;  1Q86 T;  2RRN A;  3BYP A;  1S0N A;  4XLN A;  1XR5 A;  3N5B A;  1PSD A;  1RT1 B;  2VA3 A;  3FKI K;  5DQI A;  1S6P B;  3MR3 A;  1WHX A;  3CD0 A;  2CQI A;  2VQF F;  3QGP A;  4J9O A;  3C2P A;  1TWH C;  1RZM A;  3IRX A;  2QX0 A;  1T11 A;  3JS9 A;  2E5I A;  4KO0 A;  3PZP A;  4I2P A;  2AIR B;  5DQG A;  3SV3 A;  5L1I A;  2ZE2 B;  3H5S A;  4H54 A;  4OFZ A;  4U95 A;  3MD1 A;  4A3K K;  4MYU A;  1WQH A;  3PV8 A;  4LR9 A;  1HQE A;  2V4J B;  4DU8 A;  4QJV B;  4M5I A;  4ENO A;  3TYT A;  1W7W A;  2QT7 A;  1JB0 C;  5I3U B;  1RT2 B;  3QX3 A;  4ZMM A;  1RYR A;  3QLH B;  5IQ6 A;  4LR8 A;  2D3O 1;  1H7X A;  3W61 A;  4WIQ A;  1P8G A;  3MM6 B;  2BV3 A;  5KFH A;  3FBB A;  4RWX A;  4PXB A;  3NGR A;  1TWG K;  3QGI A;  4OYO A;  2QGF B;  3CE8 A;  4PCQ A;  3BO2 A;  3SSQ A;  5KFF A;  2EWH A;  2ZBQ A;  4ELU A;  2WAQ D;  5HAT A;  2Z30 B;  2HIY A;  5CXT A;  1S6U A;  4I2Q B;  4ZHR A;  4MFB A;  3CDE A;  3DLG B;  3QGG A;  3S1M K;  2V8D A;  1SI9 A;  1DCP A;  1FX2 A;  5D3G B;  1N32 J;  4DL5 A;  1BC6 A;  4IFV A;  1KKH A;  4FPR A;  3IWL A;  3K57 A;  1H73 A;  1SQE A;  2HHH F;  2P5M A;  2HHP A;  2Z4P A;  2CVI A;  1T95 A;  3EGN A;  1S7I A;  4B08 A;  4A8S A;  1DZ5 A;  4JV5 F;  5T41 A;  1CJV A;  1WWH A;  1HI9 A;  2YKO A;  2O01 C;  3SCL E;  1S6O A;  1FVQ A;  2CQD A;  5C4J C;  1WTB A;  4L3K A;  5IT9 U;  1JLB B;  1XZQ A;  4M5G A;  2JEF A;  3FUY A;  1QUV A;  2R8G A;  4BY7 K;  3IG1 A;  1BS2 A;  2M2B A;  3W2V B;  4XDC A;  4Y28 C;  4LF4 J;  2KB2 A;  5HO4 A;  3H40 A;  2OMO A;  3OXL A;  1UAW A;  2ZH5 A;  5ETK A;  1UCN A;  3EUN A;  1S76 D;  3W2V A;  2DT9 A;  5HL8 A;  3GCW P;  3GTK A;  3FFI A;  1C1B B;  1LK7 A;  1NB2 A;  4YUD A;  3CCZ A;  4GZY A;  1FD2 A;  4C3M A;  1KR4 A;  4DEZ A;  4E98 A;  2PDA A;  3MPV A;  3IA0 A;  1VQ4 S;  1VRU A;  3NGT A;  2QA2 A;  3GV5 B;  2CDR B;  2I9S A;  2GHW A;  4K4V A;  4G7Z A;  2W8L A;  4QBU A;  1EAY C;  2DCU B;  3MD3 A;  2Z0G A;  2PGC A;  3CSK A;  4I67 A;  4FYD A;  2AW0 A;  1HBM B;  3S16 C;  1RT2 A;  4C48 A;  4MFB B;  2GV1 A;  2UXD F;  4BBY A;  2V0N A;  4AYB L;  3BKF A;  4FZB A;  2NVY A;  3CJK B;  2DXE A;  3M05 A;  4JI0 J;  1YQH A;  3FSX A;  3FOE A;  1P1T A;  2HQD A;  2XTJ P;  3E01 A;  4R5P A;  4ICL A;  3CCT A;  3C19 A;  1ZBT A;  4LSL A;  3PFE A;  2W2N P;  3IO1 A;  4OZN A;  2EVZ A;  1AB8 A;  1UVN A;  3PNI A;  1VOM A;  3NKY A;  1R9T C;  1FRJ A;  2HZC A;  4WII A;  1R8H A;  5HVG A;  1J2V A;  4A8F A;  5F9L A;  3ZO7 A;  4ED4 A;  2FUG 9;  4HVZ A;  3N0V A;  4DV6 F;  3G4S S;  2YPY A;  1WF0 A;  3M1V B;  3NEK A;  3FOF A;  4B9T A;  1QLN A;  1O24 A;  4WFA Q;  3G82 B;  3T19 A;  2RIJ A;  1YCL A;  1UFW A;  3K0J A;  4NCG B;  5C42 B;  3CUL A;  2U1A A;  4Q43 A;  1YNJ A;  3CJ2 A;  4IOC Q;  4NA3 A;  4CLL A;  3FBF A;  1K9M T;  2R8H A;  1Q4R A;  3GMG A;  2MYF A;  4DPO A;  3TO8 A;  4AQY F;  1U1R A;  4ERD A;  4PRF A;  2MLY A;  2FLL A;  4J90 A;  3U7J A;  1Y3J A;  1GQE A;  2MQM A;  4BHQ A;  2FVR A;  4J9R A;  4NLR A;  1RAB B;  4K50 A;  1NUE A;  3CTR A;  3IGV A;  1HNZ J;  2HK2 A;  2MZQ A;  3HZE A;  1RHU B;  2CWK A;  1F2G A;  3HVT B;  2J9E A;  7FDR A;  1RCX B;  4Q45 A;  4MEX A;  4C3J C;  1RU1 A;  1RTZ A;  3S2D K;  1XXB A;  1XIQ A;  1I1G A;  4ER8 A;  1N8R T;  2DIS A;  5EX0 A;  2F9D A;  3QBC A;  1T3O A;  1F5A A;  4DFM A;  3EPI A;  3OLB A;  2FY8 A;  1Q5V A;  2X1A A;  2F8E X;  3M4X A;  4KMU A;  1UW4 A;  1S6Q A;  3TRG A;  1J6W A;  1I50 K;  1WNE A;  3CB4 A;  1N5Y A;  3Q86 A;  1QSS A;  3JTO A;  2HQI A;  1SUQ A;  2VPW B;  1IWG A;  4OYI A;  2DGX A;  4NA2 A;  4NZ6 A;  4Q7A A;  4RKU C;  1WSV A;  2EFP A;  1T3N A;  1EFW A;  4I4B A;  2Y0S L;  4QWD A;  3LW5 C;  2V9K A;  4JI4 F;  1C0U A;  5AXL A;  2CAJ A;  5KOX A;  5A8R A;  2V5H G;  4RNN A;  5KT5 A;  3BR9 A;  1O0P A;  2OD6 A;  3NRB A;  4F7V A;  5EX3 A;  1JLB A;  2R3V A;  1JLE A;  1T03 A;  4DV3 F;  3T00 A;  1KLM B;  3BN7 A;  4GO5 X;  4IQX A;  2BE5 A;  2FJE B;  3S1T A;  2G9O A;  1C0T B;  3FZ2 A;  1HBM A;  2ASJ A;  3CCS S;  4DV3 J;  1S5Z A;  1KTV A;  4F3Q A;  2Y8W A;  2DEJ A;  1RXO B;  3CJS A;  5D77 A;  3M8R A;  2M52 A;  2XLK A;  3KJV A;  2MKK A;  3X1L B;  1RTH A;  3NL0 A;  4MKV A;  2I38 A;  5LMU F;  3CDW A;  4ILD A;  1SJ1 A;  2R7W A;  3ENA A;  5C24 B;  1O6X A;  3D3C J;  2HQF A;  3QSY B;  1F93 A;  3GTO C;  1NSA A;  5KOW A;  2DNQ A;  5CYQ B;  1GH8 A;  1RTI A;  4UUX A;  5AJ3 F;  1QM9 A;  1MNE A;  3K7A K;  1DBD A;  2PA8 L;  2CA9 A;  3R5B A;  3IXQ A;  4RR5 A;  2FPH X;  3DCA A;  3NGS A;  4ZJQ A;  1I3Q A;  1CG2 A;  2L48 A;  1GEH A;  3VTI A;  4C2M C;  3HHK A;  2BE2 A;  3BQ0 A;  3PKY A;  2YU9 K;  1V6H A;  2C3O A;  5ETM A;  3R6G B;  5HSP A;  4TQS A;  1EET B;  1KQG B;  2GO8 A;  1SQG A;  2K06 A;  2Y1L B;  2JFK A;  4KQZ A;  5GAE U;  2HWH A;  2OPS A;  3DYA B;  2YNH A;  2ZDO A;  4B9U A;  3M8P B;  3GYG A;  3K5N A;  4NOH A;  1RSC A;  4DSL A;  3D4J A;  3FEX B;  1G4C A;  1H6K X;  3RUB L;  2CZ4 A;  2AX0 A;  1LWE B;  2YKM B;  1O8B A;  2E2J C;  2IA0 A;  1GT8 A;  2N82 B;  2XS5 A;  4OJG A;  4E2F B;  4IFY B;  2QZ8 A;  2WK4 A;  2IDE A;  3T1H J;  4AYB D;  5B0E A;  1VC0 A;  3EIC A;  1ZH5 A;  1TP7 A;  3H5U A;  2YWH A;  1XC9 A;  3I0S A;  3PO3 C;  4U8V A;  1R43 A;  4LF7 J;  1RT1 A;  2RT3 A;  4MTP A;  2VKR A;  4A8K A;  3N5F A;  3D0I E;  4ECW A;  1ZAV A;  1P27 B;  1O29 A;  4N8O A;  1RU0 A;  1I51 B;  5KT4 A;  3MEE B;  2QLB B;  4M5M A;  1FT8 A;  2R7Z A;  3OVS A;  4RBT A;  2YNG B;  2D41 A;  3S14 K;  3NLC A;  4JOU A;  3UNY A;  5KFW A;  2OPR A;  1TUG B;  4DSI A;  1R8A A;  1JQW A;  4UZC A;  1V3S A;  1OPZ A;  1Q16 B;  3RBD A;  1UPM B;  2XCO A;  3RBZ A;  2OSQ A;  1GTH A;  2IC3 B;  3E8O A;  3CCU S;  4OLP A;  3VAJ A;  3RTV A;  2R92 A;  2H5J B;  3I5B A;  4CLS A;  4Q5V A;  2RHS B;  1TWF K;  2G2Z A;  1PKU A;  3O6Q A;  3OJU A;  2BW7 A;  3VAL A;  1S4E A;  5A8W A;  1WKK A;  3HHL C;  3W5Y A;  1SJ3 P;  4DR6 F;  2KKH A;  1IN0 A;  2XCA A;  1OYE A;  3V4M A;  3KLV A;  3S17 K;  2RU9 A;  4IH7 A;  1M5V C;  2E2J K;  3ERE D;  4MH8 A;  3DLE A;  4TLR A;  3ZNU A;  3CMA S;  3A12 A;  2VL1 A;  1GMV A;  5HRO A;  4RW4 B;  4NX9 A;  3EDQ B;  2KG1 A;  1LFP A;  3CC2 S;  4AH6 A;  4TYA A;  1PYS B;  1HNV A;  4H4O A;  3TX8 A;  3VGT A;  3KJN B;  3N79 A;  2W1B A;  3FKB A;  3MM7 B;  4NAS A;  2HZA A;  4O4G B;  3KG4 A;  4CTA B;  2MXY A;  4YS2 A;  5J2M A;  2ZD1 A;  3GWC A;  1JLA B;  3OBI A;  4DV7 F;  2R7Z K;  3A8E A;  2DXF A;  1JXL A;  4J7C A;  3DKD A;  3CIZ A;  4XPE A;  1SJQ A;  2FVS A;  3SQG A;  5ETT A;  2M4M A;  1CQM A;  3JSB A;  1YZ6 A;  1TL7 A;  2DTJ A;  1S99 A;  1XBW A;  5IT9 Y;  1NRK A;  3GLJ A;  1YNN A;  2HVZ A;  4UTG A;  4LF4 F;  4KAW X;  2HLT A;  3UE2 A;  3NAH A;  1FNX H;  2VJU A;  3M2R A;  4J9L A;  1UKU A;  4MKA A;  4DX6 A;  1R8P A;  1R8C A;  5M3F K;  3KLI A;  3BGF A;  4EYI B;  4DFK A;  2MQQ A;  3M30 B;  1YRU A;  1WG5 A;  1D1U A;  2FY1 A;  5IS2 A;  2MJU A;  1S9G B;  3GFX A;  3LP2 B;  3TVY A;  3MM5 B;  1GNK A;  1RTH B;  2FYX A;  4FXD A;  5LOQ A;  3K7R A;  2Y1I A;  5A0Y A;  4AUK A;  3HD2 A;  4QIW L;  3M8P A;  4QR1 A;  4XSX A;  2NZ4 A;  3NBP A;  1NND A;  4OZL A;  2ZM6 F;  2XBP A;  3VHQ A;  2PFF B;  3AA9 A;  2CG8 A;  4CLU A;  4JI7 F;  1IKW A;  1SXL A;  3GTJ C;  3WX8 A;  1VK3 A;  5FLX U;  2DVI A;  4DUZ J;  5C44 C;  2FJW A;  2HAI A;  1FE4 A;  5HVF A;  4UY8 T;  2Q6B A;  1H38 A;  1LXJ A;  2YPZ A;  3I4N C;  4I7F B;  1JIH A;  3PYF A;  4MK9 A;  4DUT A;  1BUX A;  1PYT A;  1H74 A;  1UJ6 A;  2CPJ A;  1U47 A;  2W7O A;  2E2I A;  1BGX T;  3EX7 B;  2CFX A;  3BYR A;  4DHV A;  1DQ9 A;  3QZ8 A;  1TL1 B;  3CNQ P;  1DTQ B;  3QRQ A;  1RAD B;  4JI6 J;  2E5J A;  3SFG A;  1WEL A;  3A8K A;  2MHE A;  4HI1 A;  3C16 A;  2W2M P;  4BBR C;  1MSW D;  1VRT A;  2NPF A;  4HH0 A;  1TWF C;  2YWE A;  3QRP A;  1IKX B;  1Q8I A;  3JQJ A;  5KAK A;  1LQ9 A;  4PR6 A;  5GMD A;  1K1Q A;  3IBC B;  2ROG A;  3Q8Q B;  4L73 A;  1LWC A;  3B8H A;  2UXD J;  1WQG A;  5C4X C;  3TJ9 A;  3N28 A;  2ZUF A;  5CAA A;  3PO2 K;  4JI3 J;  3FBC A;  4KV8 A;  2OEK A;  2FVP A;  1XXA A;  1NDL A;  1OIA A;  4X64 J;  1B0T A;  2BJ8 A;  4MIA A;  4KV8 B;  1TWA K;  5DGA A;  4FN5 A;  1Y5N B;  3VGU A;  3QAT A;  2VPZ B;  4NXM J;  3QID A;  3LWM A;  1AUS L;  2JA8 C;  1U7L A;  3BR8 A;  4K7Q A;  5DZ6 A;  1KSP A;  3LAK A;  2EXU A;  4DR7 F;  3U1L A;  4B02 A;  1KVJ A;  4CLY A;  3M6V A;  1SFO C;  1DLO B;  3AQO A;  3FCW A;  5IOR A;  3MGJ A;  3EPG A;  4N7T A;  1CC7 A;  3DLL Q;  1GX6 A;  4LBI A;  1NJX A;  4FBT A;  2HS0 A;  3DRP B;  4ID5 A;  4PKD B;  1P1L A;  4EK2 A;  4J9Q A;  1E6V A;  4B3S F;  1KVI A;  2CW0 A;  2QFJ A;  2NYH A;  1XZP A;  2D9O A;  2ACM A;  2J6T A;  5A6P A;  4ECU A;  2RHQ B;  1ZM4 A;  4C7Q A;  4TKT A;  5H9F K;  2DCL A;  3SDE A;  2CNK B;  3S1N K;  5LXR A;  2RIL A;  1K83 K;  4YFK A;  2C2N A;  3UWT A;  2UZA A;  5IFM A;  3ZZU A;  4O3R A;  4PQA A;  4LVN P;  2YU9 C;  3BGO P;  4K0K J;  1IUJ A;  5EN1 A;  2CZ9 A;  2BOP A;  3X3U A;  1M5O C;  1HR0 J;  2PFD A;  2DNK A;  3CW2 C;  4LBH A;  4GVL A;  4P2X A;  3D2W A;  3A3P B;  3SZZ A;  3TR5 A;  5U47 A;  1ZM2 A;  2EFV A;  3RYL A;  1XNR J;  2NXJ A;  3PHT A;  2K7K A;  4TNO A;  3JAM U;  4YR3 A;  2NS1 B;  4C0B A;  2AEJ A;  1XJW B;  1YJT A;  2R7U A;  3O2I A;  4FNI A;  2C2O B;  3MMA B;  1TKT A;  2O67 A;  4CLP A;  4FF2 A;  2FJA B;  4RUA A;  2AX1 A;  1TAU A;  3LP0 A;  1RKJ A;  1U1L A;  2A3J A;  3MR6 A;  3GSI A;  3H2L A;  1VQK S;  1JJH A;  4KR0 B;  4RNF A;  5M2P A;  2C1E B;  3A8J A;  2VG5 A;  4OHX A;  3D68 A;  2BXJ A;  4DV0 F;  1J5O B;  4PG4 A;  1BXN A;  3L4K A;  4Q2M A;  1QTM A;  3KLF B;  4B9L A;  5M3M K;  3M8Y A;  2UUC J;  4A3B C;  2B63 K;  1WHW A;  4IG3 B;  1WDT A;  2UUT A;  1MLA A;  2VUG A;  2WOM A;  3OR1 B;  1DLO A;  2W4D A;  2RQM A;  1ZAX A;  3MFI A;  3GJT B;  2XYP B;  1QAI A;  1RYS A;  3PR5 B;  5B0C A;  2HKE A;  1FA0 A;  5CHP A;  5C7P A;  2RRB A;  4A3G K;  4X4O A;  4TU7 A;  2ZBP A;  4EZ6 A;  3PKM A;  1H2U X;  2HYI B;  5JUM A;  2RD5 C;  3RR7 A;  2GQQ A;  1UW9 A;  3R7S B;  3OTD A;  4UW2 A;  5K8P A;  4M63 A;  2H5E A;  4F25 A;  4LQ9 A;  4EYH B;  3PYE A;  1L3U A;  4WTY A;  5F3T A;  2HHQ A;  3HHL B;  2AZ3 A;  5IOQ A;  4CLT A;  1YRT A;  3K59 A;  1DTQ A;  3GV8 B;  4PWW A;  5L46 A;  2MZS A;  4YB6 A;  3J7Y U;  5BYR A;  3CIM A;  2JH3 A;  1RWW B;  4LIR A;  2XMV A;  2DGO A;  3TZW A;  4LJZ A;  3PM9 A;  3CJT A;  4ICL B;  4K4S A;  4C0O C;  3CDA A;  4DZ6 A;  1UZD A;  4ILR A;  1IBK J;  2AV5 A;  5HAO A;  1R8B A;  3ILO A;  3LPY A;  4MAK A;  1TTH B;  3BBF A;  1ZOT A;  1VRT B;  4M5J A;  3HX9 A;  1DFD A;  1T9V A;  2HS3 A;  3AFG A;  2YY3 A;  2DNH A;  2LXF A;  5I4M A;  4LSZ B;  4I6W A;  2B43 A;  4LBP A;  5T7L B;  2BVZ A;  1T9W A;  3HKW A;  3Q8P B;  2YNH B;  1YTY A;  4DR5 J;  4PXC A;  3PW5 A;  2RS2 A;  4R25 A;  1U1K A;  3PW7 A;  2FJX A;  4UOC A;  2PE8 A;  3JTP A;  1XNQ F;  4PQU B;  1Q53 A;  1KRP A;  4O3S A;  2KM8 C;  4X65 J;  2QLF B;  1QAY A;  2WCX A;  4CH0 S;  3GIK A;  3GTP A;  5ITH A;  2I8E A;  1SUQ B;  1S1W A;  3DDI A;  1WTF A;  1QSY A;  1FK9 B;  4QQB A;  1F9N A;  1JXV A;  2J0S D;  1TWA C;  3SEO A;  4B9S A;  4G1Q B;  5F3Z A;  5IZH A;  1LW2 A;  3T6J A;  4NLQ A;  3VAI A;  2IHR 1;  1G1X A;  2UXC F;  1KQS R;  4A3I C;  1D09 B;  3I31 A;  1IL2 A;  2DNY A;  1G51 A;  4IH6 A;  5DQH A;  2W9B B;  2LEB A;  3T1H F;  4QWB A;  2V2Q A;  1FFG B;  4R0E A;  4AND A;  4N76 A;  4RW6 A;  2FLO A;  1NDP A;  3P49 B;  4PUO A;  3UVJ A;  2GSU A;  1MWY A;  2QL5 B;  5KG1 A;  3AB2 B;  2ATL A;  1WJ9 A;  2XEX A;  3S1Q C;  1TL4 A;  3CCR S;  1HNI A;  4DWI A;  1RLD A;  4G1I A;  3LP1 A;  3LF0 A;  1SB6 A;  4ZCK A;  4ECQ A;  4O3P A;  2J76 E;  4DCO B;  2L08 A;  2X3G A;  1L5U A;  4PEO A;  5H9E J;  2L41 A;  2AP6 A;  4CO2 A;  4KJI A;  3IBF B;  2R7Z C;  3WZ0 A;  2L3M A;  1JX4 A;  4ECY A;  2LEC A;  3D6M B;  2GC8 A;  4B3T J;  1X4C A;  2LQJ A;  2FHJ D;  2H1Y A;  2KN4 A;  4FF1 A;  2WB1 D;  3HHL A;  3LAM A;  4A3B K;  2CFA B;  3FQK A;  5L8R C;  2Z2Z A;  4CT9 A;  2NVQ C;  1FWP A;  3BS9 A;  3GTG K;  3GTQ A;  1SIW B;  1SCJ B;  4DV1 J;  3M9M B;  3K8V A;  3H8Y A;  2V67 A;  2HHW A;  3G96 A;  2LEA A;  4ZA1 A;  3I4M K;  4ZN3 A;  4A3F C;  5DDQ C;  1Y4Z B;  1NU4 A;  3VA7 A;  3MI7 X;  4OZ3 A;  1Q0N A;  1BWV A;  1UPP A;  4KGM A;  3UNG C;  1OSC A;  4A3M C;  2RJZ A;  3DRR A;  4A3I K;  1DAR A;  1X0F A;  3GTK C;  3KJF B;  1F6T A;  2D3O R;  2B4O A;  1KVK A;  3BZQ A;  1RAO A;  3HT3 A;  4MMO A;  1Q5Y A;  5F0W A;  4OZJ A;  3Q23 A;  2V8V A;  5IC4 B;  3B6B A;  4HEA 9;  1S4F A;  3S1R K;  1CQN A;  1AZS A;  4CH7 A;  5C2G A;  3GDZ A;  2UVV A;  5KFS A;  1M5K C;  4TQR A;  2NYI A;  3HVW A;  4KMD A;  4RL1 A;  4QIE A;  4DQR A;  5HLF B;  5MAO A;  1IKY B;  2J7K A;  4A93 K;  3NBP B;  2V6U A;  2Z2L A;  3FDS A;  2C2E A;  4LF8 J;  2YH1 A;  3MF5 A;  5K9F A;  3OTO F;  2AJ2 A;  4PXD A;  4AXI A;  3QT6 A;  2D6F C;  5HAN A;  1SJF A;  4ZOS A;  4EWT A;  1NJW A;  4C3I C;  1Y1V K;  4OJ3 A;  1SL0 A;  1TFW A;  3FMB A;  4UF4 A;  1MU2 A;  2P8T A;  1H0H B;  4USK A;  5KFX A;  2X1G A;  2GQC A;  1HI1 A;  3M2V B;  4LJM A;  2AZ1 A;  2EG1 A;  3R5D A;  4K4X A;  2MQ8 A;  3IG1 B;  1ZVU A;  2VG6 B;  4IR9 A;  4WYL A;  3OL6 A;  1B3T A;  2FHK A;  3RRG A;  3KLI B;  1RWN B;  3GTM C;  4GTA A;  2B4P A;  4I6A A;  1IQZ A;  5G0R B;  3TA0 A;  2XS2 A;  1WEX A;  3N9U C;  1U1P A;  1FDN A;  2KI2 A;  2YXL A;  2OI2 A;  1WC0 A;  1L3V A;  2HFO A;  3K7A C;  1TKT B;  4F2R A;  3ZZO A;  5FII A;  3TAM B;  4ALZ A;  3HUL A;  1EZZ B;  4LMZ A;  1SKR A;  1S10 A;  3W1Y C;  2E1R A;  1NH7 A;  5IYB C;  2KWA A;  1WCM C;  1HBO B;  3MHY A;  4A3F K;  5E3C A;  2LKZ A;  3SSR A;  4YR0 A;  4Y2M A;  3GR0 A;  1WOP A;  2BRL A;  1KC8 T;  1Q8B A;  2CPI A;  1YGY A;  1YVF A;  4EGL A;  3PO5 A;  1T05 A;  3I4H X;  4X4U A;  2CPF A;  4FYX B;  2O3D A;  4TVA B;  3BGU A;  5I42 B;  4LF6 J;  1H98 A;  4PWD B;  2YWW A;  3AH5 A;  4KHP F;  4NPO A;  4DV4 J;  4W90 B;  1AA1 B;  5LSO A;  4KO0 B;  4LRF A;  2CJX B;  4GFQ A;  2GJI A;  3JSY A;  1T9T A;  4OYX A;  4G0U A;  3UVJ B;  1BQN A;  5HMX A;  1TL3 A;  4A3E K;  2LXU A;  2BQU A;  1IBC B;  2AGP A;  4MKY A;  4P52 A;  2VPY B;  3N6M A;  3S15 K;  2KYZ A;  2V8P A;  3BSC A;  3DLK B;  2WVD A;  3D9B A;  3CCQ S;  3UW1 A;  1IKW B;  1BQM B;  1OYD A;  4ED6 A;  3JAM Y;  1RAA B;  1Y11 A;  3MM8 A;  2HHS A;  1RHJ B;  1IBM J;  1HNV B;  3RBX A;  3QT8 A;  4PG7 A;  2PT0 A;  4FYY B;  4AL6 A;  2XMW A;  2VF3 A;  3RU0 A;  1OMS A;  5IM0 B;  4GVB B;  4ZPV R;  2JA5 K;  1SL1 A;  8RUC A;  3CPW R;  2CQH A;  2VBX A;  2E2I K;  4PXE A;  1X5T A;  3FCH A;  1VFJ A;  3SQO P;  1IXK A;  4P2F A;  4CO1 A;  2WVF A;  4DR2 J;  1FFS B;  4Q0B A;  2A6H A;  1S12 A;  3P4U B;  5C25 A;  2VDI A;  2AJ4 A;  1FKA F;  2VBZ A;  2ZVS A;  3BV8 A;  1XEZ A;  5IM0 A;  3VGV A;  2GVZ A;  1KDN A;  2YBV A;  2XLI A;  2DR8 A;  2PMW A;  3DOK A;  3KDO A;  2DGQ A;  3DNC A;  3WBZ A;  3CME S;  1EKS A;  1K1S A;  2GMH A;  2QMX A;  2ZUE A;  2EFG A;  4ZPB A;  1HNZ F;  1MMD A;  7FD1 A;  3CT9 A;  3GR1 A;  1ZBS A;  2IMO A;  2MPU A;  3HKZ D;  1CBK A;  5KFO A;  5HK4 A;  2E9T A;  1XTZ A;  3VAF A;  3K8W A;  1TMJ A;  1PCA A;  3MMB B;  3GTL A;  4DL0 C;  4KC6 A;  1GMW D;  1JLG A;  3C6T B;  4ZVH A;  2LQ8 A;  3PW0 A;  3OFG A;  4RBU A;  2AYE A;  2Y0B B;  4ECZ A;  2GGP B;  3IWN C;  4KTQ A;  3HOU K;  3KK3 B;  2HSE B;  4Y7N C;  2KHC A;  1W2I A;  1RAG B;  2DHH A;  1WOO A;  2R92 C;  4HL9 A;  4Y2K A;  4BWJ A;  3AOD A;  2A6M A;  2OPR B;  2W01 A;  4OIN A;  2Q1L A;  2J8S A;  3KK1 B;  2N7C A;  5D4O A;  1KNZ A;  1OWX A;  2WOM B;  3M32 A;  4BC9 A;  2OUG A;  2EK1 A;  4U8Y A;  5J1P A;  1UVL A;  3RAQ A;  3I87 A;  4C8N A;  2D74 B;  4Y3C A;  3VQT A;  4FBU A;  4I2P B;  2H4W B;  4OMF G;  1X4F A;  4JI2 F;  2M0G B;  2LQ5 A;  3Q8S B;  4OI0 A;  5CYJ A;  2JJ4 D;  1PJ5 A;  2HQC A;  3H2V E;  2RQ4 A;  3VQS A;  1HWK A;  5GAG I;  2YNF B;  1U2C A;  2YQ1 A;  3S2D C;  1ZYQ A;  2DHS A;  1CEZ A;  3PO3 K;  2WB4 A;  5FJ8 K;  4C3J K;  4CNZ A;  3GEE A;  4F2S A;  4F0K A;  4ED0 A;  3CC4 S;  2B5J B;  4W98 A;  1X7V A;  3NGK A;  2DH8 A;  4WBF A;  3HFV A;  3I32 A;  2VDH A;  5IXU A;  2FLN A;  3P45 B;  4TXS A;  1U1O A;  3M1V A;  2NVQ K;  1A0O B;  3SZ2 A;  4X4T A;  4EBD A;  4L3N A;  3CJ4 A;  3M2U A;  1UVI A;  2W9C A;  1YJR A;  1TWH A;  4YFX A;  1J6V A;  3OFF A;  1GXU A;  1S1X A;  3UDE A;  2FIU A;  3MUM P;  1KOO A;  3CAG A;  3EZ5 A;  2F63 A;  3L3C A;  5HN0 A;  3T1Y J;  2B9E A;  4OI1 A;  2ZDP A;  3HI9 A;  4ZPW R;  4DV6 J;  4QIG A;  3W5X A;  3TQE A;  3SCJ E;  4LSN A;  2IDL A;  4X4N A;  3MPW A;  2WTF A;  2CQ2 A;  1PIE A;  4ZPC A;  1Z2L A;  3LPE A;  2Z2Y B;  1U8S A;  4CQ1 A;  3K89 A;  2A10 A;  2R7Q A;  1HMV B;  5HP1 A;  1XZP B;  4Y2I A;  4Y0F A;  4DL2 A;  2DH9 A;  2OPS B;  1X4A A;  5B0B A;  2DO0 A;  4OX9 J;  4J9S A;  3IR7 B;  1N48 A;  2C2M B;  1C4A A;  1TL5 A;  2VUM C;  2HIQ A;  1TK0 A;  3QWP A;  2Z8Q A;  4USJ C;  5J1E A;  2XZW A;  3KLG B;  4OJH A;  2NUU G;  3UPF A;  3M9O B;  2O66 A;  3M2R B;  5CJ9 A;  4YB5 A;  3GTO K;  3AJ2 A;  5D4P A;  3MR5 A;  3JSM A;  2H65 B;  1TWC C;  1HPZ A;  2BKP A;  4OIO A;  2J9D A;  3S16 K;  3HO1 A;  1IM4 A; 
#chains in the Genus database with same CATH homology
 3GEI A;  1WOO A;  4P9S A;  1WOP A;  3A8I A;  3A8J A;  1XZQ B;  3GEH A;  3TTG A;  2GAG C;  1XZQ A;  1XZP B;  1YX2 A;  1PJ6 A;  3GEE A;  3A8K A;  1WOR A;  1PJ7 A;  3AD8 C;  3TFJ A;  3AD9 C;  1VLO A;  2GAH C;  1V5V A;  3ADA C;  1X31 C;  1PJ5 A;  4PAA A;  3TFI A;  1WSV A;  3AD7 C;  1WOS A;  3TFH A;  3GIR A;  1WSR A;  1XZP A;  3GSI A;  5L46 A;  1VRQ C;  4PAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...