1VRQC

Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sarcosine oxidase alpha subunit
publication title Crystal structure of heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 50
structure length 195
sequence length 195
ec nomenclature ec 1.5.3.1: Sarcosine oxidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 1vrqC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1vrqC01
1WORA 3GEEA 5L46A 1WOOA 2GAGC 3GSIA 4PAAA 3TFIA 3ADAC 4PABA 3A8IA 3TFHA 3GIRA 3AD9C 1V5VA 1VRQC 1PJ5A 2GAHC 3GEHA 3TFJA 1X31C 1VLOA 1YX2A 3AD8C 3A8JA 1WOSA 1XZPA 1PJ6A 1XZPB 3TTGA 1WOPA 1XZQA 1WSVA 3AD7C 3GEIA 1WSRA 1XZQB 1PJ7A 3A8KA 4P9SA
chains in the Genus database with same CATH superfamily
3CCLS 3CCWA 4JI0F 4AL6A 1HQMA 1SUQB 3L95X 2VONA 4OHXA 4F4AA 5JMNA 4B3OB 4HT7A 4DR7F 1F5CA 4ZVQB 1Y1VK 2AJQA 2XO6A 3R7NB 4B3RJ 2H5IB 2HQFA 2XO7A 2LEAA 1GQEA 3JSMB 3JXOA 1JLBB 2X1BA 1D8YA 2AYGA 2CJYB 1M5VC 4W90B 4KGZB 4L72B 2R92K 2JA6K 3GTLK 1Q53A 4YB1P 4URSA 3EZUA 1PG5B 3G6YA 3BF4A 1FDBA 3TX8A 3DOKB 1FCAA 4UQTA 2WW8A 3GR1A 2EFPA 2OEKA 5A6WA 3NNAA 1FVSA 4C11A 2NVYA 1JOEA 1LFPA 3GTGK 2IRXA 1SFOK 4ITSA 5KFAA 4IOBA 2GCFA 4ZCIA 2CPEA 4A8FA 2R8JA 4A46A 1PC5A 3D6HB 2PMHA 5A8RA 4ZPVR 4QR0A 1NK7A 1T8EA 3ADAC 2CWKA 3CC4S 3DDIA 1LWXA 1NJIT 3N0BA 3SSSA 3QO9B 3QGHA 2E9ZA 4C8NA 3SV4A 1G51A 3QRQA 2LQ8A 4Z7CA 5CHCB 3FZ2A 4P52A 4WKRA 3AH6A 3VVTA 1HNIA 1JLFA 3MEGB 4GVLA 3HJVA 5KFTA 1Q7YT 3ILIA 1U47A 1JJHA 3C6UA 2IJNA 4OZNA 4W92B 2CPZA 1ZAWA 3DMJA 1TK0A 3BBFA 3K58A 2K7KA 3W62A 2ASDA 2CPJA 2BQRA 4Q4ZA 1UPPA 4CT9A 1S1TA 2K8GA 1PJ6A 5GADU 1R0BG 1K83C 3AY0A 1TKXA 1RAHB 3S1MK 3HD2A 3GJRB 3LP1A 4BBSC 4CNZA 3UVJB 5ETRA 4PWUA 4CH1A 3MMAA 3SI8A 3G82A 4NRTA 3DLKB 4J9PA 2VG5A 1LWFB 3P8BB 1UFLA 1RAIB 4D3GA 1WEYA 3NS5A 4DV3J 2YXLA 5AXKA 4KN7A 4DPWA 3V4IB 3AB4B 4ECSA 1SVDA 5HI7A 3G87A 1G3OA 2OPQA 1PGZA 1RT2B 2O5JA 2ZKUA 3M3YK 2HHHF 3GTJK 4AYBD 2IFXA 3W60A 2U1AA 1YRUA 5IT4A 4H4OB 1IBKF 3G4CA 1T95A 1WCMC 1NDLA 1YJWS 2DNKA 1LW2B 1LWCA 1HI8A 3K5NA 1O2FB 1H0HB 4BLAA 5G0RB 5CHPA 3BSOA 5F0UA 1BY9A 1VC0A 2F8EX 5F8MA 3D0IE 2R8HA 3PJ9A 1VQ6S 3DOMB 2VFTA 3W2VB 3QRPA 3ISZA 4BBRC 5C2CA 3EQLA 4OHVA 3JSRA 3VAFA 5KOXA 1RJJA 3R3TA 2BW7A 4IKAA 1PJ7A 4EWTA 3HKZL 4P7VA 3RAQA 1NHUA 3T6BA 3T1YF 1Z2ZA 1RTIB 5EUHA 5F0WA 2FHJD 4Y2KA 1U1MA 5GADI 5ETNA 3E3XA 1FKPB 3TUIC 1BLUA 2HNYB 5J2MA 2OEJA 3S15K 4BXXC 4OJGA 1KOHA 4HI1A 5E41A 3GTQA 3I55S 4OHWA 2WVFA 1PO6A 4DX7A 2YH1A 3M8YA 1D0EA 1RAAB 2NYIA 3S2HK 1A0OB 3T00A 3UE2A 4UY85 1AUSL 1RADB 2XYGB 2UXBJ 2DD8S 2V4JB 3I4HX 3M30A 4YB5A 1HBOA 1RWPB 3PX0A 3UCUP 3BQ0A 2MKCA 4DFJA 2Y0SL 2ILZA 3SFUA 4EYHB 4MTPA 4DR6J 2EXUA 2M2BA 3SZZA 4X65F 3ITHA 1F9FA 1KHVA 4TQSA 4GZYA 2H9ZA 3LP2B 1VDHA 2MSTA 4RBVA 1S76D 2I8EA 2C2NA 2MB0B 3HOXC 3C8YA 4YQWA 2DR9A 1EB0A 4C8YA 1Q5YA 3V6KA 4O3NA 3HVRA 1UEUA 3GLJA 2HFUA 2A6EA 4DV2J 3FJ2A 3ULHA 3G8QA 4I6WA 2RILA 5IOLA 1NZ8A 3QAEA 2W4DA 5BYSA 2ZH8A 3CCVS 5KFMA 3NNCA 1HPZA 2W01A 2LU1A 2HBQB 3QYYA 4TXSA 2IM3A 1RDRA 2DRDA 2OTLS 2AZ1A 3ET6B 4M1KA 1HBNA 2XMWA 1UFKA 3CQZA 2E5JA 4CRJA 4ER8A 3CDWA 3MFHA 2J9CA 3HHLC 2FLNA 4A8QA 1BMQB 2JA5C 3R7BB 1WEZA 4IOAQ 3W9JA 5T41A 1R0CB 2QA4S 2Q79A 4A8SA 4LBIA 1ITPA 4KY3A 4A3GC 2DNMA 4DSIA 2K1RB 4TU7A 4U9RA 3UN3A 5F3TA 4PXDA 2CZ4A 3H5XA 2L41A 1KONA 1IKWA 1FTRA 1CJUB 3IXQA 4CYUA 1WF1A 4OYIA 3L4BC 4N47A 5KFFA 4C98A 1TKDA 2QFJA 2QLFB 3OR2B 2HLUA 2HBRB 5HAOA 5I42B 3QNWB 4J9QA 2HK3A 1OMSA 3CCJS 2BABA 4JI4J 1SIZA 1HHTP 3NEKA 3I0SA 2MLZA 2BR0A 5D78A 5AE1A 3HHLD 1SMYA 1BJTA 3G2XA 5KT3A 3Q8VA 3QIPB 2HURA 3LO3A 1S10A 4MK8A 1UPMB 2OAUA 1NSPA 5LMNF 4CZCA 2F5GA 3OL6A 4P73A 2CQGA 5B08A 2N4DA 3IBCB 2F7VA 3E01B 4J9RA 2VUMK 2B7BB 4MMOA 1YDLA 3EDQB 3VQTA 4OYOA 3KK3A 4CM0A 4RW7A 2HMIA 3MECA 5HN0A 2RQMA 2HNDB 3M1VB 4K4YA 4ZHRB 4ANCA 2HHWA 3O1LA 4ECYA 5IZHA 1RT4B 3KJVB 4ICLA 2ZOGA 5I3UA 2R93K 4USVA 3R97A 1TL7A 2V8DA 4NLWA 1NU4A 1QD1A 2B63K 2MDAA 4A93K 4A48A 1RBLA 4RO0A 2G1HA 1C0TA 1TL5A 2NSBA 3FBCA 2FZCB 3RBZA 2B9YA 2FVQA 3NS7B 2VA3A 1M1KT 3QT8A 5F9LA 4IUFA 3ZZUA 3LF0A 4MFBA 4X66J 4QPTA 2X3GA 3CE8A 1H38A 1NBEB 2YKOA 1S12A 4DUZF 1OYDA 5EWGA 2M8DB 2LA4A 2QFIA 5E3AA 5L1LA 2R7SA 1FNXH 5DDQC 3C16A 3SV3A 1VLYA 4DZDA 4X4UA 2VKZG 3IS9B 1UJ4A 1VIXA 4DV4F 4RJVA 4DV3F 3MPYA 4PQUB 2PHCB 2DBBA 2K2PA 3KLHB 3MM9A 2EC2A 2A69A 5MLCV 5GAHU 3M7VA 4F50A 1K0VA 3CPWR 1LK7A 1XERA 4CDIA 2GO9A 4J9SA 1N32J 3QBCA 4IQMA 4HKQA 1CJVB 4AL7A 2D41A 5CH7B 1H73A 1FRLA 2CQBA 3BPSP 4CH7A 1M5KC 5IT9Y 2IC3A 1EQMA 4ES3A 1D8ZA 3CDEA 4QIEA 1HQUA 3PO2K 3J81Y 4WE1A 1VGXA 1QAYA 4RW6B 3VCDA 4ILMA 3HFVA 4RNNA 3MMCB 4LR2A 1TWCC 3DLGB 1U2CA 3KG1A 1MMLA 4A3FK 2X7IA 1I50A 2R2RA 4WYLA 5C5JA 4Y52K 2QA4G 2R8GA 4X64J 4ECQA 2XS7A 4O2DA 3S1TA 4OMFG 2C2RA 1KVJA 1NZAA 3I32A 3SBMA 2FLPA 4G1PA 1B0PA 5BJRA 3NCPA 5AJ3F 1JQGA 3MM6B 2JLGA 1K47A 3JB9k 2IA6A 4U6PA 1S57A 2NVYK 5T14A 4QBUA 3CIZA 4RUCA 2IAJB 1YQHA 3FBBA 1S6QB 3CCMS 1XXBA 5ETOA 2DRBA 1U2RA 1SIWB 2CUYA 2MKHA 5KFVA 3FVYA 4KFBB 4WYWA 4YR2A 4WP3A 2VG7B 4I2QB 3CCQS 5H1SV 3B8HA 3KLIA 4K2JA 1VYAA 3MR2A 1BQMB 3Q24A 3V6HA 4RL1A 1WNEA 4ID5A 4DL7A 5IYCK 4CLWA 3CCRS 3L4JA 1S9EA 2KL8A 1FVQA 1NNDA 3R5GA 1ZQ1C 1Y1WA 4ELTA 3THTA 1XZQA 3DM2B 5DG8A 1KS2A 1U1RA 2HPUA 2GW8A 4AQYJ 4P6QA 2EVZA 3LP0A 3P3DA 2WOMB 1UEVA 2FQTA 2AJ2A 4KATA 4O23A 1XMQJ 4NRUA 5CD4A 4DLGA 3TX0A 1R8BA 2YNHA 4DV7J 4B9NA 1O24A 2YQ1A 4KM9A 2DCLA 5C4XK 1HNZF 4YHHJ 2LQ9A 3V4GA 3X1LB 3I5AA 4FYDA 1TAQA 1YVFA 4XAKA 5D0HA 4IG0A 2Y0BB 3M6WA 3OREA 2N7YA 1C1CA 1CJKA 4PUOA 4MK7A 3OVBA 4GTEA 5D0RA 2LU2A 1I6HK 5KFOA 2JJ4D 1PYTA 3DI6A 4J90A 2ZJPQ 2YNFB 2OMLA 1ZYQA 4E0DA 3I96A 1TWFC 5DZ7A 3FCWA 4Y6IA 4NLUA 2FJEB 4LF9F 1QE1A 1M90T 2AYMA 4G7ZA 2ZKTA 4QIVA 3OEPA 3M2RB 1I1GA 3D2WA 5DQHA 2Q6BA 2QL7B 1NDKA 4PG7A 2GIRA 3A3PB 4E2FB 4KBIA 3AQPA 4MYTA 1R8HA 3K0JA 4RU9A 4OZ0A 3RB3A 4UT4A 2AT1B 3BGFA 2VBYA 3DGPB 4NXMF 1CC7A 3HOZK 3OL8A 5K8NA 4TU8A 3CULA 3M6VA 3PKMA 3K5OA 1RKIA 4CLZA 4IO1A 1GNKA 2YNGB 4OYAA 1MU2B 3FSXA 4NASA 1TTHB 1O2AA 1JLGB 3NKYA 3HKWA 4DSEA 5L9XA 3HOYK 2B56A 2KYXA 1JLCB 3W2WB 4JYAJ 2XBPA 1AZSB 4N8OA 4NLGA 2GIQA 2ZHAA 1IM6A 1R6YA 4LT6A 2HHXA 2R7VA 1N0UA 1I6VA 3GQCA 3GTQK 3NCRA 4WIIA 1WC1A 1R9TA 2V8HA 3MM5A 1J5OA 2A6HA 3EZ5A 1S99A 3CCUS 4KV8B 1A9NB 2MZRA 3Q8SB 2ZH5A 2DEIA 1VK8A 2QV6A 1DQ9A 1Y3JA 1UWBA 2KYZA 2MZJA 1FEEA 2O67A 1E6VB 3N28A 3D3CJ 4USKA 2HYIB 3SCLE 3B78A 1N88A 1Z2LA 2IBKA 3CDAA 4FM9A 2BJ7A 4EBCA 4XO0A 1YBTA 2C2EA 1RWUA 2B51A 1UAWA 4BY7K 4X4NA 1T94A 3QMQA 4U8YA 5KFPA 3MR6A 4X4OA 2QLWA 3NRBA 4F2RA 1JXVA 4PZVA 5B0EA 2ROEA 2B5JA 4TN2A 4DS5A 2B0GA 2MKJA 5D3GA 1BUXA 5IP7C 1VQSA 4ED8A 3P49B 2XYHB 4PWWA 5IT9U 2GHPA 2VQFF 4OI4A 1TWAA 1M5OC 3J81U 3BKTA 2LKZA 3CQZK 1R3NA 2R2UA 3EUNA 8RUCA 2B6AA 4YR3A 4DL3A 2BE5A 2J0QD 3QJJA 3QLHB 4LFCJ 3ZTRA 3S7RA 3H2LA 2W2NP 3EGNA 4JI5F 4UOHA 1PBAA 2P5MA 1Q86T 2E2JC 4X64F 1DCHA 2KHDA 1TMJA 2MGZA 3DGVA 2EFOA 1WIHA 3OSPA 2OO4A 2IY5B 2HIYA 4LF6J 1YSJA 3KNAA 4M5GA 1NB2A 2ADCA 5F8NA 3RGIA 1ZM9A 4ZIVA 4TY8A 3HI9A 1RUSA 1H74A 2CNOB 1LKZA 1TVRA 3G96A 2DY9A 2E5IA 1FFWB 1ZYRA 4HR2A 1HNWJ 3GONA 2D7SA 5K20B 5KG0A 1H98A 4F8RA 3H0GA 5DG7A 4DJBA 1NHKL 4ZDNA 4FXVA 4QR1A 2V8GA 4CIOA 1SI9A 3AODA 3OPFA 1Q8LA 4ED3A 5KTQA 3SCKE 3TO8A 4DL2A 3D1HA 5LOQA 1IBMJ 4Y7NK 4DI6A 3NNHA 3PEJA 3GDZA 2O1PA 1KRPA 1REVA 2B4VA 5IYDK 5A8WB 2CIMA 4EO6A 5CD4H 2IVMA 1KTVA 3T5LA 1X4EA 2FGOA 3D1QA 3NY0A 3H59A 3I9V9 3DRSA 2HZCA 4Q0BA 1NDPA 2MQMA 2LFVA 3RZDC 2YVSA 3R6GB 4GKKJ 3L3CA 3BJYA 3N0VA 5KFXA 2Z2ZA 1HKAA 1LWEB 2GVDA 5DJBA 3QATA 5C3EC 3SCIE 4B02A 5KAKA 5KFLA 5ETSA 2Y8YA 3DC2A 1RHJB 2G0IA 3Q8PB 5ETVA 3SQGA 4LF5J 3A12A 2FVSA 5H9FK 4I0WA 4OIXA 1XXAA 4RUHA 1HQEA 2H4YB 3KUGA 2PSZA 2KN4A 1Y3KA 5TJ3A 4LRDA 5LXRA 2NUHA 4A3CK 4YY3F 3OR1A 4KMHA 3GZ7A 1AYEA 5KFYA 3UR3C 5M5XK 2VH7A 4OI6A 2P9GA 5LJ3Y 1ZS6A 3WX4A 2KWAA 4OIRA 3HXAA 1SJ3P 4PPZA 1VQKS 2DXDA 2BJEA 7AT1B 3HXMA 3SFGA 3LGMA 4U7UK 3IM8A 1T0TV 2KG1A 5HK4A 1J6XA 4Q5VA 5KT7A 3ZZRA 3WC0A 4TY9A 4LR8A 1YITS 1I50K 4B17A 5DGBA 1T11A 5D15A 5DQGA 1R31A 3CJQA 5EX3A 4J7CA 5EGYA 4USJC 2B43A 4LJZA 1X4CA 1SKRA 4Y3CA 5IP9K 5C25B 1AXQA 4M5DB 5KT5A 4DDQA 3BH7B 2MZSA 2BEFA 4DOZA 3ZZPA 4K4SA 1FK9A 3TQEA 4LIRA 4MJKA 3EVOA 4K2XA 1J2VA 2C3UA 2CNNB 1NK6A 1J27A 4J9UE 3GCXP 2CZ9A 1N34J 2FHJA 2Z2MA 1RHKB 2ABYA 2J76E 3HPOA 4EBDA 2LP4A 4OYZA 4LSZB 2IM0A 4P5AA 2GAGC 3QGPA 4LMZA 5BR8F 3Q22A 2YNIB 1SUQA 1Y1WK 1SL2A 5L1KA 4B3OA 1TQLA 2KVQE 4I69A 4X4RA 4ZP8A 2PN6A 2JLFA 4HYKA 3FMWA 2BJ1A 2P9CA 3U27A 1Y0HA 3JSMA 4OQJA 1EZZB 3MUMP 1JLBA 3KHLA 2ZEJA 2RHSB 3AH5A 4BY1K 1WDTA 4JI1F 4K0KJ 1VQ4S 2J8AA 3DLEB 1BQNB 2EK1A 2O3DA 2FHOB 2ZBPA 3PZPA 2DNZA 1G2EA 4RPFA 1FRHA 2GAHC 2UUBJ 4GO7X 5F8IA 4Q2LA 1RWKB 4C3KA 3DOKA 2DO0A 1DD5A 1B4BA 4DSLA 2MKKA 5HBMB 1L3TA 5D4LA 3I4MK 3QT6A 3HCXA 2OTJS 3OTDA 3T6JA 2XS2A 2MTLA 4ILDA 1PYOB 5IV4A 3M6UA 4OHYA 3GV7B 2JEGA 1S49A 1VQPS 3V6DB 3N4WA 1IQ0A 2ZFHA 4RW4B 4ED6A 4CNYA 1E6YB 1RWOB 2BVZA 3POTB 2WCXA 4C3LA 1XJWB 1ZM2A 3LH2S 3QO9A 3MCMA 3F0NA 2R8IA 4Y00A 4HL9A 5AXNA 2E2HC 4C3MA 4C0OC 4DPYA 2E2IA 1TWHA 2JFDA 4CO4A 4HHHA 3Q86A 3MEGA 5K8PA 3VV2B 2QTWA 1H6KX 2RSQA 3GEHA 5DDOC 1RHRB 3FEXB 1HWJA 2W7PA 3K59A 1QVFR 3FCHA 4DR2F 2NCKL 1KTQA 2I38A 2EFQA 2D9PA 1WOOA 1GMUA 3RBEA 5MAOA 3D4JA 1ZAVA 2XTJP 1MW7A 3GFHA 2V4RA 4OYPA 4KYZA 3ONQA 3I4NK 3HT0A 5M3FK 4A8WA 3NP5A 4BC9A 2CKWA 2FHMA 3PHEA 4LVOP 4H4MB 4HHJA 4LLGA 1JX4A 4EGLA 3UVJA 2JC0A 4LF8J 3PDNA 1DLOB 3SMZA 3DLKA 5AXLA 1LWFA 1RWWB 1NH8A 2I9SA 4IDKB 3VAKA 1OYEA 1TU0B 4UZCA 4R25A 1DBDA 4ZCMA 3MZIA 3V4IA 4A3IC 2XLKA 1IBMF 4KGXB 2AEJA 1RT2A 4ZVOB 2GX8A 1BWVA 3FRZA 2VA2A 3OQ2A 1R9TK 3ZTOA 2XULA 3JTOA 1WUUA 1WKKA 1EX8A 1OS5A 3E51A 5IWAJ 1UJ5A 3EM1A 1VQYA 2R7UA 2D3UA 2C3YA 3A13A 2QMUB 4KMUA 1SJFA 1UVKA 4H4OA 1S6UA 2ZNZA 2FYXA 1LW2A 4LFAJ 5G0RA 5FLMK 2J6UA 5HATA 2LMIA 1SH2A 1DFDA 5ITHA 1ZZFA 4KTQA 1OSDA 1U0HB 4D3HA 3DOMA 4K59A 2RU3A 4J9LA 4C8OA 2A0FB 1RTZA 3W2VA 4LRAA 1B7FA 3T02A 3ENQA 1RWNB 4LF5F 2POKA 4IFVB 2JLEA 3M8ZA 2HRTA 2A10A 2RDIA 1ZBTA 1EI6A 4PRFA 3F56A 1MMDA 1VH2A 2OD4A 2XSJB 3FRYA 3RRKA 3HHKA 2ZVIA 3QSYB 4DQRA 2MQNA 2VDIA 4FVMA 4P9SA 2FJBB 1RU0A 2VASA 3HFZB 3DRPB 1RTIA 3DRYA 3BR8A 4B3MJ 2IJRA 4A4JA 1IKXB 1MSWD 4AXIA 4QWAA 3KDOA 1HYSB 4DXLA 4XLNA 1TWAK 1FKPA 4NWBA 4M5HA 4B9UA 4A8KA 3TW0A 2HNYA 5LL6d 1DCOA 1WF0A 1SKSA 1N33J 2FQQB 2GJFA 1V5VA 1YJNS 4ED2A 2RT3A 1YBUA 5D77A 4ZVHA 2COLA 2XMMA 2V4JA 1FJGJ 2AP6A 5B0BA 1BQXA 2FZGB 2JL9A 4DU7A 3RZOC 1U0SA 1OQ6A 3PRVA 3QZ8A 1Z1ZA 3WIUA 2VPYB 3S01A 1I94J 3K7RA 4ZVRB 1EQ0A 5SZTA 3LP2A 5D4PA 2QE5A 2D3ZA 3M32B 1Y9OA 1CG2A 1V3ZA 1F5BA 1KWMA 2LQJA 4LK0A 1YHQS 2NUUG 3TJ9A 1SJRA 2CADA 2C2DA 1U49A 3H0GK 3US5A 1HLWA 3W9HA 2J7KA 2HRYA 3TEHB 1NMEB 2CPFA 4FS2A 4DR4J 4OX8A 1XNRF 4KMDA 4S0MA 3OHBA 3CJ8A 4RLEA 3WDOA 1ZVUA 4NYOA 3EXYA 1SQGA 2RIJA 1Y5NB 4OIPA 1PIEA 1U7LA 2E7VA 2AJ0A 4TYAA 4A3EC 5GAEU 4F4XA 3AJDA 4PAAA 1S0OA 3BREA 5L1JA 5CJ9A 2DHSA 4R0EA 3ET6A 4FF1A 3KJQB 2DPIA 1U6BA 1GXUA 1BD6A 5T7LB 4XCHA 1D1UA 4UZBA 2DR5A 3J7YI 3ETMA 4OX6A 1NSKL 2K1RA 1VRTB 2QMWA 2E1RA 1TL3B 1KR4A 1Y4ZB 2KTQA 1CJUA 2CJKA 3FUYA 3P96A 2G2ZA 2BM0A 3OR2A 5I42A 2RNEA 2XG8A 1M5PC 4DG1B 2ZFZA 2WONB 2NVXA 3D67A 2FQOA 2CG4A 2WBMA 4IH7A 5IS2A 4DV0J 3M6XA 3QIPA 4IRDA 2J5AA 2YWHA 4OHZA 4M5JA 3H25A 3ENVA 1NRKA 1C4AA 2EBBA 4XPEA 2H51B 2NVTK 2BJ9A 3J81j 2NPFA 1FWKA 4BDPA 1QUVA 2HLTA 3E01A 4BLGA 3EJMA 2PPBA 2VOOA 1VS3A 1S1VB 3DN9A 4I56A 2ATCB 4TQRA 3GTMC 1UZDA 2LQBA 5K9FA 1N56A 1Z4UA 3DRRB 3FEYB 2HNDA 3M1VA 2WZ1A 4ZHRA 4BBSK 3GTOC 2NQPA 4JI8F 1PKUA 1RHUB 2HFOA 1RT4A 3KJVA 2OFHX 4UTGA 4FXDA 2D6FC 5GAEI 1Y1VC 3AT1B 5M5WK 2MQQA 1SPBP 3Q23A 1H7WA 2ZOMA 1TUWA 3P5TL 5D0GA 2F4VF 3TAMB 2RDDA 4NOHA 3LA0A 3RB0A 5HROB 4NZ0A 2R92C 3GTLC 3E2EA 4ECZA 2L9WA 4USIA 3BO4A 3C2PA 5DDPC 4X2BA 2ZBQA 1T03B 1AW0A 4LF8F 3QGIA 4KHRA 1F3FA 1DTQB 3CVKA 5HANA 2LXUA 1B99A 1TWFA 4G0VA 3IS9A 2QZ8A 4YN3B 4A3LK 2PA8L 1JNZB 2B4PA 4ILRA 4PQUA 4KN4A 4DPUA 4FZBA 3KLHA 3M9MB 2XCRB 3E8OA 5LM7E 2FLLA 2DR8A 1TMMA 6AT1B 3G6VA 4P7TA 1SFOC 2YBVA 3SEOA 4JV5F 3CC2S 2BX6A 5E33A 2FC9A 1CJVA 2Z0GA 3OSNA 2W9AA 2F1FA 4BBRK 4JOUA 3RB6A 1UVJA 3OTOJ 4F67A 1MLAA 2UVUA 1RWVB 4RW6A 2J9DE 1KNZA 3I31A 1QTNB 5E7OB 3PKYA 3W5ZA 3R1LA 4LRCA 3MMCA 5DG9A 1EHWA 3DLGA 3AOBA 4DN9A 1S6PB 3OUYB 1S72S 2YU9A 3EVWA 5E5NA 3J7Z5 3UQSA 2A68A 3B6BA 4P2SA 2BUNA 1U1PA 3PTWA 1ZH5A 5DM6Q 2PEHA 2FIUA 3AJ1A 1O2BA 4BXXK 2DR7A 4V19X 1KD1T 2MLYA 4WFZA 4JV0A 3TANA 2ZM6F 3KHGA 3QX3A 5M2PA 2ASJA 5FJ8K 3MM6A 3TJ8A 1LOUA 1YIJS 2OGUA 2IAJA 1S6QA 2VD3A 4NZ6A 1QDUB 4WIQA 1B70B 3R5DA 4KFBA 1PYSB 4K4UA 4ED5A 2WVEA 1ZA2B 4DCOB 3UCZP 1Q95G 2VG7A 4I2QA 2BM1A 2OPRB 4O3QA 3LTOA 1RSCA 3BGLA 4AT1B 4XPCA 1BQMA 4RBUA 1XC9A 3W64A 3FFIB 2CQPA 2HIQA 2LEPA 3HOXK 1SCJB 3PIOQ 2DHXA 1RYSA 2E2IK 2Y3PA 1TWHK 2PMZL 3RW6A 4DN0A 2YX7A 4FS1A 4JI7F 3RJMB 4ZITA 2CNKB 3NAIA 1XMOF 3DM2A 5KT2A 3GIJA 1Q79A 3CJ5A 3CJ4A 1CS4B 1R8PA 4WJBA 1HW8A 1AB8A 4CTAB 3M3YC 3TRGA 2HVIA 3GTJC 1RBOB 1RI7A 1O8BA 5KFCA 1WDDA 3HOVK 1H72C 3CXCR 3S6EA 1JKHB 1FDNA 4K4ZA 2WOMA 1R6VA 3U1MA 1MG7A 2LDYA 3TR5A 4K4WA 4KPCA 4JI6F 1WORA 4AL5A 3TNVA 3K5MA 1I3QA 5TMFA 1S0NA 1IJFB 3FDSA 4NCGB 1OPIA 4DU8A 3FK4A 2P8IA 1N5SA 2VC1A 2G2OA 3C19A 4WPAA 4LF4J 3NGDA 1ROFA 3IGVA 2HQ3A 3GR0A 3O6QA 4IG3B 1F60B 1JLAB 1QJHA 2M3DA 4A3GK 4G6VB 3QWUA 2V2KA 3GIMA 3OPKA 2XMVA 2ADBA 4P72A 1T05B 2L08A 4KH0B 3CDBA 3CJTA 4YR0A 1D9DA 4A3BK 3UDLA 2HS0A 4JI0J 3FQLA 4IYQA 4B9TA 4C3IK 2YKQA 1UVLA 3VHQA 4QWEA 2YNFA 2J9EA 3EE3A 4B9VA 3TI0A 1S4EA 3MD3A 2W2OP 4MAKA 1RTDB 3M2RA 4CQ1A 4XK8C 3HK2A 4C2MC 3AQOA 4PCQA 1RYRA 2Z8QA 5FJ4A 2NXJA 2CQHA 3S2HC 5F8LA 3RB4A 4L74A 3IMQJ 2K3KA 3CIMA 2JEJA 2E5GA 1P8GA 4LFBF 3GG1A 3DGPA 4FPRA 2CQ0A 1DTTB 3GILA 2I2YA 2KO1A 1LFWA 3GEEA 2H48B 5K5MA 4K7QA 1EARA 1GH8A 2YTCA 2KRRA 5C42B 4O3PA 3SDEB 2YNGA 1MU2A 1B0TA 2NZ4A 1JLGA 5LSLA 2FC8A 3UI3A 2V5HG 1TK8A 3GCWP 2PO4A 3F44A 1JLCA 2KM8B 3W2WA 2ZHBA 1AZSA 4F02A 2R2SA 1AFIA 3LAPA 5KG7A 1L3UA 2FJAB 4YFUA 2JVOA 3NWGA 2LYVA 2PA8D 1S1XB 4NEZA 4DS4A 2B4UA 4M8LA 3KG0A 1S5ZA 3RZAA 1OY9A 4KT0C 1IKVB 1N8RT 4KV8A 4J3NA 4LF2A 2RS2A 2PFDA 3BKFA 1ZM3A 1VQLS 4F2SA 4ZVSB 4EU0A 2QA1A 2W9BB 4IFYB 4GMKA 2Y1RI 1WC6A 4N41A 3PNIA 1KFDA 3W7BA 3C66A 5JVGQ 3S0XA 2YWKA 1E6VA 3THVA 1X9WA 1FKOB 1T9XA 4QW9A 4DQQA 4G0UA 3RAXA 4ZP7A 4GRSA 4MIBA 2BXJA 1NSAA 4PXBA 1WI8A 2J0WA 1EP4A 4A3MK 2UXCF 1RT3B 1USOA 1X4DA 4ZPCA 3ZFVA 4ZKAA 1NPPA 1F2HA 2G1DA 4RNOA 2HHPA 4NCAA 4RW8B 4X4TA 2XCPA 2MSSA 3PYFA 1Q16B 1B4AA 4H4KC 5F8GA 2Y8WA 2AGQA 2HQCA 3W5XA 1YZ6A 1YJVA 2VPWB 1FFSB 1U1OA 1V5IB 4DL5A 2B9WA 2VZ9A 2RU9A 5B09A 5ETQA 4OYWA 2BDPA 3R5BA 1BDFA 1IBKJ 3GYNA 1YJUA 1JK9B 3S8SA 3BR9A 3WODA 3QLHA 3GIIA 3BV8A 3RYLA 2O01C 3C14B 3AA8A 1BWEA 2ROPA 1UJ6A 1LNQA 2W8LA 1VBYA 3BPDA 5LT5A 2MXYA 3GTKC 1QY7A 2R93C 4HLBA 4KQZA 4EMDA 1DQ8A 5KG6A 5D4DA 3T1HJ 3GTPC 2PMZD 3VAJA 2B63C 5C44K 4FDFA 2ALZA 1RZMA 2OJ3A 4C3JK 1C1BB 4ZVEA 5M5YK 4QZVB 2H1YA 5C24B 1FEHA 3CMAS 5L8RC 1TKZB 3T41A 2NVXK 3QGGA 4PQAA 2FD2A 1Q4RA 2LA6A 3SYZA 1C2PA 4BS2A 1XPPA 2HS3A 5AXMA 2Z2YB 3HHEA 3T1YJ 4CH0S 3IR7B 4X62F 2PDAA 4PWDB 2G4BA 3TAQA 2WAQL 1KKHA 3BGRB 2MY7A 3T5JA 3HT3A 1GX6A 1SJ4P 4P71A 2EFVA 2XLIA 1Y00A 4Z37A 2E9RX 1WJ9A 3GYXB 4ZLJA 2NPIA 2P6SA 4O3SA 3KLGB 2CVIA 2ROGA 3QZ7A 5A8WA 1UW4A 1AT1B 4WJ4A 1F5AA 4KAWX 1FF2A 2GGPB 3LQVA 2V69A 2AJFE 4EUVA 2ZH1A 3MFIA 3PO2C 2KM8C 5D0EA 2BJDA 3KHHA 3MF5A 1XR5A 4X65J 4C8MA 1DRZA 2K7JA 2F8MA 1S77D 3GG0A 2PI4A 3IO1A 4HT5A 1X4AA 3U7JA 1WTBA 1DJ0A 1J98A 3PY8A 1LWEA 4WILA 2LQ5A 1S97A 4FF3A 4M5KA 4Y52C 2C22A 2QYGA 4CWBA 3EX7B 4JI3F 4KB2A 3DDNA 3IP0A 3NMRA 1TWFK 2E2HA 1YLXA 3W8PA 4KRWA 3GV5B 5DRKA 1JB0C 1NKBA 5JJBA 2VU5A 1NPKA 2OMOA 3LWLA 3OJUA 1J5EF 3TVKA 5C7PA 1FFGB 2JNJA 1ZAXA 5DQIA 3N9UC 2YWFA 1RQ0A 4MKYA 2RRNA 5C4JK 4K8RA 4LF1A 4QWCA 5H9EJ 1RGVA 2VB6A 4KC5A 3GV8B 2JC1A 5I3PA 3L9ZA 4ZP6A 3BP8C 2R7QA 1NDCA 1KN6A 2YX1A 4ETXA 1W2IA 1NCLA 3V81B 4ZN1A 9ATCB 4OZJA 2JA7C 3C3LA 1KBRA 1R7IA 2GMHA 4NLTA 2ZJRQ 4A3KK 4DMZA 2XM3A 3HZEA 3OFHA 4QWDA 1URNA 2YU9K 5KT4A 1BGWA 3TA1A 4UUXA 3S17C 2OLWA 3WHIA 3BP3A 2R7WA 1N6QB 5F3ZA 3LANA 2CPHA 5C25A 4M5DA 3NBPB 2AU0A 1Q0NA 2H3EB 2DGVA 4B9LA 2V6SA 3OVSA 5DZ6A 5KG1A 3PX4A 3JAMY 5J2NB 5KG4A 3HOWK 5J1NA 4J91A 2QLBB 3EXCX 4DX5A 5K14B 4MH8A 2XQCA 4WXWA 4I67A 5L46A 5LMNJ 3KG4A 1IR2A 2JA8K 4DV6F 5C4XC 3CJ3A 3PFOA 4J9MA 1O27A 2VFRA 2RB7A 1UTAA 4WTYA 2HVDA 2W9CA 1AUDA 2VF3A 2YNIA 1W7WA 3V5RA 2CJBA 1H2VZ 2HWTA 3IBFB 5H9FJ 2V9WA 4HVZA 1W2BR 3KWMA 1DQAA 2ZBCA 1I6HC 1QTMA 4M94A 3OFGA 2Q66A 2RQ4A 5ETKA 1TUVA 1S1WB 2L3MA 1ZTWA 2ZUAA 1A7GE 1YG0A 2XNQA 1N52B 2PT0A 1DARA 5IP7K 3GWCA 3DLEA 1I3QK 1BQNA 1HWIA 3MD1A 3PO3C 4FBUA 4ZVGA 2GIFA 3CD6S 3CW2C 4I7FB 4USTA 4DUZJ 3HHLB 1OWXA 1F2GA 4J5OA 3D6TB 1YJ9S 1NO8A 4PG8A 3PYDA 4CT8A 3DYAB 5HBMA 3K8VA 2HMIB 2YKMB 1TUGB 1WACA 1HA1A 4DV4J 2DVIA 2AWZA 3DXBA 3TZYA 4LOWA 3T5KA 1XBWA 3HD1A 2AEMA 3W1YC 3CJ2A 3TUJC 3G4AA 5A6PA 2E2JK 2L48A 4A8OA 3F73A 3H42A 5B0FA 2W4PA 1KP6A 3V6DA 5ETTA 1JNRB 1GFWB 4RW4A 1E6YA 2BKPA 3HULA 2HFVA 3HOYC 2CJQA 1WHWA 1ZM4A 1MN9A 3POTA 4KC6A 1CULB 3IR5B 5CYJA 4I2PB 1KC8T 4K4TA 3H8YA 2BE7D 1NM2A 2DK2A 3TAPA 4EYIB 1GMWD 2VC0A 3VF0B 3CJ0A 4J9OA 5IORA 3BUEA 2RKIB 2WAQD 3CJKB 3Q89A 3T1HF 3MMJA 2BQ3A 3PX6A 1W25A 4I68A 2VQEJ 4M5NA 1VQMS 2HSEB 1Q5VA 4NLRA 4C8ZA 2Z58B 3JQJA 3JSYA 3NLCA 1RAGB 4LRBA 1WC0A 1RB0A 3VGSA 2C2OB 4MYUA 2IM1A 5D4OA 1S9FA 4ANEA 2GS8A 4ZP9A 1U1KA 1QVGR 2QC3A 5AJ3J 3RRHA 3IGNA 3PW7A 4H4MA 3ELHA 4G1QB 4DSJA 4ZLLA 3MCSA 1UVNA 3MPVA 4J9KA 3LALA 2A6OA 2MQLA 4BY7C 1DLOA 2DJWA 4HDGA 1HR0F 1U8SA 2BRLA 1NKCA 1G7CB 2PD1A 4L6V3 5J2QB 1GTEA 5KFWA 2F63A 2HWHA 2Y3YA 5DO2A 3K5LA 3PYEA 2V4QA 1IUJA 1VQNS 4GKJJ 3AXMA 5IQ6A 5C3EK 2I0XA 2JHEA 2DGOA 2F40A 4C45A 1SH3A 4X4VA 2LDIA 3I0RB 3UPFA 1SJ1A 2HGLA 3D54A 3CQZC 3B4MA 3QAUA 2F9JA 2WHOA 2DGSA 3HFKA 3UNYA 1HWLA 2LXIA 4Q8FA 1L3KA 2HAIA 4O4RA 3HSJA 3G4SS 4N5SA 4J9NA 3AD9C 1U0HA 1VQ9S 5TMCA 3VR1A 5KFUA 1V6HA 4UOFA 2XMUA 2XCQA 2LXFA 3AAWB 1K1QA 2CVEA 1UVMA 4IFVA 2E1PA 2E7WA 3BKUA 3SQOP 3R5JB 4NXNF 3GTMA 4OZ1A 3PJXA 2MLXA 3GIRA 2XSJA 3IRXB 4WP8A 1JLQB 5IC6B 1FRXA 2FY1A 1YRTA 1HNZJ 1U1NA 3GTOA 3GFYA 3T01A 2IMOA 2CYYA 3K17A 3AB2B 2C28A 3MAAB 3KXDA 2HQDA 1ACMB 3DRPA 2OPSB 1IQTA 2ZBRA 1OIAA 1FI4A 1IKXA 2XZDB 4JUZA 3MM8B 4W4MA 1HYSA 2C2ZB 3UWTA 5A0YB 2XLJA 4WK1A 1OPZA 1IXKA 1FNOA 3QJPA 3AOAA 4M1XA 3OFFA 2V2ZA 2B4OA 4HH1A 1C0UB 3FKIA 2ZZTA 5J1EB 4LF9J 4FF4A 4Y7NC 1VQ5S 1LW0B 1BXNA 1U24A 3N5BA 2UUAF 2DGUA 2VBWA 5IYDC 1HD0A 1CJTB 5B0DA 4AXJA 3JAMU 2A6MA 4NXMJ 4YDXA 1AFJA 2VJUA 3M32A 4DFPA 3A3OB 4MKBA 4X4PA 2W2MP 1EJ7L 2Z4PA 4GVBB 1FDAA 1RTHB 2QSWA 1UKUA 2V8VA 2ACMA 1PBUA 5IV3A 5IQQA 1I3OB 2X1GA 2FZKB 4ALZA 5F41A 3UDCA 2QJ3A 1NK9A 4TKTA 4DV1F 4LF7F 3R5AA 2CQCA 3ZZOA 1AA1B 3NAHA 3HVWA 2BYCA 4HHUA 2XMAA 4RU2A 4H54A 4DR5F 2H4WB 2R7ZC 2QA2A 2ACYA 4KH1B 2W8KA 1LXJA 1YCLA 5T7LA 2SXLA 4FKYA 4EK2A 3S1RK 3ENWA 4I6AA 2KZMA 5HMWA 1Q8KA 4XTTA 4RZRA 4ELVA 4ZVTB 1VRTA 2GV1A 3PACA 1TL3A 2O5DA 2XMTA 4F04B 5LMUF 2D3OR 1X8DA 4DUYF 5EGHA 1I50C 5CYMB 2JEFA 3PIPQ 2IM2A 5JFEA 4RNMA 4PXCA 3JS9A 3GE9A 4K50A 3W3SA 2KU7A 3OW2R 2E2HK 4MEXA 4OZLA 5GMDA 4P2FA 2WONA 4DV5J 4OV6A 3R2CJ 4JI2F 2J6TA 1S79A 3RUBL 4IRCA 3IBWA 3O2IA 8ATCB 3NL0A 4U7UD 2ZVSA 4MK9A 6FDRA 2JZ5A 2VQFJ 1KQKA 2QRRA 2CQ4A 1S1VA 4URGA 2HGNA 1WKJA 3HO1A 3PFEA 2EK6A 1NJYA 5IOSA 1SL0A 3C15B 4AUKA 3EWGA 3DRRA 4ECTA 2IA0A 4F3QA 2DITA 3MEKA 3ILOA 2KB2A 2CJXB 2VQEF 3MWBA 4DL4A 1SKUB 4OZ2A 2UVRA 1NK4A 4JI5J 3MMBB 2CZVC 1RISA 2ZH6A 1SQFA 1YBAA 2IIHA 3JSBA 2UUWA 3TAMA 2M4MA 2LLZA 4A3IK 2XY6A 1O29A 2ASYA 3MR7A 1ZXOA 5HLFB 4BY1C 5HROA 2N4CA 3D0GE 1KVKA 2KFYA 4TU9A 3D9BA 2WW4A 4IRKA 2BJ8A 1T03A 3SSQA 3KLFB 1DTQA 1R8CA 2IVFB 1TFWA 3M2UB 1T3NA 1YKWA 1HNXJ 1VOMA 3U02A 5HMZA 3MOJB 4C2MA 4KHPJ 4ZH4A 2EC0A 4GKJF 2BJ3A 3IN5A 3NXZA 2VBZA 4YFXA 4NE9C 5RUBA 1FXLA 2F8HA 3ENAA 4Y65A 1FE4A 4QJVB 1JIHA 2IRUA 2VBXA 5F8JA 4WU3A 2M8HA 2NXEA 4KB7A 4C8LA 4LQYA 1K1SA 1VRQC 2AX1A 3LAMA 4F0HA 3DXSX 1O51A 3N01A 5IT0A 1Y10A 3QT7A 3KUEA 3MPUB 3M2VB 4NX9A 1KSPA 2CFXA 2GZOA 1R27B 2QX0A 3GTYX 1FX4A 2E7XA 1S6PA 2DGXA 3OUYA 1HMVB 3GJQB 1USMA 1G4CA 2EG2A 2QMXA 3OXLA 2OSQA 1RT5B 3GEIA 2BQUA 3QFHA 2ASLA 4EO8A 2RHQB 3DOLB 4Y2CA 2DNRA 4L76A 4X84A 1HIYA 3O3LA 4ENOA 4BKWA 4QIWL 2AHOB 1S7HA 1QUPA 2MY8A 3A8EA 4F3MA 3ILJA 4NA3A 1WG5A 2ZH3A 3TQ1A 4YY3J 4UUWA 1ZPVA 2OPRA 1GMVA 2NSCA 4RMFA 1QAXA 3FCVA 4ZK7M 3MPWA 4AE5A 3FFIA 2AYBA 2AW0A 3L7PA 4HACB 5K8MA 4FBTA 5GVQA 5L9NA 3LOUA 4EZ6A 3FKBA 2CQ3A 2UV8A 2KVIA 1R9TC 1CS4A 3CEDA 4HH0A 4DR3J 4CTAA 1IQZA 2EBEA 3KJNB 3UR0A 2Y1JA 3HOUC 4B3TJ 4LR7A 4GT9A 2ZDOA 1IM4A 1YRXA 1JKHA 4J9VA 4TVAB 4Q44A 1TV6B 4I6YA 2VHGA 4JK1A 4A3EK 5FLMC 4N7TA 1X5PA 4FNHA 3W8GA 5CA5A 4CO3A 1K0TA 4NCGA 4LSNB 1SBRA 1MMNA 5KFEA 1TWGA 2A1BA 3OR1B 5KFZA 2J8SA 4OYBA 5GMEA 4QWBA 1WKLA 2FDNA 4C97A 4OX9F 4WJ3M 3U1NA 3IAM9 1NAQA 2HVHA 3H2VE 5IYBC 4IG3A 2QSFA 2MEWA 1UW9A 4O0IA 2N3OA 1JLAA 1S0MA 1XNQF 1YNNA 1UMJA 1YNJA 3NGKA 1ZOTA 4KR0B 5DETA 2V6UA 3OBIA 3HZGA 5HMYA 4FZVA 1T05A 1RTJB 4GTAA 3GTKA 2ZJQQ 1T02A 5KFJA 1P9YA 5IOTA 3PO4A 3GTPA 3OFEA 5BR8J 1RT6B 3QRRA 3K7AC 3AD8C 2C2MB 2V2VA 5KFRA 3BQ1A 2FHKA 2J7WA 2XS5A 2KFNA 1RTDA 4G1IA 3SIPB 2XWYA 4CLPA 1U6FA 1EH1A 2WVDA 4JI1J 5F8HA 1T9TA 1NKEA 1VJEA 2CQDA 3OV7A 1R0AB 1FRKA 2HW3A 4ZOSA 3D5MA 4IH6A 4XIUA 4G0WA 2KI2A 4OLOA 1DTTA 2AKWB 1S9GB 2LCWA 4DV5F 1DCPA 3GTMK 4O4GB 4UOCA 3S16K 4NLXA 3M4OC 3PEHA 2V6TA 2DO4A 4RWXA 3H5YA 5C42A 2ZWPA 4FKXA 3GTOK 2WVBA 4KGKA 4WWSA 3SDEA 2FB0A 3H20A 5A76A 5I4MA 1JXLA 3H0GC 1L5UA 4O44B 1N5YB 3IAS9 3D0HE 1WQHA 4OYMA 1CC8A 4LBPA 1EQRA 3HM9A 2BMBA 2HKEA 3QJLA 3O8WA 1XMBA 4NLSA 3P45B 2WB1L 1EKSA 1S1XA 1FWLA 1CQNA 3FKIK 2RF2B 2WTFA 4WK3A 4YOEA 3Q83A 1YX2A 1IKVA 5KT6A 2BRKA 2ATLA 5JVHQ 4UY8T 3AD7C 3FSYA 3M8QB 5JUMA 3VGTA 4DPOA 2BE2B 4DR2J 3NWRA 2JEIA 1Q1KA 2W9BA 4IFYA 4C3HK 1RAEB 3A4TA 2MZQA 3TTGA 1FKOA 2E5HA 3NG8A 5ETPA 1P27B 2MQPA 1ZBSA 1F9HA 4XSXA 2MKSA 4NYPA 1U4BA 3WZ0A 2Q43A 1LV5A 3LGHA 3M8PB 4G7OA 3KK1B 3OXGA 1FD8A 1HNXF 1RT3A 3RG6A 2E1CA 4KHPF 5B0AA 1V3RA 3W5YA 3TJAA 2JA7A 4NI2B 4OJ3A 4OIQA 1M1HA 3WIVA 3UN5A 3NCQA 2VPXB 5KFBA 3J7A1 2CNLB 4RW8A 4DR1J 4NLOA 1O5JA 1IR0A 2HVEA 2NVTC 1URRA 3HP6A 1L3VA 5EHHA 2ZE2B 4QIWD 2VJVA 1IWGA 2IVYA 1R43A 1S0VA 2OIHA 1UP1A 4KKOB 1NJZA 1HFEL 3OVAA 1X60A 3PV8A 2ZD1B 4C0BA 1NK0A 3C46A 3C14A 1VHFA 2CJ9A 2CFAB 1RLCL 3G6ES 2M70A 3KHRA 5CCMA 4NMLA 4UW2A 3G8TA 4DCPB 5FDLB 2CW0A 1CPZA 1XXCA 2UV8G 2KXHA 1O26A 1C1BA 2EG1A 2W25A 3IFEA 5C24A 1C0AA 4USUA 1D9FA 3MDFA 3TUPA 4LR9A 1TKZA 3MEEB 5HJYA 2EWHA 2RUSA 4ETZA 2FJDB 2V9KA 2YPYA 4A8MP 2DT9A 3AOCA 2DCUB 1CSJA 4X6AC 5J1PA 2MPUA 2DY1A 3BQ2A 5A8KB 3DHXA 2HHSA 4MEYA 3IA0A 4A3LC 4PWDA 4GTFA 3PHTA 3VALA 3BGRA 2J6SA 1K9MT 5EWEA 3EGWB 1CVJA 1K83A 3GSDA 1KLMB 3L7OA 4HEA9 2W7VA 2RDJA 4Y34A 5M2RA 1DY3A 1F9EB 2P9EA 5HP1B 1XQIA 1P6TA 4DR3F 3W9IA 3KLGA 4A3DC 4OLPA 3BGUA 1NEEA 1I6JA 4B3TF 4ANDA 1GMWA 1T9VA 2VICA 2GGPA 3HSDA 4AD6A 4HDHA 1HNVB 5E68A 4ZCLA 2DH9A 3W65A 4DQPA 7FD1A 4YMEA 4CLFA 4Z2XA 2ZUEA 3PYGA 4IR1A 2UXDF 2PE8A 3G71S 1VR6A 5KFHA 3N6NA 2YKAA 2AQ4A 2C1EB 3J80U 2HHUA 4IQXA 2YWWA 2YKNB 2NVQK 4F7VA 4LIWA 2YX4A 1NSQA 2W7OA 1FDDA 1WCMA 3TZZA 3UNGC 1OJ4A 3TFJA 4FF2A 4C2MK 3BN4A 1XNRJ 5I3QA 4OZ5A 3PRBA 2NLWA 4BLBA 3Q8QB 2BACA 1XTZA 5ADZA 1TL1B 5A2QU 2DPJA 4OI1A 3MUTP 5EN1A 2V0NA 2KZZA 3BDEA 3UD3P 2EEYA 3HHNB 3CO0P 3LAKA 3BO2A 2VG6B 2FLOA 3V81A 3T19A 4A3JK 4B3SJ 2JX2A 3DLHA 3FMBA 4USWA 3CCSS 2E2IC 1TWHC 2GSUA 2I5JB 3LWMA 2J7UA 2GQCA 1RXOB 3RTVA 1W26A 2UVVA 3EPGA 4ZVFA 2JWNA 3S2DK 3W61A 1ISEA 4RUBA 2RD5C 3QPIA 2WB1D 3HOVC 1N6QA 2DYAA 1FJEB 3H3VL 1WQGA 2JVRA 3NGUA 3NBPA 5AE3A 4M95A 4QCLA 3KLVA 1UCNA 1RHMB 3VAMA 3FZBA 3GMGA 2E44A 3KNGA 1MROB 3CCZA 5J2NA 4FYVB 4NCBA 4QIGA 4WU2A 2E29A 2CPXA 2Z56B 1N0VC 3ZO7A 3FOFA 4B3RF 3OL9A 5K14A 3H4DA 1H2TZ 1F93A 4WFAQ 2VL1A 3DXJA 2CPDA 4LJMA 2G0JA 2QGFB 4CLUA 1YJTA 3BYPA 4DDFA 4BWMA 1NJWA 2K3IA 2C3MA 1N5QA 6FD1A 1LXNA 4E8UA 4GO5X 1TZ0A 2LECA 5HL8A 3CCTA 1Q8IA 2B3TB 4A3BC 3ZNJ1 4HTIA 2X1AA 1FA0A 3FNNA 1HWKA 3FSIA 4JI8J 4C3IC 1FNMA 2DNOA 1IKYB 1ULRA 4FP9A 4WCEQ 1S1WA 1O6XA 5KOWA 3NOGA 3TVYA 3TFHA 4Z7YA 2V68A 3RR7A 2FPHX 2F4VJ 1WHXA 4DX6A 1WOSA 2IYIA 3KFWX 3CTRA 3CD5A 1TWGK 3LAJA 3VAIA 2RUGA 3L7UA 2BW2A 4I7FA 3HHLA 2DNGA 2XMJA 3O44A 3SCJE 4F4ZA 2GC8A 2JA5A 3KLEB 4ZJOA 3DYAA 2N82B 3CCES 1QSSA 1HI9A 2XYPB 2YKMA 4ZPWR 2B7CB 2EFGA 1P9QC 3ILLA 4DR1F 1VI7A 4WZQA 1WELA 5KFDA 3GTKK 4FPIA 3H40A 3D3BJ 4MQ9A 4JV5J 3GTPK 1OSCA 4F36A 1I51B 5DLFA 2HNZB 2WB4A 4RNFA 2DKOB 1CULA 2F3JA 3C6TB 4I2PA 3H0PA 4F25A 2D69A 3NOCA 2H5EA 1FTCA 2APOA 3UN2A 2N7CA 4R8UB 1XWLA 2OHDA 2RKIA 1DHMA 2DNNA 3CJKA 1X9MA 3IM9A 3T3FA 1U2FA 4URQU 1FJ7A 3TA2A 3PW2A 4DHVA 2DNLA 2HFSA 3A8KA 2M7SA 4TLRA 5B7WA 2ZUFA 2HHTA 2OELA 3FGVA 2KRBA 4RW9B 2PFFB 2DIUA 4PEOA 4AH6A 1X0PA 2FVCA 4JV2A 1O25A 2ZM6J 3OJSA 1D09B 3CNQP 2R7ZA 3M9OB 1ZA1B 3ICLA 1XEZA 1WI6A 3V6JA 2R4FA 4G1QA 3D28A 2KXNB 2BOPA 2OKQA 4TYBA 1BE4A 3KK2B 2JDJA 2XCOA 2J9DA 3HKZD 4A3MC 1X4FA 2RMLA 1H7XA 4A47A 3J7YU 4YP3A 5J2QA 3K57A 1GAOA 4DLEA 2D74B 3MEDB 1RT1B 1YWXA 2R7RA 2ZC3A 3ZZYA 1X0FA 2KH9A 1SC6A 3GB0A 2B9XA 1Q82T 4JI7J 3I0RA 2CDRB 1XMOJ 3CD7A 1MNEA 5HJXA 5LJ5Y 2W24A 2A3JA 3RBDA 3S14C 4NMXA 4LSLB 4KO0B 2DGQA 4R5PB 4ZPBA 1KQFB 1NHVA 4NLYA 4IO9Q 2ILYA 3SZYA 3FBFA 2Y0SD 1NK5A 2CA9A 3T9ZA 2VKRA 4JI6J 3NGSA 2GA7A 4KASA 1P1LA 1D9AA 4FYYB 2YY3A 5G4DA 3A1YG 3VAGA 3VWSA 3LW5C 3DU6A 5C44C 4L73A 4O3OA 2PI5A 2QLJB 2PIIA 1TKTB 3IRXA 3ZC4A 1JLQA 3Q2TC 1JMTA 4OX7A 2EKNA 4C3JC 1HHQA 4NLPA 3U1LA 3EGVA 1TWCA 2JA7K 3QFWA 3TVZA 2UXBF 2EKYA 1KDNA 4KJIA 2NVXC 3MAAA 1PCAA 2OPSA 1KHWA 1Q8BA 3H3VD 4QYZK 5GAHI 3MM8A 3S17K 4DR6F 4G65A 5A0YA 3GFZA 2GVZB 4WFNQ 5GAGU 3DCAA 2K06A 5CABA 4B3SF 3NMAA 1Q81T 3S1QC 2B8PA 4DL6A 2M5YA 5IM0B 4CI0B 2F65A 3H4BA 2DHHA 1C0UA 2OPPB 5J1EA 4RBTA 1XIQA 3S1NC 1RHQB 4QQBA 1WWHA 4DV2F 1UVIA 3T5HA 1LW0A 2CQ1A 3PR5B 4GTCA 2YH0A 5CYQB 3OTEA 1FESA 3IR6B 4CO0A 1CJTA 1X7VA 1YK9A 4JV1A 4LFBJ 2HHVA 2XMKA 3JSTA 3O5TB 4C6AA 3K2YA 1Y5IB 2H65B 1TAUA 1O0PA 1SV5B 1YJ7A 4GVBA 1RTHA 3ISNC 2CRLA 1VGYA 3R6LB 2KHCA 4M63A 5FLXY 5J2PB 2AZ3A 3H5SA 1CBKA 4MIAA 1UEKA 4WZMA 3KTQA 1S59A 2MZTA 4ED7A 3DDKA 4U8VA 1XZPB 3M8WA 1K83K 4DL0C 3HVTB 2MQOA 4N76A 4CO2A 3PO3K 4RR5A 1MWQA 3VGUA 2AMCB 3QT5A 4OJ1A 5EDWA 5C4JC 2AYEA 3UDEA 4JI4F 2MMYA 2MKIA 2DXFA 1J6WA 4MKVA 2AEFA 3ISND 4RNHA 3J7AN 2AX0A 1PAUB 1L0WA 3BEGB 3UD5A 2JH3A 1Q78A 5GAGI 3I82A 3VVUA 2R9LA 3LPXA 3TUZC 4Y2AA 2DTJA 2JA6C 1M1GA 2RVJA 3CGIA 4A3KC 1EETB 3LGNA 3G9CA 5CYMA 2YU9C 7FDRA 1S1UB 3AFGA 2A18A 4OIOA 1WCMK 4OFZA 2XGQA 1QAIA 2UP1A 4ZVUB 1WSVA 2UXCJ 1B0VA 1CQMA 3OL7A 2HHQA 2Y1IA 3AA9A 3MM7B 1EFWA 3IWXA 3V2UC 3EPIA 3GTGC 3HOWC 2RE1A 4PYDA 1CLFA 4Q8EA 3M05A 4B9SA 3VA7A 4Q5SA 2RQCA 1IL2A 3ZXWA 1JLEB 2JA8C 3PO5A 3UD4P 5ETMA 2FVPA 4F26A 4X66F 4NZ7A 3TWZA 2HQGA 3C15A 4UOGA 2DB1A 1VC5A 3NGRA 3PVXA 1APSA 4CCHA 2RJZA 3D66A 4IOCQ 2E1AA 3RR8A 4WBFA 1KFSA 3R1HA 1VRUB 5JXSA 3TOQA 4O3RA 1EP4B 3MMBA 2HWIA 1IS1A 3KMQA 4C48A 2XZTB 4Y2MA 2FJXA 2XHCA 5IXUA 2V2QA 2GQ2A 1N32F 5HLFA 2HS4A 3NS6A 1RBAA 2V34A 1RWMB 1I3QC 1F3VA 3S1MC 3KLFA 4CLSA 2XB2D 5CXTA 2L9DA 1PILA 1HBUB 3GU0A 4DF4A 3PW5A 2XHWA 3M2UA 1H3DA 1DZ5A 5ETLA 4X62J 5F9NA 1B3TA 4P2XA 3L4KA 2VFUA 1RT7B 4BHQA 4NLQA 2ZH2A 1N5VA 3PM9A 4EFAC 4KMAA 1UV7A 3UO0A 3KUHA 4QJVA 1RU2A 5E2QA 1U6ZA 3DLBA 2J0SD 3OXFA 2ZBIA 1U45A 3PRDA 3MGJA 2EBGA 3RU0A 3IG1B 2FJVA 2YWGA 5H9EK 3DLLQ 3MURP 4NA1A 4A8XA 2A2CA 2Y1LB 4ES2A 5BYRA 1HBMB 1UETA 3M2VA 4I64A 4XLPA 5KFQA 4OINA 1HMVA 1QM9A 2Q6CA 5DS7A 4L3KA 2YWEA 3HSZA 3CWJA 1RT5A 2FVRA 2RAQA 2MKYA 3VGVA 4PXEA 3VZHA 5HL7Q 2JA5K 3DOLA 4WKYA 5D4NA 4JI3J 3CJSA 1QAJA 1IE0A 2MQ8A 2MZ1A 1FD2A 2VV5A 3Q8YA 4OI2A 4I4BA 1ZETA 5DDRC 1J5EJ 4AQYF 3K89A 1JJ2R 4WFBQ 4DCJB 2BE9B 3MCNA 2RRAA 3CC7S 3TEGA 4OYXA 2IBOA 4QW8A 5DGAA 4F4YA 2DH7A 1XMQF 3S15C 4LQ3A 4DFKA 4HACA 4LK1A 2GHVC 2JRSA 2BANB 3B4DA 4DV7F 2I1RA 2VDHA 1V9OA 2DEJA 4LUBA 3PW0A 4KGVB 3BSNA 1U26A 3HHDA 4ECWA 4BBYA 4YHHF 3JYTB 4WXOA 4F0KA 1U8WA 2OFGX 5CCLA 3BO3A 2LVWA 4HI2A 3ZTPA 1X4GA 1A6LA 4X4SA 1TFYA 1TV6A 4RUAA 2UUCJ 2CDQA 4YFKA 4NYZA 1ZTTA 2HFNA 3FEZA 4LSNA 1QLNA 2NXCA 2R7ZK 4ECRA 2BOAA 1SXLA 5FLXU 5M3MK 1F7UA 3W63A 2HFZA 4M5MA 3BGOP 1KLNA 2CQ2A 1KOOA 5HQMA 1K73T 3KMSA 3BM7A 4DV6J 3KDNA 2DH8A 2C3OA 4DWIA 3N5FA 3D6MB 4ERDA 1WOPA 3EZOA 5E3RA 3K8WA 1RTJA 4DF8A 3A3NB 2KT3A 2DNPA 3CAGA 1T9UA 2QLXA 1LK5A 2ZUGA 1GT8A 4P2MA 1RT6A 1X31C 4NPOA 3GYGA 4YEAA 2GNKA 2HEKA 2WK4A 5D6GA 3OHAA 1F7VA 1UZHA 2DNHA 3VTIA 2PGCA 2EW9A 2VOPA 4C11B 4ZIWA 2QL9B 3HLUA 3DFEA 1RLDA 4DPTA 3EICA 2VUGA 2CPIA 1X5SA 4N56A 3H5UA 3B82A 2YQ3A 5A8RB 4ELUA 2HGMA 2VFVA 4JYAF 4GFQA 1R0AA 3MTJA 2V50A 1IR1A 2CWXA 5BXIA 3FBEA 1S9GA 3GPAA 4O4GA 5HSPA 3I9ZA 1VFJA 1WSRA 1QSYA 3TYTA 3R9LA 3GSIA 3GP9A 2W9CB 3BBCA 1TWCK 1HNIB 1JXEA 3KYLA 1U09A 2I6WA 3P5BP 1JLFB 2XC9A 2PEBA 3RW7A 1B4SA 2X51A 5L39A 2ZWOA 3C6UB 2ZZMA 1K8AT 1IN0A 3DMJB 4XSZA 2DR6A 1U02A 4EI2A 1T9YA 4NL5A 1OY6A 4O44A 2HAFA 1N5YA 3BDPA 3M8SA 2GMLA 2DHAA 2VUMC 1K44A 3CF5Q 2JSXA 3EDRB 2Y9HA 1UA0A 1S1TB 2A2DA 5JVOA 3MI7X 1S7IA 5SUHA 1TKXB 1SB6A 1WQFA 4WF9Q 3BBBA 1J6VA 2RF2A 3LP1B 2IMWP 1PAEX 3H7HB 3R2DJ 4V1Ak 3MMAB 3G82B 1FRJA 3PJWA 3M8QA 2HQIA 3LPYA 2BE2A 2VG5B 5L1IA 3THPA 4A93C 2HG4A 5KFIA 2HZVA 3S1RC 2IYGA 1RA7A 2NREA 2X1FA 3GIKA 1U48A 1X9SA 2PMWA 2L9NA 2OPQB 2XI3A 1OO0B 3TZWA 2CJAA 3M8PA 4JP8A 1T7PA 4ID8A 4Q7AA 2HK2A 3KK1A 3ZTQA 1S6OA 3BN7A 2R7OA 3WBZA 1FRIA 1CEZA 4IR9A 2CG8A 2OI2A 1LWCB 1H2UX 4LFCF 3PCOB 4NI2A 1HR0J 2RH3A 1LQ9A 1IBCB 3M9NB 2WBRA 3JTPA 1GK8A 2NR0A 1RWXB 3H90A 4OJHA 1MN7A 2ZZNA 4LF6F 2AD9A 2ZE2A 2Z57B 1RK8A 1VK3A 4KKOA 2M52A 1HNWF 5KFKA 4OV1A 4YS2A 2ZD1A 3BSAA 1VIOA 2CFAA 3MHYA 1JJCB 3OTCA 4ZLNA 4DSKA 5FD1A 1WC5A 4A3FC 4WFXA 5CZVA 3TA0A 3OTBA 1G1XA 2VIHA 2G2YA 4X4QA 2D9OA 2ZOFA 4F4KA 5FDLA 3NGTA 5J2MB 1INNA 1PSDA 2ALYB 3IC1A 4NXNJ 5KFSA 4DQSA 2DXEA 2Z2LA 5HVGA 1D3WA 3MCOA 3MEEA 2WSEC 1RKJA 2G0CA 4KPYA 2NVYC 4F0MA 2HZAA 3M30B 2BKOA 3HOUK 1HBOB 3DKDA 3FHZA 5A8KA 2YQ0A 4CP5A 1VLOA 2EPIA 2AIRB 3IWLA 3KOAA 1XR6A 4U67Q 4GKKF 3ITHB 1HW9A 1GEHA 4ED4A 1KLMA 1GXTA 5IYCC 3MMLB 4B9MA 1JJ4A 5HP1A 2R3VA 1RA6A 4C9DA 4V19J 2H54B 4A8YA 1SJQA 4U96A 1RACB 5IOQA 4ECUA 4XDDA 3H2UB 5FIIA 5IYBK 3ETOA 4YB6A 1XR7A 2XGPA 3UCGA 3MR5A 2UUAJ 1P1TA 1AROP 1PJ5A 4DZ6A 1HNVA 2JFKA 2UUCF 2M0GB 4OI0A 3K5PA 4MT1A 2AGPA 1RAOA 4F4WA 3FQKA 3HF5A 1HPZB 1G6BA 4PKDB 2HRUA 3BH6B 2OUGA 1NUEA 2ZNYA 1Y5LB 3UDVA 2RQKA 1JVIA 4MIWA 4UF4A 1BHNA 3KJFB 3K7AK 1NK8A 2IDLA 1HBNB 3HX9A 2YKNA 1U1LA 2F4FA 2GFFA 1Q7LB 1LEOA 4KSEB 1M0SA 5B0GA 3ZNUA 4FN5A 2ERRA 1ZPWX 4DV1J 2V8PA 4LF7J 5CZXA 2V94A 2O66A 1XN9A 1NXIA 3SSRA 4L75A 1IKWB 3DU5A 1DURA 1SKWA 4CYUB 4YUDA 1TL1A 3X3UA 4DR5J 4CO1A 3PXGa 3M8RA 5KG5A 5DM7Q 2X3DA 3M4OK 2VG6A 3P4UB 4DSFA 2W2QP 3I0SB 1BC6A 2CPYA 2DISA 4B08A 5HQ8A 3BSCA 1I5OB 2I5JA 4ILLA 4F3OA 5HMXA 3QIDA 1N34F 4RKUC 5LMUJ 2OD6A 1WG1A 4DUYJ 2XY5A 4WP9A 3TZXA 4BWJA 1VCTA 4OZ3A 3KK3B 3J7ZT 3HOZC 1HARA 4RW7B 1S4FA 2P5VA 3R5CA 3MECB 5M2UA 1MROA 2B9EA 2R42A 1HHSA 1N48A 4ECXA 4E98A 4JI2J 3QSIA 4ICLB 2WRMA 5I3UB 4YG2A 4O0NA 1TL7B 1X4BA 2QL5B 4ZJQA 4U95A 5DLGA 5IFMA 1Y7PA 3CO9A 2XSFA 4G3IA 4K0KF 1C0TB 3GFXA 2BBEA 1RAJA 2FJWA 3DLJA 2XWXA 5KFNA 3IRWP 4MFBB 1RABB 2NXUA 3GTQC 2R7TA 3Q0AA 1FX2A 2UUBF 4Q2MA 4U7CA 2AF6A 3HSGA 4NA2A 2AJ1A 2M9KA 3C16B 3CUNA 4K4XA 1V3SA 3NUHA 4GTDA 4P75A 1IKYA 2DNYA 3VZIA 1SC1B 2D3O1 4CLKA 2GQQA 3ZZ0A 1IBLJ 2G13A 2W4CA 2MHNA 3MM9B 1Y11A 4UQGA 3I5BA 5CQGA 1N5TA 4JB8B 3EYZA 3I5CA 2GSNA 4GTBA 2IHR1 4P74A 3OLAA 4CLYA 2DGWA 4WFYA 3PW4A 2IC3B 1RP5A 1VISA 3WQPA 1F1BB 2Q1LA 3KLEA 1HQUB 3MAHA 2CXEA 4WE1B 2QT7A 1T9WA 4IDKA 3D7SB 1EIYB 1WG4A 3S16C 3ZZZA 3JTNA 3RZDK 5AT1B 3RRGA 4Y2IA 1FXDA 4Y28C 4ZLPA 2QG9B 3N6MA 2J0XA 1NJXA 4CLTA 2U2FA 4RWWA 4NOIA 4TNOA 1FKAF 2E5LJ 5E0OA 4IH5A 2CQIA 3QWPA 4QU7A 2HVZA 2HNZA 2WSCC 3EMTA 1FRMA 3C6TA 1BGXT 1VQ8S 2XEXA 1FJCA 2Z30B 4BC7A 4M5LA 5CAAA 2KG0A 3AJ2A 2AJ4A 4R8UA 3TFIA 1TL4A 2O5IA 1U25A 4X6AK 3FKIC 2V67A 1VBKA 4NLVA 4DUTA 2D1CA 1ELOA 1IW7A 2QIFA 4FYXB 2RRBA 4M5IA 2N3LA 3BYRA 3R8YA 3BB5A 3KLIB 4Q43A 4ZVPB 1RE1B 2BKNA 4P5BA 1O28A 3F41A 2MJNA 4RW9A 4ID5B 3Q2SC 2MYFA 4KHMA 3M4XA 4C3HC 4AFFA 2AV5A 1GX5A 4ATNA 1KQSR 1HI0P 1WD6A 3QQCD 1S9EB 4A3DK 4KAIA 5IWAF 1DAXA 5E3PA 1XZQB 1YTYA 3UW1A 1IWAA 1X5OA 1IBAA 1Y1VA 2QN6B 4YDDB 4HTJA 3KK2A 2DGTA 4LFAF 2ZHOA 3VAHA 1FT8A 3LP0B 4K5SA 2KT5A 5HVHA 2XCAA 2E66A 1FERA 4LRFA 2BA9A 2R92A 3GTLA 2JA6A 4TLQA 3MEDA 1RT1A 3CMES 5KFGA 4XDCA 3D6FB 3I6PA 3RAMA 1NLKL 4PG6A 4K4VA 2R2TA 2YNHB 3MR3A 5THWA 1BS2A 2GMJA 3UFCX 4EEYA 3HJFA 3JQKA 2HBYB 4LSLA 4KO0A 1PC4A 4R5PA 3I4PA 2LEBA 3CDUA 4J37A 2BZ2A 1EK8A 2FTRA 2MHEA 3GTGA 2R7XA 2UU9J 3I87A 1UWAA 1SFOA 4B3MF 2KXFA 4IG0B 3MXHP 5U47A 4DX8H 2DNQA 1C1CB 1CJKB 4PUOB 3SZ2A 2IDEA 5L38A 3OD2A 5KG2A 2QYCA 3ZZTA 2RS8A 2CAJA 3DI6B 1N33F 2E9TA 2GO8A 1HL6A 4OX9J 2OH2A 1TKTA 1R89A 5B0CA 4P10A 2NYHA 1QE1B 3VQSA 4ES1A 1S48A 3R7SB 1SH0A 4L3NA 1FJGF 1XNQJ 4WTOB 4K5RA 4DEZA 3CD0A 2P8TA 1GE9A 4R0JA 4GC7A 2EFNA 4A3CC 1FO1A 2KJVA 1UA1A 4ZPDA 1WTFA 2GVZA 4LQ9A 1I94F 4KM8A 1N54B 3CJRA 2IRYA 1TELA 4EBEA 2UUTA 2XZWA 3ERED 5IM0A 2YPZA 3Q3QA 4MKAA 4ED1A 2ZDPA 4ZCKA 2OPPA 4C8KA 4USHA 1KVIA 4OL8A 1ICEB 4ZS6A 1B64A 4QPXA 4ZN3A 4DR4F 3SXLA 1WHVA 4PABA 4PYAA 1OQ3A 5CYQA 4PPDA 1VMBA 3R27A 4ZA1A 2FUG9 2WSFC 3L09A 4DG1A 4CO5A 4EZ9A 4GC6A 3V4MA 1N36J 5IP9C 4QIFA 2XY7A 1REGX 3PR4A 1SV5A 3TP2A 2W2PP 4G7HA 1F9NA 1YZ7A 2GHWA 3GTJA 3MM5B 4PR6A 1J5OB 1MWZA 2V6AA 5E3CA 4ECVA 2NVQC 4DR7J 2W7AA 4QU6A 4N77A 2OSRA 5J2PA 4DBQA 3MUVP 2P6TA 3D1OA 1UFWA 1YGYA 1NPRA 1UWBB 2PA3A 3RBXA 1XZPA 1JQWA 3HVTA 3CSKA 4FXWA 1WC4A 2R8KA 1WHYA 4Q45A 2NXNA 1Y1WC 2JOQA 5D8HB 2WVCA 1RCOB 1IBLF 4ZPTR 4W98A 3G8SA 1M5SA 4DV0F 1F6TA 2DRAA 4QYZJ 1ZZNA 2B5JB 4A3JC 4JBCA 4YB7A 5D3GB 3B54A 1WC3A 1YI2S 4USMA 3N0CA 2QO3A 2VPZB 2DIVA 1EETA 2GJ2A 4LBHA 4BCAA 3S2DC 3A8IA 4LVNP 4FVCA 5GMKa 4Y0FA 2FGCA 1SL1A 2KKHA 5LSRA 1NB7A 1S1UA 3JQMA 4FYWB 3P6YC 3CT9A 1VJQA 2RH6A 1KEKA 1GTHA 2B6AB 1EKRA 2FY8A 3GJSB 1QSLA 1FE0A 3EVMA 3MM7A 1AB4A 3I4MC 2PC6A 3LPEA 3G6XA 5HO4A 3N79A 2E5LF 1VQOS 2E1MC 5AE2A 2MGZB 1X5TA 2F9DA 4LREA 1FWPA 3T1AA 1JLEA 3Q8UA 2AGOA 1T3OA 3T9NA 3EGZA 2ZH7A 1VBZA 3MAQA 1HWUA 1MWYA 4KE5A 4C7QA 4TY8B 3MTKA 1TVRB 2KDOA 4C4WA 2OEMA 4NEYA 5C2GA 3W66A 3Q8RB 4DFMA 1VRUA 4PG5A 1JWWA 5E3QA 2DHGA 1RAFB 1R8AA 4KIAA 5HVFA 1SC4B 1N4LA 1X4HA 5EGEA 3AXKA 3GJTB 4CM2A 4NLDA 1FXRA 4KGMA 4DQIA 1YJRA 3OT9A 4YFNA 4DPXA 1U1QA 3DRXA 3MOZA 3I4NC 1SQEA 2H5JB 4I1TA 1TWGC 3WX8A 1REVB 3OTOF 4ED0A 3D68A 1HBUA 2YKPA 3S14K 3RZOK 2M88A 1KQGB 2ZC4A 4KARA 2HHHJ 2UZAA 1VC6A 2EI5A 1NH7A 2XI2A 3DRSB 1HI1A 4Q0BB 3HDSA 4ZPAA 1RT7A 1F0XA 4QOTA 1C4CA 2GSOA 1UL3A 2QEXS 2Q3PA 2GVDB 3KKFA 1OY8A 3I56S 3OLBA 1IJEB 1SC3B 2KFZA 1XK8A 1EAYC 3IWNC 2C3PA 1VJWA 2KT2A 5HQLA 3CMQA 2IPOB 2VFSA 3SQGB 5BYQA 1KQ4A 2RGRA 3IG1A 3H98A 2UU9F 4QYRA 1HQEB 1IVZA 4AYBL 4ZMMA 1WEXA 2V63A 5KG3A 1HBMA 5LSOA 2NZCA 2P2CB 3FC9A 4ZJLA 4H4KA 3G86A 2XNRA 4PG4A 2UXDJ 3TARA 1B7YB 3LUYA 5LXYA 5EX0A 2KJWA 2VUMA 3HVAA 2IJFA 3J80Y 3FOEA 3S1QK 3MPDA 4GTLA 4RX6A 4OI3A 5EWFA 4FNIA 2C42A 4KB4A 1FHTA 2UVWA 3S1NK 1TR0A 1GXLA 2MJUA 3BS9A 1VHIA 2B8QA 2NS1B 3PG9A 2R93A 2G9OA 1VBXA 1L3SA 1HQ2A 1RCXB 2B63A 2GJIA 4KDDA 3N3YA 2BV3A 1RU1A 2VODA 1TWAC 4QR2A 4N8NA 1HD1A 5A2QY 9RUBA 1M5HA 3ZTSA 2BANA 3WC2A 3N6LA 3A8JA 5IC4B 1FK9B 4C0HA 4LF4F 2HBZB 2OP5A 1VQ7S 3DHWC 1WF2A 3AHPA 5K8OA 2ZITA 3CB4A 3JYTA 2ZH4A 3BZQA 8AT1B 1N36F 4CLLA 2W1BA 1TP7A 2C2KB 2ZH9A 3DNCA 3HMJG 1TK5A 3IPJA
chains in the Genus database with same CATH topology
1WORA 3GEEA 5L46A 1WOOA 2GAGC 3GSIA 4PAAA 3TFIA 3ADAC 4PABA 3A8IA 3TFHA 3GIRA 3AD9C 1V5VA 1VRQC 1PJ5A 2GAHC 3GEHA 3TFJA 1X31C 1VLOA 1YX2A 3AD8C 3A8JA 1WOSA 1XZPA 1PJ6A 1XZPB 3TTGA 1WOPA 1XZQA 1WSVA 3AD7C 3GEIA 1WSRA 1XZQB 1PJ7A 3A8KA 4P9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOR A;  3GEE A;  5L46 A;  1WOO A;  2GAG C;  3GSI A;  4PAA A;  3TFI A;  3ADA C;  4PAB A;  3A8I A;  3TFH A;  3GIR A;  3AD9 C;  1V5V A;  1VRQ C;  1PJ5 A;  2GAH C;  3GEH A;  3TFJ A;  1X31 C;  1VLO A;  1YX2 A;  3AD8 C;  3A8J A;  1WOS A;  1XZP A;  1PJ6 A;  1XZP B;  3TTG A;  1WOP A;  1XZQ A;  1WSV A;  3AD7 C;  3GEI A;  1WSR A;  1XZQ B;  1PJ7 A;  3A8K A;  4P9S A; 
#chains in the Genus database with same CATH topology
 3CCL S;  3CCW A;  4JI0 F;  4AL6 A;  1HQM A;  1SUQ B;  3L95 X;  2VON A;  4OHX A;  4F4A A;  5JMN A;  4B3O B;  4HT7 A;  4DR7 F;  1F5C A;  4ZVQ B;  1Y1V K;  2AJQ A;  2XO6 A;  3R7N B;  4B3R J;  2H5I B;  2HQF A;  2XO7 A;  2LEA A;  1GQE A;  3JSM B;  3JXO A;  1JLB B;  2X1B A;  1D8Y A;  2AYG A;  2CJY B;  1M5V C;  4W90 B;  4KGZ B;  4L72 B;  2R92 K;  2JA6 K;  3GTL K;  1Q53 A;  4YB1 P;  4URS A;  3EZU A;  1PG5 B;  3G6Y A;  3BF4 A;  1FDB A;  3TX8 A;  3DOK B;  1FCA A;  4UQT A;  2WW8 A;  3GR1 A;  2EFP A;  2OEK A;  5A6W A;  3NNA A;  1FVS A;  4C11 A;  2NVY A;  1JOE A;  1LFP A;  3GTG K;  2IRX A;  1SFO K;  4ITS A;  5KFA A;  4IOB A;  2GCF A;  4ZCI A;  2CPE A;  4A8F A;  2R8J A;  4A46 A;  1PC5 A;  3D6H B;  2PMH A;  5A8R A;  4ZPV R;  4QR0 A;  1NK7 A;  1T8E A;  3ADA C;  2CWK A;  3CC4 S;  3DDI A;  1LWX A;  1NJI T;  3N0B A;  3SSS A;  3QO9 B;  3QGH A;  2E9Z A;  4C8N A;  3SV4 A;  1G51 A;  3QRQ A;  2LQ8 A;  4Z7C A;  5CHC B;  3FZ2 A;  4P52 A;  4WKR A;  3AH6 A;  3VVT A;  1HNI A;  1JLF A;  3MEG B;  4GVL A;  3HJV A;  5KFT A;  1Q7Y T;  3ILI A;  1U47 A;  1JJH A;  3C6U A;  2IJN A;  4OZN A;  4W92 B;  2CPZ A;  1ZAW A;  3DMJ A;  1TK0 A;  3BBF A;  3K58 A;  2K7K A;  3W62 A;  2ASD A;  2CPJ A;  2BQR A;  4Q4Z A;  1UPP A;  4CT9 A;  1S1T A;  2K8G A;  1PJ6 A;  5GAD U;  1R0B G;  1K83 C;  3AY0 A;  1TKX A;  1RAH B;  3S1M K;  3HD2 A;  3GJR B;  3LP1 A;  4BBS C;  4CNZ A;  3UVJ B;  5ETR A;  4PWU A;  4CH1 A;  3MMA A;  3SI8 A;  3G82 A;  4NRT A;  3DLK B;  4J9P A;  2VG5 A;  1LWF B;  3P8B B;  1UFL A;  1RAI B;  4D3G A;  1WEY A;  3NS5 A;  4DV3 J;  2YXL A;  5AXK A;  4KN7 A;  4DPW A;  3V4I B;  3AB4 B;  4ECS A;  1SVD A;  5HI7 A;  3G87 A;  1G3O A;  2OPQ A;  1PGZ A;  1RT2 B;  2O5J A;  2ZKU A;  3M3Y K;  2HHH F;  3GTJ K;  4AYB D;  2IFX A;  3W60 A;  2U1A A;  1YRU A;  5IT4 A;  4H4O B;  1IBK F;  3G4C A;  1T95 A;  1WCM C;  1NDL A;  1YJW S;  2DNK A;  1LW2 B;  1LWC A;  1HI8 A;  3K5N A;  1O2F B;  1H0H B;  4BLA A;  5G0R B;  5CHP A;  3BSO A;  5F0U A;  1BY9 A;  1VC0 A;  2F8E X;  5F8M A;  3D0I E;  2R8H A;  3PJ9 A;  1VQ6 S;  3DOM B;  2VFT A;  3W2V B;  3QRP A;  3ISZ A;  4BBR C;  5C2C A;  3EQL A;  4OHV A;  3JSR A;  3VAF A;  5KOX A;  1RJJ A;  3R3T A;  2BW7 A;  4IKA A;  1PJ7 A;  4EWT A;  3HKZ L;  4P7V A;  3RAQ A;  1NHU A;  3T6B A;  3T1Y F;  1Z2Z A;  1RTI B;  5EUH A;  5F0W A;  2FHJ D;  4Y2K A;  1U1M A;  5GAD I;  5ETN A;  3E3X A;  1FKP B;  3TUI C;  1BLU A;  2HNY B;  5J2M A;  2OEJ A;  3S15 K;  4BXX C;  4OJG A;  1KOH A;  4HI1 A;  5E41 A;  3GTQ A;  3I55 S;  4OHW A;  2WVF A;  1PO6 A;  4DX7 A;  2YH1 A;  3M8Y A;  1D0E A;  1RAA B;  2NYI A;  3S2H K;  1A0O B;  3T00 A;  3UE2 A;  4UY8 5;  1AUS L;  1RAD B;  2XYG B;  2UXB J;  2DD8 S;  2V4J B;  3I4H X;  3M30 A;  4YB5 A;  1HBO A;  1RWP B;  3PX0 A;  3UCU P;  3BQ0 A;  2MKC A;  4DFJ A;  2Y0S L;  2ILZ A;  3SFU A;  4EYH B;  4MTP A;  4DR6 J;  2EXU A;  2M2B A;  3SZZ A;  4X65 F;  3ITH A;  1F9F A;  1KHV A;  4TQS A;  4GZY A;  2H9Z A;  3LP2 B;  1VDH A;  2MST A;  4RBV A;  1S76 D;  2I8E A;  2C2N A;  2MB0 B;  3HOX C;  3C8Y A;  4YQW A;  2DR9 A;  1EB0 A;  4C8Y A;  1Q5Y A;  3V6K A;  4O3N A;  3HVR A;  1UEU A;  3GLJ A;  2HFU A;  2A6E A;  4DV2 J;  3FJ2 A;  3ULH A;  3G8Q A;  4I6W A;  2RIL A;  5IOL A;  1NZ8 A;  3QAE A;  2W4D A;  5BYS A;  2ZH8 A;  3CCV S;  5KFM A;  3NNC A;  1HPZ A;  2W01 A;  2LU1 A;  2HBQ B;  3QYY A;  4TXS A;  2IM3 A;  1RDR A;  2DRD A;  2OTL S;  2AZ1 A;  3ET6 B;  4M1K A;  1HBN A;  2XMW A;  1UFK A;  3CQZ A;  2E5J A;  4CRJ A;  4ER8 A;  3CDW A;  3MFH A;  2J9C A;  3HHL C;  2FLN A;  4A8Q A;  1BMQ B;  2JA5 C;  3R7B B;  1WEZ A;  4IOA Q;  3W9J A;  5T41 A;  1R0C B;  2QA4 S;  2Q79 A;  4A8S A;  4LBI A;  1ITP A;  4KY3 A;  4A3G C;  2DNM A;  4DSI A;  2K1R B;  4TU7 A;  4U9R A;  3UN3 A;  5F3T A;  4PXD A;  2CZ4 A;  3H5X A;  2L41 A;  1KON A;  1IKW A;  1FTR A;  1CJU B;  3IXQ A;  4CYU A;  1WF1 A;  4OYI A;  3L4B C;  4N47 A;  5KFF A;  4C98 A;  1TKD A;  2QFJ A;  2QLF B;  3OR2 B;  2HLU A;  2HBR B;  5HAO A;  5I42 B;  3QNW B;  4J9Q A;  2HK3 A;  1OMS A;  3CCJ S;  2BAB A;  4JI4 J;  1SIZ A;  1HHT P;  3NEK A;  3I0S A;  2MLZ A;  2BR0 A;  5D78 A;  5AE1 A;  3HHL D;  1SMY A;  1BJT A;  3G2X A;  5KT3 A;  3Q8V A;  3QIP B;  2HUR A;  3LO3 A;  1S10 A;  4MK8 A;  1UPM B;  2OAU A;  1NSP A;  5LMN F;  4CZC A;  2F5G A;  3OL6 A;  4P73 A;  2CQG A;  5B08 A;  2N4D A;  3IBC B;  2F7V A;  3E01 B;  4J9R A;  2VUM K;  2B7B B;  4MMO A;  1YDL A;  3EDQ B;  3VQT A;  4OYO A;  3KK3 A;  4CM0 A;  4RW7 A;  2HMI A;  3MEC A;  5HN0 A;  2RQM A;  2HND B;  3M1V B;  4K4Y A;  4ZHR B;  4ANC A;  2HHW A;  3O1L A;  4ECY A;  5IZH A;  1RT4 B;  3KJV B;  4ICL A;  2ZOG A;  5I3U A;  2R93 K;  4USV A;  3R97 A;  1TL7 A;  2V8D A;  4NLW A;  1NU4 A;  1QD1 A;  2B63 K;  2MDA A;  4A93 K;  4A48 A;  1RBL A;  4RO0 A;  2G1H A;  1C0T A;  1TL5 A;  2NSB A;  3FBC A;  2FZC B;  3RBZ A;  2B9Y A;  2FVQ A;  3NS7 B;  2VA3 A;  1M1K T;  3QT8 A;  5F9L A;  4IUF A;  3ZZU A;  3LF0 A;  4MFB A;  4X66 J;  4QPT A;  2X3G A;  3CE8 A;  1H38 A;  1NBE B;  2YKO A;  1S12 A;  4DUZ F;  1OYD A;  5EWG A;  2M8D B;  2LA4 A;  2QFI A;  5E3A A;  5L1L A;  2R7S A;  1FNX H;  5DDQ C;  3C16 A;  3SV3 A;  1VLY A;  4DZD A;  4X4U A;  2VKZ G;  3IS9 B;  1UJ4 A;  1VIX A;  4DV4 F;  4RJV A;  4DV3 F;  3MPY A;  4PQU B;  2PHC B;  2DBB A;  2K2P A;  3KLH B;  3MM9 A;  2EC2 A;  2A69 A;  5MLC V;  5GAH U;  3M7V A;  4F50 A;  1K0V A;  3CPW R;  1LK7 A;  1XER A;  4CDI A;  2GO9 A;  4J9S A;  1N32 J;  3QBC A;  4IQM A;  4HKQ A;  1CJV B;  4AL7 A;  2D41 A;  5CH7 B;  1H73 A;  1FRL A;  2CQB A;  3BPS P;  4CH7 A;  1M5K C;  5IT9 Y;  2IC3 A;  1EQM A;  4ES3 A;  1D8Z A;  3CDE A;  4QIE A;  1HQU A;  3PO2 K;  3J81 Y;  4WE1 A;  1VGX A;  1QAY A;  4RW6 B;  3VCD A;  4ILM A;  3HFV A;  4RNN A;  3MMC B;  4LR2 A;  1TWC C;  3DLG B;  1U2C A;  3KG1 A;  1MML A;  4A3F K;  2X7I A;  1I50 A;  2R2R A;  4WYL A;  5C5J A;  4Y52 K;  2QA4 G;  2R8G A;  4X64 J;  4ECQ A;  2XS7 A;  4O2D A;  3S1T A;  4OMF G;  2C2R A;  1KVJ A;  1NZA A;  3I32 A;  3SBM A;  2FLP A;  4G1P A;  1B0P A;  5BJR A;  3NCP A;  5AJ3 F;  1JQG A;  3MM6 B;  2JLG A;  1K47 A;  3JB9 k;  2IA6 A;  4U6P A;  1S57 A;  2NVY K;  5T14 A;  4QBU A;  3CIZ A;  4RUC A;  2IAJ B;  1YQH A;  3FBB A;  1S6Q B;  3CCM S;  1XXB A;  5ETO A;  2DRB A;  1U2R A;  1SIW B;  2CUY A;  2MKH A;  5KFV A;  3FVY A;  4KFB B;  4WYW A;  4YR2 A;  4WP3 A;  2VG7 B;  4I2Q B;  3CCQ S;  5H1S V;  3B8H A;  3KLI A;  4K2J A;  1VYA A;  3MR2 A;  1BQM B;  3Q24 A;  3V6H A;  4RL1 A;  1WNE A;  4ID5 A;  4DL7 A;  5IYC K;  4CLW A;  3CCR S;  3L4J A;  1S9E A;  2KL8 A;  1FVQ A;  1NND A;  3R5G A;  1ZQ1 C;  1Y1W A;  4ELT A;  3THT A;  1XZQ A;  3DM2 B;  5DG8 A;  1KS2 A;  1U1R A;  2HPU A;  2GW8 A;  4AQY J;  4P6Q A;  2EVZ A;  3LP0 A;  3P3D A;  2WOM B;  1UEV A;  2FQT A;  2AJ2 A;  4KAT A;  4O23 A;  1XMQ J;  4NRU A;  5CD4 A;  4DLG A;  3TX0 A;  1R8B A;  2YNH A;  4DV7 J;  4B9N A;  1O24 A;  2YQ1 A;  4KM9 A;  2DCL A;  5C4X K;  1HNZ F;  4YHH J;  2LQ9 A;  3V4G A;  3X1L B;  3I5A A;  4FYD A;  1TAQ A;  1YVF A;  4XAK A;  5D0H A;  4IG0 A;  2Y0B B;  3M6W A;  3ORE A;  2N7Y A;  1C1C A;  1CJK A;  4PUO A;  4MK7 A;  3OVB A;  4GTE A;  5D0R A;  2LU2 A;  1I6H K;  5KFO A;  2JJ4 D;  1PYT A;  3DI6 A;  4J90 A;  2ZJP Q;  2YNF B;  2OML A;  1ZYQ A;  4E0D A;  3I96 A;  1TWF C;  5DZ7 A;  3FCW A;  4Y6I A;  4NLU A;  2FJE B;  4LF9 F;  1QE1 A;  1M90 T;  2AYM A;  4G7Z A;  2ZKT A;  4QIV A;  3OEP A;  3M2R B;  1I1G A;  3D2W A;  5DQH A;  2Q6B A;  2QL7 B;  1NDK A;  4PG7 A;  2GIR A;  3A3P B;  4E2F B;  4KBI A;  3AQP A;  4MYT A;  1R8H A;  3K0J A;  4RU9 A;  4OZ0 A;  3RB3 A;  4UT4 A;  2AT1 B;  3BGF A;  2VBY A;  3DGP B;  4NXM F;  1CC7 A;  3HOZ K;  3OL8 A;  5K8N A;  4TU8 A;  3CUL A;  3M6V A;  3PKM A;  3K5O A;  1RKI A;  4CLZ A;  4IO1 A;  1GNK A;  2YNG B;  4OYA A;  1MU2 B;  3FSX A;  4NAS A;  1TTH B;  1O2A A;  1JLG B;  3NKY A;  3HKW A;  4DSE A;  5L9X A;  3HOY K;  2B56 A;  2KYX A;  1JLC B;  3W2W B;  4JYA J;  2XBP A;  1AZS B;  4N8O A;  4NLG A;  2GIQ A;  2ZHA A;  1IM6 A;  1R6Y A;  4LT6 A;  2HHX A;  2R7V A;  1N0U A;  1I6V A;  3GQC A;  3GTQ K;  3NCR A;  4WII A;  1WC1 A;  1R9T A;  2V8H A;  3MM5 A;  1J5O A;  2A6H A;  3EZ5 A;  1S99 A;  3CCU S;  4KV8 B;  1A9N B;  2MZR A;  3Q8S B;  2ZH5 A;  2DEI A;  1VK8 A;  2QV6 A;  1DQ9 A;  1Y3J A;  1UWB A;  2KYZ A;  2MZJ A;  1FEE A;  2O67 A;  1E6V B;  3N28 A;  3D3C J;  4USK A;  2HYI B;  3SCL E;  3B78 A;  1N88 A;  1Z2L A;  2IBK A;  3CDA A;  4FM9 A;  2BJ7 A;  4EBC A;  4XO0 A;  1YBT A;  2C2E A;  1RWU A;  2B51 A;  1UAW A;  4BY7 K;  4X4N A;  1T94 A;  3QMQ A;  4U8Y A;  5KFP A;  3MR6 A;  4X4O A;  2QLW A;  3NRB A;  4F2R A;  1JXV A;  4PZV A;  5B0E A;  2ROE A;  2B5J A;  4TN2 A;  4DS5 A;  2B0G A;  2MKJ A;  5D3G A;  1BUX A;  5IP7 C;  1VQS A;  4ED8 A;  3P49 B;  2XYH B;  4PWW A;  5IT9 U;  2GHP A;  2VQF F;  4OI4 A;  1TWA A;  1M5O C;  3J81 U;  3BKT A;  2LKZ A;  3CQZ K;  1R3N A;  2R2U A;  3EUN A;  8RUC A;  2B6A A;  4YR3 A;  4DL3 A;  2BE5 A;  2J0Q D;  3QJJ A;  3QLH B;  4LFC J;  3ZTR A;  3S7R A;  3H2L A;  2W2N P;  3EGN A;  4JI5 F;  4UOH A;  1PBA A;  2P5M A;  1Q86 T;  2E2J C;  4X64 F;  1DCH A;  2KHD A;  1TMJ A;  2MGZ A;  3DGV A;  2EFO A;  1WIH A;  3OSP A;  2OO4 A;  2IY5 B;  2HIY A;  4LF6 J;  1YSJ A;  3KNA A;  4M5G A;  1NB2 A;  2ADC A;  5F8N A;  3RGI A;  1ZM9 A;  4ZIV A;  4TY8 A;  3HI9 A;  1RUS A;  1H74 A;  2CNO B;  1LKZ A;  1TVR A;  3G96 A;  2DY9 A;  2E5I A;  1FFW B;  1ZYR A;  4HR2 A;  1HNW J;  3GON A;  2D7S A;  5K20 B;  5KG0 A;  1H98 A;  4F8R A;  3H0G A;  5DG7 A;  4DJB A;  1NHK L;  4ZDN A;  4FXV A;  4QR1 A;  2V8G A;  4CIO A;  1SI9 A;  3AOD A;  3OPF A;  1Q8L A;  4ED3 A;  5KTQ A;  3SCK E;  3TO8 A;  4DL2 A;  3D1H A;  5LOQ A;  1IBM J;  4Y7N K;  4DI6 A;  3NNH A;  3PEJ A;  3GDZ A;  2O1P A;  1KRP A;  1REV A;  2B4V A;  5IYD K;  5A8W B;  2CIM A;  4EO6 A;  5CD4 H;  2IVM A;  1KTV A;  3T5L A;  1X4E A;  2FGO A;  3D1Q A;  3NY0 A;  3H59 A;  3I9V 9;  3DRS A;  2HZC A;  4Q0B A;  1NDP A;  2MQM A;  2LFV A;  3RZD C;  2YVS A;  3R6G B;  4GKK J;  3L3C A;  3BJY A;  3N0V A;  5KFX A;  2Z2Z A;  1HKA A;  1LWE B;  2GVD A;  5DJB A;  3QAT A;  5C3E C;  3SCI E;  4B02 A;  5KAK A;  5KFL A;  5ETS A;  2Y8Y A;  3DC2 A;  1RHJ B;  2G0I A;  3Q8P B;  5ETV A;  3SQG A;  4LF5 J;  3A12 A;  2FVS A;  5H9F K;  4I0W A;  4OIX A;  1XXA A;  4RUH A;  1HQE A;  2H4Y B;  3KUG A;  2PSZ A;  2KN4 A;  1Y3K A;  5TJ3 A;  4LRD A;  5LXR A;  2NUH A;  4A3C K;  4YY3 F;  3OR1 A;  4KMH A;  3GZ7 A;  1AYE A;  5KFY A;  3UR3 C;  5M5X K;  2VH7 A;  4OI6 A;  2P9G A;  5LJ3 Y;  1ZS6 A;  3WX4 A;  2KWA A;  4OIR A;  3HXA A;  1SJ3 P;  4PPZ A;  1VQK S;  2DXD A;  2BJE A;  7AT1 B;  3HXM A;  3SFG A;  3LGM A;  4U7U K;  3IM8 A;  1T0T V;  2KG1 A;  5HK4 A;  1J6X A;  4Q5V A;  5KT7 A;  3ZZR A;  3WC0 A;  4TY9 A;  4LR8 A;  1YIT S;  1I50 K;  4B17 A;  5DGB A;  1T11 A;  5D15 A;  5DQG A;  1R31 A;  3CJQ A;  5EX3 A;  4J7C A;  5EGY A;  4USJ C;  2B43 A;  4LJZ A;  1X4C A;  1SKR A;  4Y3C A;  5IP9 K;  5C25 B;  1AXQ A;  4M5D B;  5KT5 A;  4DDQ A;  3BH7 B;  2MZS A;  2BEF A;  4DOZ A;  3ZZP A;  4K4S A;  1FK9 A;  3TQE A;  4LIR A;  4MJK A;  3EVO A;  4K2X A;  1J2V A;  2C3U A;  2CNN B;  1NK6 A;  1J27 A;  4J9U E;  3GCX P;  2CZ9 A;  1N34 J;  2FHJ A;  2Z2M A;  1RHK B;  2ABY A;  2J76 E;  3HPO A;  4EBD A;  2LP4 A;  4OYZ A;  4LSZ B;  2IM0 A;  4P5A A;  2GAG C;  3QGP A;  4LMZ A;  5BR8 F;  3Q22 A;  2YNI B;  1SUQ A;  1Y1W K;  1SL2 A;  5L1K A;  4B3O A;  1TQL A;  2KVQ E;  4I69 A;  4X4R A;  4ZP8 A;  2PN6 A;  2JLF A;  4HYK A;  3FMW A;  2BJ1 A;  2P9C A;  3U27 A;  1Y0H A;  3JSM A;  4OQJ A;  1EZZ B;  3MUM P;  1JLB A;  3KHL A;  2ZEJ A;  2RHS B;  3AH5 A;  4BY1 K;  1WDT A;  4JI1 F;  4K0K J;  1VQ4 S;  2J8A A;  3DLE B;  1BQN B;  2EK1 A;  2O3D A;  2FHO B;  2ZBP A;  3PZP A;  2DNZ A;  1G2E A;  4RPF A;  1FRH A;  2GAH C;  2UUB J;  4GO7 X;  5F8I A;  4Q2L A;  1RWK B;  4C3K A;  3DOK A;  2DO0 A;  1DD5 A;  1B4B A;  4DSL A;  2MKK A;  5HBM B;  1L3T A;  5D4L A;  3I4M K;  3QT6 A;  3HCX A;  2OTJ S;  3OTD A;  3T6J A;  2XS2 A;  2MTL A;  4ILD A;  1PYO B;  5IV4 A;  3M6U A;  4OHY A;  3GV7 B;  2JEG A;  1S49 A;  1VQP S;  3V6D B;  3N4W A;  1IQ0 A;  2ZFH A;  4RW4 B;  4ED6 A;  4CNY A;  1E6Y B;  1RWO B;  2BVZ A;  3POT B;  2WCX A;  4C3L A;  1XJW B;  1ZM2 A;  3LH2 S;  3QO9 A;  3MCM A;  3F0N A;  2R8I A;  4Y00 A;  4HL9 A;  5AXN A;  2E2H C;  4C3M A;  4C0O C;  4DPY A;  2E2I A;  1TWH A;  2JFD A;  4CO4 A;  4HHH A;  3Q86 A;  3MEG A;  5K8P A;  3VV2 B;  2QTW A;  1H6K X;  2RSQ A;  3GEH A;  5DDO C;  1RHR B;  3FEX B;  1HWJ A;  2W7P A;  3K59 A;  1QVF R;  3FCH A;  4DR2 F;  2NCK L;  1KTQ A;  2I38 A;  2EFQ A;  2D9P A;  1WOO A;  1GMU A;  3RBE A;  5MAO A;  3D4J A;  1ZAV A;  2XTJ P;  1MW7 A;  3GFH A;  2V4R A;  4OYP A;  4KYZ A;  3ONQ A;  3I4N K;  3HT0 A;  5M3F K;  4A8W A;  3NP5 A;  4BC9 A;  2CKW A;  2FHM A;  3PHE A;  4LVO P;  4H4M B;  4HHJ A;  4LLG A;  1JX4 A;  4EGL A;  3UVJ A;  2JC0 A;  4LF8 J;  3PDN A;  1DLO B;  3SMZ A;  3DLK A;  5AXL A;  1LWF A;  1RWW B;  1NH8 A;  2I9S A;  4IDK B;  3VAK A;  1OYE A;  1TU0 B;  4UZC A;  4R25 A;  1DBD A;  4ZCM A;  3MZI A;  3V4I A;  4A3I C;  2XLK A;  1IBM F;  4KGX B;  2AEJ A;  1RT2 A;  4ZVO B;  2GX8 A;  1BWV A;  3FRZ A;  2VA2 A;  3OQ2 A;  1R9T K;  3ZTO A;  2XUL A;  3JTO A;  1WUU A;  1WKK A;  1EX8 A;  1OS5 A;  3E51 A;  5IWA J;  1UJ5 A;  3EM1 A;  1VQY A;  2R7U A;  2D3U A;  2C3Y A;  3A13 A;  2QMU B;  4KMU A;  1SJF A;  1UVK A;  4H4O A;  1S6U A;  2ZNZ A;  2FYX A;  1LW2 A;  4LFA J;  5G0R A;  5FLM K;  2J6U A;  5HAT A;  2LMI A;  1SH2 A;  1DFD A;  5ITH A;  1ZZF A;  4KTQ A;  1OSD A;  1U0H B;  4D3H A;  3DOM A;  4K59 A;  2RU3 A;  4J9L A;  4C8O A;  2A0F B;  1RTZ A;  3W2V A;  4LRA A;  1B7F A;  3T02 A;  3ENQ A;  1RWN B;  4LF5 F;  2POK A;  4IFV B;  2JLE A;  3M8Z A;  2HRT A;  2A10 A;  2RDI A;  1ZBT A;  1EI6 A;  4PRF A;  3F56 A;  1MMD A;  1VH2 A;  2OD4 A;  2XSJ B;  3FRY A;  3RRK A;  3HHK A;  2ZVI A;  3QSY B;  4DQR A;  2MQN A;  2VDI A;  4FVM A;  4P9S A;  2FJB B;  1RU0 A;  2VAS A;  3HFZ B;  3DRP B;  1RTI A;  3DRY A;  3BR8 A;  4B3M J;  2IJR A;  4A4J A;  1IKX B;  1MSW D;  4AXI A;  4QWA A;  3KDO A;  1HYS B;  4DXL A;  4XLN A;  1TWA K;  1FKP A;  4NWB A;  4M5H A;  4B9U A;  4A8K A;  3TW0 A;  2HNY A;  5LL6 d;  1DCO A;  1WF0 A;  1SKS A;  1N33 J;  2FQQ B;  2GJF A;  1V5V A;  1YJN S;  4ED2 A;  2RT3 A;  1YBU A;  5D77 A;  4ZVH A;  2COL A;  2XMM A;  2V4J A;  1FJG J;  2AP6 A;  5B0B A;  1BQX A;  2FZG B;  2JL9 A;  4DU7 A;  3RZO C;  1U0S A;  1OQ6 A;  3PRV A;  3QZ8 A;  1Z1Z A;  3WIU A;  2VPY B;  3S01 A;  1I94 J;  3K7R A;  4ZVR B;  1EQ0 A;  5SZT A;  3LP2 A;  5D4P A;  2QE5 A;  2D3Z A;  3M32 B;  1Y9O A;  1CG2 A;  1V3Z A;  1F5B A;  1KWM A;  2LQJ A;  4LK0 A;  1YHQ S;  2NUU G;  3TJ9 A;  1SJR A;  2CAD A;  2C2D A;  1U49 A;  3H0G K;  3US5 A;  1HLW A;  3W9H A;  2J7K A;  2HRY A;  3TEH B;  1NME B;  2CPF A;  4FS2 A;  4DR4 J;  4OX8 A;  1XNR F;  4KMD A;  4S0M A;  3OHB A;  3CJ8 A;  4RLE A;  3WDO A;  1ZVU A;  4NYO A;  3EXY A;  1SQG A;  2RIJ A;  1Y5N B;  4OIP A;  1PIE A;  1U7L A;  2E7V A;  2AJ0 A;  4TYA A;  4A3E C;  5GAE U;  4F4X A;  3AJD A;  4PAA A;  1S0O A;  3BRE A;  5L1J A;  5CJ9 A;  2DHS A;  4R0E A;  3ET6 A;  4FF1 A;  3KJQ B;  2DPI A;  1U6B A;  1GXU A;  1BD6 A;  5T7L B;  4XCH A;  1D1U A;  4UZB A;  2DR5 A;  3J7Y I;  3ETM A;  4OX6 A;  1NSK L;  2K1R A;  1VRT B;  2QMW A;  2E1R A;  1TL3 B;  1KR4 A;  1Y4Z B;  2KTQ A;  1CJU A;  2CJK A;  3FUY A;  3P96 A;  2G2Z A;  2BM0 A;  3OR2 A;  5I42 A;  2RNE A;  2XG8 A;  1M5P C;  4DG1 B;  2ZFZ A;  2WON B;  2NVX A;  3D67 A;  2FQO A;  2CG4 A;  2WBM A;  4IH7 A;  5IS2 A;  4DV0 J;  3M6X A;  3QIP A;  4IRD A;  2J5A A;  2YWH A;  4OHZ A;  4M5J A;  3H25 A;  3ENV A;  1NRK A;  1C4A A;  2EBB A;  4XPE A;  2H51 B;  2NVT K;  2BJ9 A;  3J81 j;  2NPF A;  1FWK A;  4BDP A;  1QUV A;  2HLT A;  3E01 A;  4BLG A;  3EJM A;  2PPB A;  2VOO A;  1VS3 A;  1S1V B;  3DN9 A;  4I56 A;  2ATC B;  4TQR A;  3GTM C;  1UZD A;  2LQB A;  5K9F A;  1N56 A;  1Z4U A;  3DRR B;  3FEY B;  2HND A;  3M1V A;  2WZ1 A;  4ZHR A;  4BBS K;  3GTO C;  2NQP A;  4JI8 F;  1PKU A;  1RHU B;  2HFO A;  1RT4 A;  3KJV A;  2OFH X;  4UTG A;  4FXD A;  2D6F C;  5GAE I;  1Y1V C;  3AT1 B;  5M5W K;  2MQQ A;  1SPB P;  3Q23 A;  1H7W A;  2ZOM A;  1TUW A;  3P5T L;  5D0G A;  2F4V F;  3TAM B;  2RDD A;  4NOH A;  3LA0 A;  3RB0 A;  5HRO B;  4NZ0 A;  2R92 C;  3GTL C;  3E2E A;  4ECZ A;  2L9W A;  4USI A;  3BO4 A;  3C2P A;  5DDP C;  4X2B A;  2ZBQ A;  1T03 B;  1AW0 A;  4LF8 F;  3QGI A;  4KHR A;  1F3F A;  1DTQ B;  3CVK A;  5HAN A;  2LXU A;  1B99 A;  1TWF A;  4G0V A;  3IS9 A;  2QZ8 A;  4YN3 B;  4A3L K;  2PA8 L;  1JNZ B;  2B4P A;  4ILR A;  4PQU A;  4KN4 A;  4DPU A;  4FZB A;  3KLH A;  3M9M B;  2XCR B;  3E8O A;  5LM7 E;  2FLL A;  2DR8 A;  1TMM A;  6AT1 B;  3G6V A;  4P7T A;  1SFO C;  2YBV A;  3SEO A;  4JV5 F;  3CC2 S;  2BX6 A;  5E33 A;  2FC9 A;  1CJV A;  2Z0G A;  3OSN A;  2W9A A;  2F1F A;  4BBR K;  4JOU A;  3RB6 A;  1UVJ A;  3OTO J;  4F67 A;  1MLA A;  2UVU A;  1RWV B;  4RW6 A;  2J9D E;  1KNZ A;  3I31 A;  1QTN B;  5E7O B;  3PKY A;  3W5Z A;  3R1L A;  4LRC A;  3MMC A;  5DG9 A;  1EHW A;  3DLG A;  3AOB A;  4DN9 A;  1S6P B;  3OUY B;  1S72 S;  2YU9 A;  3EVW A;  5E5N A;  3J7Z 5;  3UQS A;  2A68 A;  3B6B A;  4P2S A;  2BUN A;  1U1P A;  3PTW A;  1ZH5 A;  5DM6 Q;  2PEH A;  2FIU A;  3AJ1 A;  1O2B A;  4BXX K;  2DR7 A;  4V19 X;  1KD1 T;  2MLY A;  4WFZ A;  4JV0 A;  3TAN A;  2ZM6 F;  3KHG A;  3QX3 A;  5M2P A;  2ASJ A;  5FJ8 K;  3MM6 A;  3TJ8 A;  1LOU A;  1YIJ S;  2OGU A;  2IAJ A;  1S6Q A;  2VD3 A;  4NZ6 A;  1QDU B;  4WIQ A;  1B70 B;  3R5D A;  4KFB A;  1PYS B;  4K4U A;  4ED5 A;  2WVE A;  1ZA2 B;  4DCO B;  3UCZ P;  1Q95 G;  2VG7 A;  4I2Q A;  2BM1 A;  2OPR B;  4O3Q A;  3LTO A;  1RSC A;  3BGL A;  4AT1 B;  4XPC A;  1BQM A;  4RBU A;  1XC9 A;  3W64 A;  3FFI B;  2CQP A;  2HIQ A;  2LEP A;  3HOX K;  1SCJ B;  3PIO Q;  2DHX A;  1RYS A;  2E2I K;  2Y3P A;  1TWH K;  2PMZ L;  3RW6 A;  4DN0 A;  2YX7 A;  4FS1 A;  4JI7 F;  3RJM B;  4ZIT A;  2CNK B;  3NAI A;  1XMO F;  3DM2 A;  5KT2 A;  3GIJ A;  1Q79 A;  3CJ5 A;  3CJ4 A;  1CS4 B;  1R8P A;  4WJB A;  1HW8 A;  1AB8 A;  4CTA B;  3M3Y C;  3TRG A;  2HVI A;  3GTJ C;  1RBO B;  1RI7 A;  1O8B A;  5KFC A;  1WDD A;  3HOV K;  1H72 C;  3CXC R;  3S6E A;  1JKH B;  1FDN A;  4K4Z A;  2WOM A;  1R6V A;  3U1M A;  1MG7 A;  2LDY A;  3TR5 A;  4K4W A;  4KPC A;  4JI6 F;  1WOR A;  4AL5 A;  3TNV A;  3K5M A;  1I3Q A;  5TMF A;  1S0N A;  1IJF B;  3FDS A;  4NCG B;  1OPI A;  4DU8 A;  3FK4 A;  2P8I A;  1N5S A;  2VC1 A;  2G2O A;  3C19 A;  4WPA A;  4LF4 J;  3NGD A;  1ROF A;  3IGV A;  2HQ3 A;  3GR0 A;  3O6Q A;  4IG3 B;  1F60 B;  1JLA B;  1QJH A;  2M3D A;  4A3G K;  4G6V B;  3QWU A;  2V2K A;  3GIM A;  3OPK A;  2XMV A;  2ADB A;  4P72 A;  1T05 B;  2L08 A;  4KH0 B;  3CDB A;  3CJT A;  4YR0 A;  1D9D A;  4A3B K;  3UDL A;  2HS0 A;  4JI0 J;  3FQL A;  4IYQ A;  4B9T A;  4C3I K;  2YKQ A;  1UVL A;  3VHQ A;  4QWE A;  2YNF A;  2J9E A;  3EE3 A;  4B9V A;  3TI0 A;  1S4E A;  3MD3 A;  2W2O P;  4MAK A;  1RTD B;  3M2R A;  4CQ1 A;  4XK8 C;  3HK2 A;  4C2M C;  3AQO A;  4PCQ A;  1RYR A;  2Z8Q A;  5FJ4 A;  2NXJ A;  2CQH A;  3S2H C;  5F8L A;  3RB4 A;  4L74 A;  3IMQ J;  2K3K A;  3CIM A;  2JEJ A;  2E5G A;  1P8G A;  4LFB F;  3GG1 A;  3DGP A;  4FPR A;  2CQ0 A;  1DTT B;  3GIL A;  2I2Y A;  2KO1 A;  1LFW A;  3GEE A;  2H48 B;  5K5M A;  4K7Q A;  1EAR A;  1GH8 A;  2YTC A;  2KRR A;  5C42 B;  4O3P A;  3SDE B;  2YNG A;  1MU2 A;  1B0T A;  2NZ4 A;  1JLG A;  5LSL A;  2FC8 A;  3UI3 A;  2V5H G;  1TK8 A;  3GCW P;  2PO4 A;  3F44 A;  1JLC A;  2KM8 B;  3W2W A;  2ZHB A;  1AZS A;  4F02 A;  2R2S A;  1AFI A;  3LAP A;  5KG7 A;  1L3U A;  2FJA B;  4YFU A;  2JVO A;  3NWG A;  2LYV A;  2PA8 D;  1S1X B;  4NEZ A;  4DS4 A;  2B4U A;  4M8L A;  3KG0 A;  1S5Z A;  3RZA A;  1OY9 A;  4KT0 C;  1IKV B;  1N8R T;  4KV8 A;  4J3N A;  4LF2 A;  2RS2 A;  2PFD A;  3BKF A;  1ZM3 A;  1VQL S;  4F2S A;  4ZVS B;  4EU0 A;  2QA1 A;  2W9B B;  4IFY B;  4GMK A;  2Y1R I;  1WC6 A;  4N41 A;  3PNI A;  1KFD A;  3W7B A;  3C66 A;  5JVG Q;  3S0X A;  2YWK A;  1E6V A;  3THV A;  1X9W A;  1FKO B;  1T9X A;  4QW9 A;  4DQQ A;  4G0U A;  3RAX A;  4ZP7 A;  4GRS A;  4MIB A;  2BXJ A;  1NSA A;  4PXB A;  1WI8 A;  2J0W A;  1EP4 A;  4A3M K;  2UXC F;  1RT3 B;  1USO A;  1X4D A;  4ZPC A;  3ZFV A;  4ZKA A;  1NPP A;  1F2H A;  2G1D A;  4RNO A;  2HHP A;  4NCA A;  4RW8 B;  4X4T A;  2XCP A;  2MSS A;  3PYF A;  1Q16 B;  1B4A A;  4H4K C;  5F8G A;  2Y8W A;  2AGQ A;  2HQC A;  3W5X A;  1YZ6 A;  1YJV A;  2VPW B;  1FFS B;  1U1O A;  1V5I B;  4DL5 A;  2B9W A;  2VZ9 A;  2RU9 A;  5B09 A;  5ETQ A;  4OYW A;  2BDP A;  3R5B A;  1BDF A;  1IBK J;  3GYN A;  1YJU A;  1JK9 B;  3S8S A;  3BR9 A;  3WOD A;  3QLH A;  3GII A;  3BV8 A;  3RYL A;  2O01 C;  3C14 B;  3AA8 A;  1BWE A;  2ROP A;  1UJ6 A;  1LNQ A;  2W8L A;  1VBY A;  3BPD A;  5LT5 A;  2MXY A;  3GTK C;  1QY7 A;  2R93 C;  4HLB A;  4KQZ A;  4EMD A;  1DQ8 A;  5KG6 A;  5D4D A;  3T1H J;  3GTP C;  2PMZ D;  3VAJ A;  2B63 C;  5C44 K;  4FDF A;  2ALZ A;  1RZM A;  2OJ3 A;  4C3J K;  1C1B B;  4ZVE A;  5M5Y K;  4QZV B;  2H1Y A;  5C24 B;  1FEH A;  3CMA S;  5L8R C;  1TKZ B;  3T41 A;  2NVX K;  3QGG A;  4PQA A;  2FD2 A;  1Q4R A;  2LA6 A;  3SYZ A;  1C2P A;  4BS2 A;  1XPP A;  2HS3 A;  5AXM A;  2Z2Y B;  3HHE A;  3T1Y J;  4CH0 S;  3IR7 B;  4X62 F;  2PDA A;  4PWD B;  2G4B A;  3TAQ A;  2WAQ L;  1KKH A;  3BGR B;  2MY7 A;  3T5J A;  3HT3 A;  1GX6 A;  1SJ4 P;  4P71 A;  2EFV A;  2XLI A;  1Y00 A;  4Z37 A;  2E9R X;  1WJ9 A;  3GYX B;  4ZLJ A;  2NPI A;  2P6S A;  4O3S A;  3KLG B;  2CVI A;  2ROG A;  3QZ7 A;  5A8W A;  1UW4 A;  1AT1 B;  4WJ4 A;  1F5A A;  4KAW X;  1FF2 A;  2GGP B;  3LQV A;  2V69 A;  2AJF E;  4EUV A;  2ZH1 A;  3MFI A;  3PO2 C;  2KM8 C;  5D0E A;  2BJD A;  3KHH A;  3MF5 A;  1XR5 A;  4X65 J;  4C8M A;  1DRZ A;  2K7J A;  2F8M A;  1S77 D;  3GG0 A;  2PI4 A;  3IO1 A;  4HT5 A;  1X4A A;  3U7J A;  1WTB A;  1DJ0 A;  1J98 A;  3PY8 A;  1LWE A;  4WIL A;  2LQ5 A;  1S97 A;  4FF3 A;  4M5K A;  4Y52 C;  2C22 A;  2QYG A;  4CWB A;  3EX7 B;  4JI3 F;  4KB2 A;  3DDN A;  3IP0 A;  3NMR A;  1TWF K;  2E2H A;  1YLX A;  3W8P A;  4KRW A;  3GV5 B;  5DRK A;  1JB0 C;  1NKB A;  5JJB A;  2VU5 A;  1NPK A;  2OMO A;  3LWL A;  3OJU A;  1J5E F;  3TVK A;  5C7P A;  1FFG B;  2JNJ A;  1ZAX A;  5DQI A;  3N9U C;  2YWF A;  1RQ0 A;  4MKY A;  2RRN A;  5C4J K;  4K8R A;  4LF1 A;  4QWC A;  5H9E J;  1RGV A;  2VB6 A;  4KC5 A;  3GV8 B;  2JC1 A;  5I3P A;  3L9Z A;  4ZP6 A;  3BP8 C;  2R7Q A;  1NDC A;  1KN6 A;  2YX1 A;  4ETX A;  1W2I A;  1NCL A;  3V81 B;  4ZN1 A;  9ATC B;  4OZJ A;  2JA7 C;  3C3L A;  1KBR A;  1R7I A;  2GMH A;  4NLT A;  2ZJR Q;  4A3K K;  4DMZ A;  2XM3 A;  3HZE A;  3OFH A;  4QWD A;  1URN A;  2YU9 K;  5KT4 A;  1BGW A;  3TA1 A;  4UUX A;  3S17 C;  2OLW A;  3WHI A;  3BP3 A;  2R7W A;  1N6Q B;  5F3Z A;  3LAN A;  2CPH A;  5C25 A;  4M5D A;  3NBP B;  2AU0 A;  1Q0N A;  2H3E B;  2DGV A;  4B9L A;  2V6S A;  3OVS A;  5DZ6 A;  5KG1 A;  3PX4 A;  3JAM Y;  5J2N B;  5KG4 A;  3HOW K;  5J1N A;  4J91 A;  2QLB B;  3EXC X;  4DX5 A;  5K14 B;  4MH8 A;  2XQC A;  4WXW A;  4I67 A;  5L46 A;  5LMN J;  3KG4 A;  1IR2 A;  2JA8 K;  4DV6 F;  5C4X C;  3CJ3 A;  3PFO A;  4J9M A;  1O27 A;  2VFR A;  2RB7 A;  1UTA A;  4WTY A;  2HVD A;  2W9C A;  1AUD A;  2VF3 A;  2YNI A;  1W7W A;  3V5R A;  2CJB A;  1H2V Z;  2HWT A;  3IBF B;  5H9F J;  2V9W A;  4HVZ A;  1W2B R;  3KWM A;  1DQA A;  2ZBC A;  1I6H C;  1QTM A;  4M94 A;  3OFG A;  2Q66 A;  2RQ4 A;  5ETK A;  1TUV A;  1S1W B;  2L3M A;  1ZTW A;  2ZUA A;  1A7G E;  1YG0 A;  2XNQ A;  1N52 B;  2PT0 A;  1DAR A;  5IP7 K;  3GWC A;  3DLE A;  1I3Q K;  1BQN A;  1HWI A;  3MD1 A;  3PO3 C;  4FBU A;  4ZVG A;  2GIF A;  3CD6 S;  3CW2 C;  4I7F B;  4UST A;  4DUZ J;  3HHL B;  1OWX A;  1F2G A;  4J5O A;  3D6T B;  1YJ9 S;  1NO8 A;  4PG8 A;  3PYD A;  4CT8 A;  3DYA B;  5HBM A;  3K8V A;  2HMI B;  2YKM B;  1TUG B;  1WAC A;  1HA1 A;  4DV4 J;  2DVI A;  2AWZ A;  3DXB A;  3TZY A;  4LOW A;  3T5K A;  1XBW A;  3HD1 A;  2AEM A;  3W1Y C;  3CJ2 A;  3TUJ C;  3G4A A;  5A6P A;  2E2J K;  2L48 A;  4A8O A;  3F73 A;  3H42 A;  5B0F A;  2W4P A;  1KP6 A;  3V6D A;  5ETT A;  1JNR B;  1GFW B;  4RW4 A;  1E6Y A;  2BKP A;  3HUL A;  2HFV A;  3HOY C;  2CJQ A;  1WHW A;  1ZM4 A;  1MN9 A;  3POT A;  4KC6 A;  1CUL B;  3IR5 B;  5CYJ A;  4I2P B;  1KC8 T;  4K4T A;  3H8Y A;  2BE7 D;  1NM2 A;  2DK2 A;  3TAP A;  4EYI B;  1GMW D;  2VC0 A;  3VF0 B;  3CJ0 A;  4J9O A;  5IOR A;  3BUE A;  2RKI B;  2WAQ D;  3CJK B;  3Q89 A;  3T1H F;  3MMJ A;  2BQ3 A;  3PX6 A;  1W25 A;  4I68 A;  2VQE J;  4M5N A;  1VQM S;  2HSE B;  1Q5V A;  4NLR A;  4C8Z A;  2Z58 B;  3JQJ A;  3JSY A;  3NLC A;  1RAG B;  4LRB A;  1WC0 A;  1RB0 A;  3VGS A;  2C2O B;  4MYU A;  2IM1 A;  5D4O A;  1S9F A;  4ANE A;  2GS8 A;  4ZP9 A;  1U1K A;  1QVG R;  2QC3 A;  5AJ3 J;  3RRH A;  3IGN A;  3PW7 A;  4H4M A;  3ELH A;  4G1Q B;  4DSJ A;  4ZLL A;  3MCS A;  1UVN A;  3MPV A;  4J9K A;  3LAL A;  2A6O A;  2MQL A;  4BY7 C;  1DLO A;  2DJW A;  4HDG A;  1HR0 F;  1U8S A;  2BRL A;  1NKC A;  1G7C B;  2PD1 A;  4L6V 3;  5J2Q B;  1GTE A;  5KFW A;  2F63 A;  2HWH A;  2Y3Y A;  5DO2 A;  3K5L A;  3PYE A;  2V4Q A;  1IUJ A;  1VQN S;  4GKJ J;  3AXM A;  5IQ6 A;  5C3E K;  2I0X A;  2JHE A;  2DGO A;  2F40 A;  4C45 A;  1SH3 A;  4X4V A;  2LDI A;  3I0R B;  3UPF A;  1SJ1 A;  2HGL A;  3D54 A;  3CQZ C;  3B4M A;  3QAU A;  2F9J A;  2WHO A;  2DGS A;  3HFK A;  3UNY A;  1HWL A;  2LXI A;  4Q8F A;  1L3K A;  2HAI A;  4O4R A;  3HSJ A;  3G4S S;  4N5S A;  4J9N A;  3AD9 C;  1U0H A;  1VQ9 S;  5TMC A;  3VR1 A;  5KFU A;  1V6H A;  4UOF A;  2XMU A;  2XCQ A;  2LXF A;  3AAW B;  1K1Q A;  2CVE A;  1UVM A;  4IFV A;  2E1P A;  2E7W A;  3BKU A;  3SQO P;  3R5J B;  4NXN F;  3GTM A;  4OZ1 A;  3PJX A;  2MLX A;  3GIR A;  2XSJ A;  3IRX B;  4WP8 A;  1JLQ B;  5IC6 B;  1FRX A;  2FY1 A;  1YRT A;  1HNZ J;  1U1N A;  3GTO A;  3GFY A;  3T01 A;  2IMO A;  2CYY A;  3K17 A;  3AB2 B;  2C28 A;  3MAA B;  3KXD A;  2HQD A;  1ACM B;  3DRP A;  2OPS B;  1IQT A;  2ZBR A;  1OIA A;  1FI4 A;  1IKX A;  2XZD B;  4JUZ A;  3MM8 B;  4W4M A;  1HYS A;  2C2Z B;  3UWT A;  5A0Y B;  2XLJ A;  4WK1 A;  1OPZ A;  1IXK A;  1FNO A;  3QJP A;  3AOA A;  4M1X A;  3OFF A;  2V2Z A;  2B4O A;  4HH1 A;  1C0U B;  3FKI A;  2ZZT A;  5J1E B;  4LF9 J;  4FF4 A;  4Y7N C;  1VQ5 S;  1LW0 B;  1BXN A;  1U24 A;  3N5B A;  2UUA F;  2DGU A;  2VBW A;  5IYD C;  1HD0 A;  1CJT B;  5B0D A;  4AXJ A;  3JAM U;  2A6M A;  4NXM J;  4YDX A;  1AFJ A;  2VJU A;  3M32 A;  4DFP A;  3A3O B;  4MKB A;  4X4P A;  2W2M P;  1EJ7 L;  2Z4P A;  4GVB B;  1FDA A;  1RTH B;  2QSW A;  1UKU A;  2V8V A;  2ACM A;  1PBU A;  5IV3 A;  5IQQ A;  1I3O B;  2X1G A;  2FZK B;  4ALZ A;  5F41 A;  3UDC A;  2QJ3 A;  1NK9 A;  4TKT A;  4DV1 F;  4LF7 F;  3R5A A;  2CQC A;  3ZZO A;  1AA1 B;  3NAH A;  3HVW A;  2BYC A;  4HHU A;  2XMA A;  4RU2 A;  4H54 A;  4DR5 F;  2H4W B;  2R7Z C;  2QA2 A;  2ACY A;  4KH1 B;  2W8K A;  1LXJ A;  1YCL A;  5T7L A;  2SXL A;  4FKY A;  4EK2 A;  3S1R K;  3ENW A;  4I6A A;  2KZM A;  5HMW A;  1Q8K A;  4XTT A;  4RZR A;  4ELV A;  4ZVT B;  1VRT A;  2GV1 A;  3PAC A;  1TL3 A;  2O5D A;  2XMT A;  4F04 B;  5LMU F;  2D3O R;  1X8D A;  4DUY F;  5EGH A;  1I50 C;  5CYM B;  2JEF A;  3PIP Q;  2IM2 A;  5JFE A;  4RNM A;  4PXC A;  3JS9 A;  3GE9 A;  4K50 A;  3W3S A;  2KU7 A;  3OW2 R;  2E2H K;  4MEX A;  4OZL A;  5GMD A;  4P2F A;  2WON A;  4DV5 J;  4OV6 A;  3R2C J;  4JI2 F;  2J6T A;  1S79 A;  3RUB L;  4IRC A;  3IBW A;  3O2I A;  8ATC B;  3NL0 A;  4U7U D;  2ZVS A;  4MK9 A;  6FDR A;  2JZ5 A;  2VQF J;  1KQK A;  2QRR A;  2CQ4 A;  1S1V A;  4URG A;  2HGN A;  1WKJ A;  3HO1 A;  3PFE A;  2EK6 A;  1NJY A;  5IOS A;  1SL0 A;  3C15 B;  4AUK A;  3EWG A;  3DRR A;  4ECT A;  2IA0 A;  4F3Q A;  2DIT A;  3MEK A;  3ILO A;  2KB2 A;  2CJX B;  2VQE F;  3MWB A;  4DL4 A;  1SKU B;  4OZ2 A;  2UVR A;  1NK4 A;  4JI5 J;  3MMB B;  2CZV C;  1RIS A;  2ZH6 A;  1SQF A;  1YBA A;  2IIH A;  3JSB A;  2UUW A;  3TAM A;  2M4M A;  2LLZ A;  4A3I K;  2XY6 A;  1O29 A;  2ASY A;  3MR7 A;  1ZXO A;  5HLF B;  4BY1 C;  5HRO A;  2N4C A;  3D0G E;  1KVK A;  2KFY A;  4TU9 A;  3D9B A;  2WW4 A;  4IRK A;  2BJ8 A;  1T03 A;  3SSQ A;  3KLF B;  1DTQ A;  1R8C A;  2IVF B;  1TFW A;  3M2U B;  1T3N A;  1YKW A;  1HNX J;  1VOM A;  3U02 A;  5HMZ A;  3MOJ B;  4C2M A;  4KHP J;  4ZH4 A;  2EC0 A;  4GKJ F;  2BJ3 A;  3IN5 A;  3NXZ A;  2VBZ A;  4YFX A;  4NE9 C;  5RUB A;  1FXL A;  2F8H A;  3ENA A;  4Y65 A;  1FE4 A;  4QJV B;  1JIH A;  2IRU A;  2VBX A;  5F8J A;  4WU3 A;  2M8H A;  2NXE A;  4KB7 A;  4C8L A;  4LQY A;  1K1S A;  1VRQ C;  2AX1 A;  3LAM A;  4F0H A;  3DXS X;  1O51 A;  3N01 A;  5IT0 A;  1Y10 A;  3QT7 A;  3KUE A;  3MPU B;  3M2V B;  4NX9 A;  1KSP A;  2CFX A;  2GZO A;  1R27 B;  2QX0 A;  3GTY X;  1FX4 A;  2E7X A;  1S6P A;  2DGX A;  3OUY A;  1HMV B;  3GJQ B;  1USM A;  1G4C A;  2EG2 A;  2QMX A;  3OXL A;  2OSQ A;  1RT5 B;  3GEI A;  2BQU A;  3QFH A;  2ASL A;  4EO8 A;  2RHQ B;  3DOL B;  4Y2C A;  2DNR A;  4L76 A;  4X84 A;  1HIY A;  3O3L A;  4ENO A;  4BKW A;  4QIW L;  2AHO B;  1S7H A;  1QUP A;  2MY8 A;  3A8E A;  4F3M A;  3ILJ A;  4NA3 A;  1WG5 A;  2ZH3 A;  3TQ1 A;  4YY3 J;  4UUW A;  1ZPV A;  2OPR A;  1GMV A;  2NSC A;  4RMF A;  1QAX A;  3FCV A;  4ZK7 M;  3MPW A;  4AE5 A;  3FFI A;  2AYB A;  2AW0 A;  3L7P A;  4HAC B;  5K8M A;  4FBT A;  5GVQ A;  5L9N A;  3LOU A;  4EZ6 A;  3FKB A;  2CQ3 A;  2UV8 A;  2KVI A;  1R9T C;  1CS4 A;  3CED A;  4HH0 A;  4DR3 J;  4CTA A;  1IQZ A;  2EBE A;  3KJN B;  3UR0 A;  2Y1J A;  3HOU C;  4B3T J;  4LR7 A;  4GT9 A;  2ZDO A;  1IM4 A;  1YRX A;  1JKH A;  4J9V A;  4TVA B;  4Q44 A;  1TV6 B;  4I6Y A;  2VHG A;  4JK1 A;  4A3E K;  5FLM C;  4N7T A;  1X5P A;  4FNH A;  3W8G A;  5CA5 A;  4CO3 A;  1K0T A;  4NCG A;  4LSN B;  1SBR A;  1MMN A;  5KFE A;  1TWG A;  2A1B A;  3OR1 B;  5KFZ A;  2J8S A;  4OYB A;  5GME A;  4QWB A;  1WKL A;  2FDN A;  4C97 A;  4OX9 F;  4WJ3 M;  3U1N A;  3IAM 9;  1NAQ A;  2HVH A;  3H2V E;  5IYB C;  4IG3 A;  2QSF A;  2MEW A;  1UW9 A;  4O0I A;  2N3O A;  1JLA A;  1S0M A;  1XNQ F;  1YNN A;  1UMJ A;  1YNJ A;  3NGK A;  1ZOT A;  4KR0 B;  5DET A;  2V6U A;  3OBI A;  3HZG A;  5HMY A;  4FZV A;  1T05 A;  1RTJ B;  4GTA A;  3GTK A;  2ZJQ Q;  1T02 A;  5KFJ A;  1P9Y A;  5IOT A;  3PO4 A;  3GTP A;  3OFE A;  5BR8 J;  1RT6 B;  3QRR A;  3K7A C;  3AD8 C;  2C2M B;  2V2V A;  5KFR A;  3BQ1 A;  2FHK A;  2J7W A;  2XS5 A;  2KFN A;  1RTD A;  4G1I A;  3SIP B;  2XWY A;  4CLP A;  1U6F A;  1EH1 A;  2WVD A;  4JI1 J;  5F8H A;  1T9T A;  1NKE A;  1VJE A;  2CQD A;  3OV7 A;  1R0A B;  1FRK A;  2HW3 A;  4ZOS A;  3D5M A;  4IH6 A;  4XIU A;  4G0W A;  2KI2 A;  4OLO A;  1DTT A;  2AKW B;  1S9G B;  2LCW A;  4DV5 F;  1DCP A;  3GTM K;  4O4G B;  4UOC A;  3S16 K;  4NLX A;  3M4O C;  3PEH A;  2V6T A;  2DO4 A;  4RWX A;  3H5Y A;  5C42 A;  2ZWP A;  4FKX A;  3GTO K;  2WVB A;  4KGK A;  4WWS A;  3SDE A;  2FB0 A;  3H20 A;  5A76 A;  5I4M A;  1JXL A;  3H0G C;  1L5U A;  4O44 B;  1N5Y B;  3IAS 9;  3D0H E;  1WQH A;  4OYM A;  1CC8 A;  4LBP A;  1EQR A;  3HM9 A;  2BMB A;  2HKE A;  3QJL A;  3O8W A;  1XMB A;  4NLS A;  3P45 B;  2WB1 L;  1EKS A;  1S1X A;  1FWL A;  1CQN A;  3FKI K;  2RF2 B;  2WTF A;  4WK3 A;  4YOE A;  3Q83 A;  1YX2 A;  1IKV A;  5KT6 A;  2BRK A;  2ATL A;  5JVH Q;  4UY8 T;  3AD7 C;  3FSY A;  3M8Q B;  5JUM A;  3VGT A;  4DPO A;  2BE2 B;  4DR2 J;  3NWR A;  2JEI A;  1Q1K A;  2W9B A;  4IFY A;  4C3H K;  1RAE B;  3A4T A;  2MZQ A;  3TTG A;  1FKO A;  2E5H A;  3NG8 A;  5ETP A;  1P27 B;  2MQP A;  1ZBS A;  1F9H A;  4XSX A;  2MKS A;  4NYP A;  1U4B A;  3WZ0 A;  2Q43 A;  1LV5 A;  3LGH A;  3M8P B;  4G7O A;  3KK1 B;  3OXG A;  1FD8 A;  1HNX F;  1RT3 A;  3RG6 A;  2E1C A;  4KHP F;  5B0A A;  1V3R A;  3W5Y A;  3TJA A;  2JA7 A;  4NI2 B;  4OJ3 A;  4OIQ A;  1M1H A;  3WIV A;  3UN5 A;  3NCQ A;  2VPX B;  5KFB A;  3J7A 1;  2CNL B;  4RW8 A;  4DR1 J;  4NLO A;  1O5J A;  1IR0 A;  2HVE A;  2NVT C;  1URR A;  3HP6 A;  1L3V A;  5EHH A;  2ZE2 B;  4QIW D;  2VJV A;  1IWG A;  2IVY A;  1R43 A;  1S0V A;  2OIH A;  1UP1 A;  4KKO B;  1NJZ A;  1HFE L;  3OVA A;  1X60 A;  3PV8 A;  2ZD1 B;  4C0B A;  1NK0 A;  3C46 A;  3C14 A;  1VHF A;  2CJ9 A;  2CFA B;  1RLC L;  3G6E S;  2M70 A;  3KHR A;  5CCM A;  4NML A;  4UW2 A;  3G8T A;  4DCP B;  5FDL B;  2CW0 A;  1CPZ A;  1XXC A;  2UV8 G;  2KXH A;  1O26 A;  1C1B A;  2EG1 A;  2W25 A;  3IFE A;  5C24 A;  1C0A A;  4USU A;  1D9F A;  3MDF A;  3TUP A;  4LR9 A;  1TKZ A;  3MEE B;  5HJY A;  2EWH A;  2RUS A;  4ETZ A;  2FJD B;  2V9K A;  2YPY A;  4A8M P;  2DT9 A;  3AOC A;  2DCU B;  1CSJ A;  4X6A C;  5J1P A;  2MPU A;  2DY1 A;  3BQ2 A;  5A8K B;  3DHX A;  2HHS A;  4MEY A;  3IA0 A;  4A3L C;  4PWD A;  4GTF A;  3PHT A;  3VAL A;  3BGR A;  2J6S A;  1K9M T;  5EWE A;  3EGW B;  1CVJ A;  1K83 A;  3GSD A;  1KLM B;  3L7O A;  4HEA 9;  2W7V A;  2RDJ A;  4Y34 A;  5M2R A;  1DY3 A;  1F9E B;  2P9E A;  5HP1 B;  1XQI A;  1P6T A;  4DR3 F;  3W9I A;  3KLG A;  4A3D C;  4OLP A;  3BGU A;  1NEE A;  1I6J A;  4B3T F;  4AND A;  1GMW A;  1T9V A;  2VIC A;  2GGP A;  3HSD A;  4AD6 A;  4HDH A;  1HNV B;  5E68 A;  4ZCL A;  2DH9 A;  3W65 A;  4DQP A;  7FD1 A;  4YME A;  4CLF A;  4Z2X A;  2ZUE A;  3PYG A;  4IR1 A;  2UXD F;  2PE8 A;  3G71 S;  1VR6 A;  5KFH A;  3N6N A;  2YKA A;  2AQ4 A;  2C1E B;  3J80 U;  2HHU A;  4IQX A;  2YWW A;  2YKN B;  2NVQ K;  4F7V A;  4LIW A;  2YX4 A;  1NSQ A;  2W7O A;  1FDD A;  1WCM A;  3TZZ A;  3UNG C;  1OJ4 A;  3TFJ A;  4FF2 A;  4C2M K;  3BN4 A;  1XNR J;  5I3Q A;  4OZ5 A;  3PRB A;  2NLW A;  4BLB A;  3Q8Q B;  2BAC A;  1XTZ A;  5ADZ A;  1TL1 B;  5A2Q U;  2DPJ A;  4OI1 A;  3MUT P;  5EN1 A;  2V0N A;  2KZZ A;  3BDE A;  3UD3 P;  2EEY A;  3HHN B;  3CO0 P;  3LAK A;  3BO2 A;  2VG6 B;  2FLO A;  3V81 A;  3T19 A;  4A3J K;  4B3S J;  2JX2 A;  3DLH A;  3FMB A;  4USW A;  3CCS S;  2E2I C;  1TWH C;  2GSU A;  2I5J B;  3LWM A;  2J7U A;  2GQC A;  1RXO B;  3RTV A;  1W26 A;  2UVV A;  3EPG A;  4ZVF A;  2JWN A;  3S2D K;  3W61 A;  1ISE A;  4RUB A;  2RD5 C;  3QPI A;  2WB1 D;  3HOV C;  1N6Q A;  2DYA A;  1FJE B;  3H3V L;  1WQG A;  2JVR A;  3NGU A;  3NBP A;  5AE3 A;  4M95 A;  4QCL A;  3KLV A;  1UCN A;  1RHM B;  3VAM A;  3FZB A;  3GMG A;  2E44 A;  3KNG A;  1MRO B;  3CCZ A;  5J2N A;  4FYV B;  4NCB A;  4QIG A;  4WU2 A;  2E29 A;  2CPX A;  2Z56 B;  1N0V C;  3ZO7 A;  3FOF A;  4B3R F;  3OL9 A;  5K14 A;  3H4D A;  1H2T Z;  1F93 A;  4WFA Q;  2VL1 A;  3DXJ A;  2CPD A;  4LJM A;  2G0J A;  2QGF B;  4CLU A;  1YJT A;  3BYP A;  4DDF A;  4BWM A;  1NJW A;  2K3I A;  2C3M A;  1N5Q A;  6FD1 A;  1LXN A;  4E8U A;  4GO5 X;  1TZ0 A;  2LEC A;  5HL8 A;  3CCT A;  1Q8I A;  2B3T B;  4A3B C;  3ZNJ 1;  4HTI A;  2X1A A;  1FA0 A;  3FNN A;  1HWK A;  3FSI A;  4JI8 J;  4C3I C;  1FNM A;  2DNO A;  1IKY B;  1ULR A;  4FP9 A;  4WCE Q;  1S1W A;  1O6X A;  5KOW A;  3NOG A;  3TVY A;  3TFH A;  4Z7Y A;  2V68 A;  3RR7 A;  2FPH X;  2F4V J;  1WHX A;  4DX6 A;  1WOS A;  2IYI A;  3KFW X;  3CTR A;  3CD5 A;  1TWG K;  3LAJ A;  3VAI A;  2RUG A;  3L7U A;  2BW2 A;  4I7F A;  3HHL A;  2DNG A;  2XMJ A;  3O44 A;  3SCJ E;  4F4Z A;  2GC8 A;  2JA5 A;  3KLE B;  4ZJO A;  3DYA A;  2N82 B;  3CCE S;  1QSS A;  1HI9 A;  2XYP B;  2YKM A;  4ZPW R;  2B7C B;  2EFG A;  1P9Q C;  3ILL A;  4DR1 F;  1VI7 A;  4WZQ A;  1WEL A;  5KFD A;  3GTK K;  4FPI A;  3H40 A;  3D3B J;  4MQ9 A;  4JV5 J;  3GTP K;  1OSC A;  4F36 A;  1I51 B;  5DLF A;  2HNZ B;  2WB4 A;  4RNF A;  2DKO B;  1CUL A;  2F3J A;  3C6T B;  4I2P A;  3H0P A;  4F25 A;  2D69 A;  3NOC A;  2H5E A;  1FTC A;  2APO A;  3UN2 A;  2N7C A;  4R8U B;  1XWL A;  2OHD A;  2RKI A;  1DHM A;  2DNN A;  3CJK A;  1X9M A;  3IM9 A;  3T3F A;  1U2F A;  4URQ U;  1FJ7 A;  3TA2 A;  3PW2 A;  4DHV A;  2DNL A;  2HFS A;  3A8K A;  2M7S A;  4TLR A;  5B7W A;  2ZUF A;  2HHT A;  2OEL A;  3FGV A;  2KRB A;  4RW9 B;  2PFF B;  2DIU A;  4PEO A;  4AH6 A;  1X0P A;  2FVC A;  4JV2 A;  1O25 A;  2ZM6 J;  3OJS A;  1D09 B;  3CNQ P;  2R7Z A;  3M9O B;  1ZA1 B;  3ICL A;  1XEZ A;  1WI6 A;  3V6J A;  2R4F A;  4G1Q A;  3D28 A;  2KXN B;  2BOP A;  2OKQ A;  4TYB A;  1BE4 A;  3KK2 B;  2JDJ A;  2XCO A;  2J9D A;  3HKZ D;  4A3M C;  1X4F A;  2RML A;  1H7X A;  4A47 A;  3J7Y U;  4YP3 A;  5J2Q A;  3K57 A;  1GAO A;  4DLE A;  2D74 B;  3MED B;  1RT1 B;  1YWX A;  2R7R A;  2ZC3 A;  3ZZY A;  1X0F A;  2KH9 A;  1SC6 A;  3GB0 A;  2B9X A;  1Q82 T;  4JI7 J;  3I0R A;  2CDR B;  1XMO J;  3CD7 A;  1MNE A;  5HJX A;  5LJ5 Y;  2W24 A;  2A3J A;  3RBD A;  3S14 C;  4NMX A;  4LSL B;  4KO0 B;  2DGQ A;  4R5P B;  4ZPB A;  1KQF B;  1NHV A;  4NLY A;  4IO9 Q;  2ILY A;  3SZY A;  3FBF A;  2Y0S D;  1NK5 A;  2CA9 A;  3T9Z A;  2VKR A;  4JI6 J;  3NGS A;  2GA7 A;  4KAS A;  1P1L A;  1D9A A;  4FYY B;  2YY3 A;  5G4D A;  3A1Y G;  3VAG A;  3VWS A;  3LW5 C;  3DU6 A;  5C44 C;  4L73 A;  4O3O A;  2PI5 A;  2QLJ B;  2PII A;  1TKT B;  3IRX A;  3ZC4 A;  1JLQ A;  3Q2T C;  1JMT A;  4OX7 A;  2EKN A;  4C3J C;  1HHQ A;  4NLP A;  3U1L A;  3EGV A;  1TWC A;  2JA7 K;  3QFW A;  3TVZ A;  2UXB F;  2EKY A;  1KDN A;  4KJI A;  2NVX C;  3MAA A;  1PCA A;  2OPS A;  1KHW A;  1Q8B A;  3H3V D;  4QYZ K;  5GAH I;  3MM8 A;  3S17 K;  4DR6 F;  4G65 A;  5A0Y A;  3GFZ A;  2GVZ B;  4WFN Q;  5GAG U;  3DCA A;  2K06 A;  5CAB A;  4B3S F;  3NMA A;  1Q81 T;  3S1Q C;  2B8P A;  4DL6 A;  2M5Y A;  5IM0 B;  4CI0 B;  2F65 A;  3H4B A;  2DHH A;  1C0U A;  2OPP B;  5J1E A;  4RBT A;  1XIQ A;  3S1N C;  1RHQ B;  4QQB A;  1WWH A;  4DV2 F;  1UVI A;  3T5H A;  1LW0 A;  2CQ1 A;  3PR5 B;  4GTC A;  2YH0 A;  5CYQ B;  3OTE A;  1FES A;  3IR6 B;  4CO0 A;  1CJT A;  1X7V A;  1YK9 A;  4JV1 A;  4LFB J;  2HHV A;  2XMK A;  3JST A;  3O5T B;  4C6A A;  3K2Y A;  1Y5I B;  2H65 B;  1TAU A;  1O0P A;  1SV5 B;  1YJ7 A;  4GVB A;  1RTH A;  3ISN C;  2CRL A;  1VGY A;  3R6L B;  2KHC A;  4M63 A;  5FLX Y;  5J2P B;  2AZ3 A;  3H5S A;  1CBK A;  4MIA A;  1UEK A;  4WZM A;  3KTQ A;  1S59 A;  2MZT A;  4ED7 A;  3DDK A;  4U8V A;  1XZP B;  3M8W A;  1K83 K;  4DL0 C;  3HVT B;  2MQO A;  4N76 A;  4CO2 A;  3PO3 K;  4RR5 A;  1MWQ A;  3VGU A;  2AMC B;  3QT5 A;  4OJ1 A;  5EDW A;  5C4J C;  2AYE A;  3UDE A;  4JI4 F;  2MMY A;  2MKI A;  2DXF A;  1J6W A;  4MKV A;  2AEF A;  3ISN D;  4RNH A;  3J7A N;  2AX0 A;  1PAU B;  1L0W A;  3BEG B;  3UD5 A;  2JH3 A;  1Q78 A;  5GAG I;  3I82 A;  3VVU A;  2R9L A;  3LPX A;  3TUZ C;  4Y2A A;  2DTJ A;  2JA6 C;  1M1G A;  2RVJ A;  3CGI A;  4A3K C;  1EET B;  3LGN A;  3G9C A;  5CYM A;  2YU9 C;  7FDR A;  1S1U B;  3AFG A;  2A18 A;  4OIO A;  1WCM K;  4OFZ A;  2XGQ A;  1QAI A;  2UP1 A;  4ZVU B;  1WSV A;  2UXC J;  1B0V A;  1CQM A;  3OL7 A;  2HHQ A;  2Y1I A;  3AA9 A;  3MM7 B;  1EFW A;  3IWX A;  3V2U C;  3EPI A;  3GTG C;  3HOW C;  2RE1 A;  4PYD A;  1CLF A;  4Q8E A;  3M05 A;  4B9S A;  3VA7 A;  4Q5S A;  2RQC A;  1IL2 A;  3ZXW A;  1JLE B;  2JA8 C;  3PO5 A;  3UD4 P;  5ETM A;  2FVP A;  4F26 A;  4X66 F;  4NZ7 A;  3TWZ A;  2HQG A;  3C15 A;  4UOG A;  2DB1 A;  1VC5 A;  3NGR A;  3PVX A;  1APS A;  4CCH A;  2RJZ A;  3D66 A;  4IOC Q;  2E1A A;  3RR8 A;  4WBF A;  1KFS A;  3R1H A;  1VRU B;  5JXS A;  3TOQ A;  4O3R A;  1EP4 B;  3MMB A;  2HWI A;  1IS1 A;  3KMQ A;  4C48 A;  2XZT B;  4Y2M A;  2FJX A;  2XHC A;  5IXU A;  2V2Q A;  2GQ2 A;  1N32 F;  5HLF A;  2HS4 A;  3NS6 A;  1RBA A;  2V34 A;  1RWM B;  1I3Q C;  1F3V A;  3S1M C;  3KLF A;  4CLS A;  2XB2 D;  5CXT A;  2L9D A;  1PIL A;  1HBU B;  3GU0 A;  4DF4 A;  3PW5 A;  2XHW A;  3M2U A;  1H3D A;  1DZ5 A;  5ETL A;  4X62 J;  5F9N A;  1B3T A;  4P2X A;  3L4K A;  2VFU A;  1RT7 B;  4BHQ A;  4NLQ A;  2ZH2 A;  1N5V A;  3PM9 A;  4EFA C;  4KMA A;  1UV7 A;  3UO0 A;  3KUH A;  4QJV A;  1RU2 A;  5E2Q A;  1U6Z A;  3DLB A;  2J0S D;  3OXF A;  2ZBI A;  1U45 A;  3PRD A;  3MGJ A;  2EBG A;  3RU0 A;  3IG1 B;  2FJV A;  2YWG A;  5H9E K;  3DLL Q;  3MUR P;  4NA1 A;  4A8X A;  2A2C A;  2Y1L B;  4ES2 A;  5BYR A;  1HBM B;  1UET A;  3M2V A;  4I64 A;  4XLP A;  5KFQ A;  4OIN A;  1HMV A;  1QM9 A;  2Q6C A;  5DS7 A;  4L3K A;  2YWE A;  3HSZ A;  3CWJ A;  1RT5 A;  2FVR A;  2RAQ A;  2MKY A;  3VGV A;  4PXE A;  3VZH A;  5HL7 Q;  2JA5 K;  3DOL A;  4WKY A;  5D4N A;  4JI3 J;  3CJS A;  1QAJ A;  1IE0 A;  2MQ8 A;  2MZ1 A;  1FD2 A;  2VV5 A;  3Q8Y A;  4OI2 A;  4I4B A;  1ZET A;  5DDR C;  1J5E J;  4AQY F;  3K89 A;  1JJ2 R;  4WFB Q;  4DCJ B;  2BE9 B;  3MCN A;  2RRA A;  3CC7 S;  3TEG A;  4OYX A;  2IBO A;  4QW8 A;  5DGA A;  4F4Y A;  2DH7 A;  1XMQ F;  3S15 C;  4LQ3 A;  4DFK A;  4HAC A;  4LK1 A;  2GHV C;  2JRS A;  2BAN B;  3B4D A;  4DV7 F;  2I1R A;  2VDH A;  1V9O A;  2DEJ A;  4LUB A;  3PW0 A;  4KGV B;  3BSN A;  1U26 A;  3HHD A;  4ECW A;  4BBY A;  4YHH F;  3JYT B;  4WXO A;  4F0K A;  1U8W A;  2OFG X;  5CCL A;  3BO3 A;  2LVW A;  4HI2 A;  3ZTP A;  1X4G A;  1A6L A;  4X4S A;  1TFY A;  1TV6 A;  4RUA A;  2UUC J;  2CDQ A;  4YFK A;  4NYZ A;  1ZTT A;  2HFN A;  3FEZ A;  4LSN A;  1QLN A;  2NXC A;  2R7Z K;  4ECR A;  2BOA A;  1SXL A;  5FLX U;  5M3M K;  1F7U A;  3W63 A;  2HFZ A;  4M5M A;  3BGO P;  1KLN A;  2CQ2 A;  1KOO A;  5HQM A;  1K73 T;  3KMS A;  3BM7 A;  4DV6 J;  3KDN A;  2DH8 A;  2C3O A;  4DWI A;  3N5F A;  3D6M B;  4ERD A;  1WOP A;  3EZO A;  5E3R A;  3K8W A;  1RTJ A;  4DF8 A;  3A3N B;  2KT3 A;  2DNP A;  3CAG A;  1T9U A;  2QLX A;  1LK5 A;  2ZUG A;  1GT8 A;  4P2M A;  1RT6 A;  1X31 C;  4NPO A;  3GYG A;  4YEA A;  2GNK A;  2HEK A;  2WK4 A;  5D6G A;  3OHA A;  1F7V A;  1UZH A;  2DNH A;  3VTI A;  2PGC A;  2EW9 A;  2VOP A;  4C11 B;  4ZIW A;  2QL9 B;  3HLU A;  3DFE A;  1RLD A;  4DPT A;  3EIC A;  2VUG A;  2CPI A;  1X5S A;  4N56 A;  3H5U A;  3B82 A;  2YQ3 A;  5A8R B;  4ELU A;  2HGM A;  2VFV A;  4JYA F;  4GFQ A;  1R0A A;  3MTJ A;  2V50 A;  1IR1 A;  2CWX A;  5BXI A;  3FBE A;  1S9G A;  3GPA A;  4O4G A;  5HSP A;  3I9Z A;  1VFJ A;  1WSR A;  1QSY A;  3TYT A;  3R9L A;  3GSI A;  3GP9 A;  2W9C B;  3BBC A;  1TWC K;  1HNI B;  1JXE A;  3KYL A;  1U09 A;  2I6W A;  3P5B P;  1JLF B;  2XC9 A;  2PEB A;  3RW7 A;  1B4S A;  2X51 A;  5L39 A;  2ZWO A;  3C6U B;  2ZZM A;  1K8A T;  1IN0 A;  3DMJ B;  4XSZ A;  2DR6 A;  1U02 A;  4EI2 A;  1T9Y A;  4NL5 A;  1OY6 A;  4O44 A;  2HAF A;  1N5Y A;  3BDP A;  3M8S A;  2GML A;  2DHA A;  2VUM C;  1K44 A;  3CF5 Q;  2JSX A;  3EDR B;  2Y9H A;  1UA0 A;  1S1T B;  2A2D A;  5JVO A;  3MI7 X;  1S7I A;  5SUH A;  1TKX B;  1SB6 A;  1WQF A;  4WF9 Q;  3BBB A;  1J6V A;  2RF2 A;  3LP1 B;  2IMW P;  1PAE X;  3H7H B;  3R2D J;  4V1A k;  3MMA B;  3G82 B;  1FRJ A;  3PJW A;  3M8Q A;  2HQI A;  3LPY A;  2BE2 A;  2VG5 B;  5L1I A;  3THP A;  4A93 C;  2HG4 A;  5KFI A;  2HZV A;  3S1R C;  2IYG A;  1RA7 A;  2NRE A;  2X1F A;  3GIK A;  1U48 A;  1X9S A;  2PMW A;  2L9N A;  2OPQ B;  2XI3 A;  1OO0 B;  3TZW A;  2CJA A;  3M8P A;  4JP8 A;  1T7P A;  4ID8 A;  4Q7A A;  2HK2 A;  3KK1 A;  3ZTQ A;  1S6O A;  3BN7 A;  2R7O A;  3WBZ A;  1FRI A;  1CEZ A;  4IR9 A;  2CG8 A;  2OI2 A;  1LWC B;  1H2U X;  4LFC F;  3PCO B;  4NI2 A;  1HR0 J;  2RH3 A;  1LQ9 A;  1IBC B;  3M9N B;  2WBR A;  3JTP A;  1GK8 A;  2NR0 A;  1RWX B;  3H90 A;  4OJH A;  1MN7 A;  2ZZN A;  4LF6 F;  2AD9 A;  2ZE2 A;  2Z57 B;  1RK8 A;  1VK3 A;  4KKO A;  2M52 A;  1HNW F;  5KFK A;  4OV1 A;  4YS2 A;  2ZD1 A;  3BSA A;  1VIO A;  2CFA A;  3MHY A;  1JJC B;  3OTC A;  4ZLN A;  4DSK A;  5FD1 A;  1WC5 A;  4A3F C;  4WFX A;  5CZV A;  3TA0 A;  3OTB A;  1G1X A;  2VIH A;  2G2Y A;  4X4Q A;  2D9O A;  2ZOF A;  4F4K A;  5FDL A;  3NGT A;  5J2M B;  1INN A;  1PSD A;  2ALY B;  3IC1 A;  4NXN J;  5KFS A;  4DQS A;  2DXE A;  2Z2L A;  5HVG A;  1D3W A;  3MCO A;  3MEE A;  2WSE C;  1RKJ A;  2G0C A;  4KPY A;  2NVY C;  4F0M A;  2HZA A;  3M30 B;  2BKO A;  3HOU K;  1HBO B;  3DKD A;  3FHZ A;  5A8K A;  2YQ0 A;  4CP5 A;  1VLO A;  2EPI A;  2AIR B;  3IWL A;  3KOA A;  1XR6 A;  4U67 Q;  4GKK F;  3ITH B;  1HW9 A;  1GEH A;  4ED4 A;  1KLM A;  1GXT A;  5IYC C;  3MML B;  4B9M A;  1JJ4 A;  5HP1 A;  2R3V A;  1RA6 A;  4C9D A;  4V19 J;  2H54 B;  4A8Y A;  1SJQ A;  4U96 A;  1RAC B;  5IOQ A;  4ECU A;  4XDD A;  3H2U B;  5FII A;  5IYB K;  3ETO A;  4YB6 A;  1XR7 A;  2XGP A;  3UCG A;  3MR5 A;  2UUA J;  1P1T A;  1ARO P;  1PJ5 A;  4DZ6 A;  1HNV A;  2JFK A;  2UUC F;  2M0G B;  4OI0 A;  3K5P A;  4MT1 A;  2AGP A;  1RAO A;  4F4W A;  3FQK A;  3HF5 A;  1HPZ B;  1G6B A;  4PKD B;  2HRU A;  3BH6 B;  2OUG A;  1NUE A;  2ZNY A;  1Y5L B;  3UDV A;  2RQK A;  1JVI A;  4MIW A;  4UF4 A;  1BHN A;  3KJF B;  3K7A K;  1NK8 A;  2IDL A;  1HBN B;  3HX9 A;  2YKN A;  1U1L A;  2F4F A;  2GFF A;  1Q7L B;  1LEO A;  4KSE B;  1M0S A;  5B0G A;  3ZNU A;  4FN5 A;  2ERR A;  1ZPW X;  4DV1 J;  2V8P A;  4LF7 J;  5CZX A;  2V94 A;  2O66 A;  1XN9 A;  1NXI A;  3SSR A;  4L75 A;  1IKW B;  3DU5 A;  1DUR A;  1SKW A;  4CYU B;  4YUD A;  1TL1 A;  3X3U A;  4DR5 J;  4CO1 A;  3PXG a;  3M8R A;  5KG5 A;  5DM7 Q;  2X3D A;  3M4O K;  2VG6 A;  3P4U B;  4DSF A;  2W2Q P;  3I0S B;  1BC6 A;  2CPY A;  2DIS A;  4B08 A;  5HQ8 A;  3BSC A;  1I5O B;  2I5J A;  4ILL A;  4F3O A;  5HMX A;  3QID A;  1N34 F;  4RKU C;  5LMU J;  2OD6 A;  1WG1 A;  4DUY J;  2XY5 A;  4WP9 A;  3TZX A;  4BWJ A;  1VCT A;  4OZ3 A;  3KK3 B;  3J7Z T;  3HOZ C;  1HAR A;  4RW7 B;  1S4F A;  2P5V A;  3R5C A;  3MEC B;  5M2U A;  1MRO A;  2B9E A;  2R42 A;  1HHS A;  1N48 A;  4ECX A;  4E98 A;  4JI2 J;  3QSI A;  4ICL B;  2WRM A;  5I3U B;  4YG2 A;  4O0N A;  1TL7 B;  1X4B A;  2QL5 B;  4ZJQ A;  4U95 A;  5DLG A;  5IFM A;  1Y7P A;  3CO9 A;  2XSF A;  4G3I A;  4K0K F;  1C0T B;  3GFX A;  2BBE A;  1RAJ A;  2FJW A;  3DLJ A;  2XWX A;  5KFN A;  3IRW P;  4MFB B;  1RAB B;  2NXU A;  3GTQ C;  2R7T A;  3Q0A A;  1FX2 A;  2UUB F;  4Q2M A;  4U7C A;  2AF6 A;  3HSG A;  4NA2 A;  2AJ1 A;  2M9K A;  3C16 B;  3CUN A;  4K4X A;  1V3S A;  3NUH A;  4GTD A;  4P75 A;  1IKY A;  2DNY A;  3VZI A;  1SC1 B;  2D3O 1;  4CLK A;  2GQQ A;  3ZZ0 A;  1IBL J;  2G13 A;  2W4C A;  2MHN A;  3MM9 B;  1Y11 A;  4UQG A;  3I5B A;  5CQG A;  1N5T A;  4JB8 B;  3EYZ A;  3I5C A;  2GSN A;  4GTB A;  2IHR 1;  4P74 A;  3OLA A;  4CLY A;  2DGW A;  4WFY A;  3PW4 A;  2IC3 B;  1RP5 A;  1VIS A;  3WQP A;  1F1B B;  2Q1L A;  3KLE A;  1HQU B;  3MAH A;  2CXE A;  4WE1 B;  2QT7 A;  1T9W A;  4IDK A;  3D7S B;  1EIY B;  1WG4 A;  3S16 C;  3ZZZ A;  3JTN A;  3RZD K;  5AT1 B;  3RRG A;  4Y2I A;  1FXD A;  4Y28 C;  4ZLP A;  2QG9 B;  3N6M A;  2J0X A;  1NJX A;  4CLT A;  2U2F A;  4RWW A;  4NOI A;  4TNO A;  1FKA F;  2E5L J;  5E0O A;  4IH5 A;  2CQI A;  3QWP A;  4QU7 A;  2HVZ A;  2HNZ A;  2WSC C;  3EMT A;  1FRM A;  3C6T A;  1BGX T;  1VQ8 S;  2XEX A;  1FJC A;  2Z30 B;  4BC7 A;  4M5L A;  5CAA A;  2KG0 A;  3AJ2 A;  2AJ4 A;  4R8U A;  3TFI A;  1TL4 A;  2O5I A;  1U25 A;  4X6A K;  3FKI C;  2V67 A;  1VBK A;  4NLV A;  4DUT A;  2D1C A;  1ELO A;  1IW7 A;  2QIF A;  4FYX B;  2RRB A;  4M5I A;  2N3L A;  3BYR A;  3R8Y A;  3BB5 A;  3KLI B;  4Q43 A;  4ZVP B;  1RE1 B;  2BKN A;  4P5B A;  1O28 A;  3F41 A;  2MJN A;  4RW9 A;  4ID5 B;  3Q2S C;  2MYF A;  4KHM A;  3M4X A;  4C3H C;  4AFF A;  2AV5 A;  1GX5 A;  4ATN A;  1KQS R;  1HI0 P;  1WD6 A;  3QQC D;  1S9E B;  4A3D K;  4KAI A;  5IWA F;  1DAX A;  5E3P A;  1XZQ B;  1YTY A;  3UW1 A;  1IWA A;  1X5O A;  1IBA A;  1Y1V A;  2QN6 B;  4YDD B;  4HTJ A;  3KK2 A;  2DGT A;  4LFA F;  2ZHO A;  3VAH A;  1FT8 A;  3LP0 B;  4K5S A;  2KT5 A;  5HVH A;  2XCA A;  2E66 A;  1FER A;  4LRF A;  2BA9 A;  2R92 A;  3GTL A;  2JA6 A;  4TLQ A;  3MED A;  1RT1 A;  3CME S;  5KFG A;  4XDC A;  3D6F B;  3I6P A;  3RAM A;  1NLK L;  4PG6 A;  4K4V A;  2R2T A;  2YNH B;  3MR3 A;  5THW A;  1BS2 A;  2GMJ A;  3UFC X;  4EEY A;  3HJF A;  3JQK A;  2HBY B;  4LSL A;  4KO0 A;  1PC4 A;  4R5P A;  3I4P A;  2LEB A;  3CDU A;  4J37 A;  2BZ2 A;  1EK8 A;  2FTR A;  2MHE A;  3GTG A;  2R7X A;  2UU9 J;  3I87 A;  1UWA A;  1SFO A;  4B3M F;  2KXF A;  4IG0 B;  3MXH P;  5U47 A;  4DX8 H;  2DNQ A;  1C1C B;  1CJK B;  4PUO B;  3SZ2 A;  2IDE A;  5L38 A;  3OD2 A;  5KG2 A;  2QYC A;  3ZZT A;  2RS8 A;  2CAJ A;  3DI6 B;  1N33 F;  2E9T A;  2GO8 A;  1HL6 A;  4OX9 J;  2OH2 A;  1TKT A;  1R89 A;  5B0C A;  4P10 A;  2NYH A;  1QE1 B;  3VQS A;  4ES1 A;  1S48 A;  3R7S B;  1SH0 A;  4L3N A;  1FJG F;  1XNQ J;  4WTO B;  4K5R A;  4DEZ A;  3CD0 A;  2P8T A;  1GE9 A;  4R0J A;  4GC7 A;  2EFN A;  4A3C C;  1FO1 A;  2KJV A;  1UA1 A;  4ZPD A;  1WTF A;  2GVZ A;  4LQ9 A;  1I94 F;  4KM8 A;  1N54 B;  3CJR A;  2IRY A;  1TEL A;  4EBE A;  2UUT A;  2XZW A;  3ERE D;  5IM0 A;  2YPZ A;  3Q3Q A;  4MKA A;  4ED1 A;  2ZDP A;  4ZCK A;  2OPP A;  4C8K A;  4USH A;  1KVI A;  4OL8 A;  1ICE B;  4ZS6 A;  1B64 A;  4QPX A;  4ZN3 A;  4DR4 F;  3SXL A;  1WHV A;  4PAB A;  4PYA A;  1OQ3 A;  5CYQ A;  4PPD A;  1VMB A;  3R27 A;  4ZA1 A;  2FUG 9;  2WSF C;  3L09 A;  4DG1 A;  4CO5 A;  4EZ9 A;  4GC6 A;  3V4M A;  1N36 J;  5IP9 C;  4QIF A;  2XY7 A;  1REG X;  3PR4 A;  1SV5 A;  3TP2 A;  2W2P P;  4G7H A;  1F9N A;  1YZ7 A;  2GHW A;  3GTJ A;  3MM5 B;  4PR6 A;  1J5O B;  1MWZ A;  2V6A A;  5E3C A;  4ECV A;  2NVQ C;  4DR7 J;  2W7A A;  4QU6 A;  4N77 A;  2OSR A;  5J2P A;  4DBQ A;  3MUV P;  2P6T A;  3D1O A;  1UFW A;  1YGY A;  1NPR A;  1UWB B;  2PA3 A;  3RBX A;  1XZP A;  1JQW A;  3HVT A;  3CSK A;  4FXW A;  1WC4 A;  2R8K A;  1WHY A;  4Q45 A;  2NXN A;  1Y1W C;  2JOQ A;  5D8H B;  2WVC A;  1RCO B;  1IBL F;  4ZPT R;  4W98 A;  3G8S A;  1M5S A;  4DV0 F;  1F6T A;  2DRA A;  4QYZ J;  1ZZN A;  2B5J B;  4A3J C;  4JBC A;  4YB7 A;  5D3G B;  3B54 A;  1WC3 A;  1YI2 S;  4USM A;  3N0C A;  2QO3 A;  2VPZ B;  2DIV A;  1EET A;  2GJ2 A;  4LBH A;  4BCA A;  3S2D C;  3A8I A;  4LVN P;  4FVC A;  5GMK a;  4Y0F A;  2FGC A;  1SL1 A;  2KKH A;  5LSR A;  1NB7 A;  1S1U A;  3JQM A;  4FYW B;  3P6Y C;  3CT9 A;  1VJQ A;  2RH6 A;  1KEK A;  1GTH A;  2B6A B;  1EKR A;  2FY8 A;  3GJS B;  1QSL A;  1FE0 A;  3EVM A;  3MM7 A;  1AB4 A;  3I4M C;  2PC6 A;  3LPE A;  3G6X A;  5HO4 A;  3N79 A;  2E5L F;  1VQO S;  2E1M C;  5AE2 A;  2MGZ B;  1X5T A;  2F9D A;  4LRE A;  1FWP A;  3T1A A;  1JLE A;  3Q8U A;  2AGO A;  1T3O A;  3T9N A;  3EGZ A;  2ZH7 A;  1VBZ A;  3MAQ A;  1HWU A;  1MWY A;  4KE5 A;  4C7Q A;  4TY8 B;  3MTK A;  1TVR B;  2KDO A;  4C4W A;  2OEM A;  4NEY A;  5C2G A;  3W66 A;  3Q8R B;  4DFM A;  1VRU A;  4PG5 A;  1JWW A;  5E3Q A;  2DHG A;  1RAF B;  1R8A A;  4KIA A;  5HVF A;  1SC4 B;  1N4L A;  1X4H A;  5EGE A;  3AXK A;  3GJT B;  4CM2 A;  4NLD A;  1FXR A;  4KGM A;  4DQI A;  1YJR A;  3OT9 A;  4YFN A;  4DPX A;  1U1Q A;  3DRX A;  3MOZ A;  3I4N C;  1SQE A;  2H5J B;  4I1T A;  1TWG C;  3WX8 A;  1REV B;  3OTO F;  4ED0 A;  3D68 A;  1HBU A;  2YKP A;  3S14 K;  3RZO K;  2M88 A;  1KQG B;  2ZC4 A;  4KAR A;  2HHH J;  2UZA A;  1VC6 A;  2EI5 A;  1NH7 A;  2XI2 A;  3DRS B;  1HI1 A;  4Q0B B;  3HDS A;  4ZPA A;  1RT7 A;  1F0X A;  4QOT A;  1C4C A;  2GSO A;  1UL3 A;  2QEX S;  2Q3P A;  2GVD B;  3KKF A;  1OY8 A;  3I56 S;  3OLB A;  1IJE B;  1SC3 B;  2KFZ A;  1XK8 A;  1EAY C;  3IWN C;  2C3P A;  1VJW A;  2KT2 A;  5HQL A;  3CMQ A;  2IPO B;  2VFS A;  3SQG B;  5BYQ A;  1KQ4 A;  2RGR A;  3IG1 A;  3H98 A;  2UU9 F;  4QYR A;  1HQE B;  1IVZ A;  4AYB L;  4ZMM A;  1WEX A;  2V63 A;  5KG3 A;  1HBM A;  5LSO A;  2NZC A;  2P2C B;  3FC9 A;  4ZJL A;  4H4K A;  3G86 A;  2XNR A;  4PG4 A;  2UXD J;  3TAR A;  1B7Y B;  3LUY A;  5LXY A;  5EX0 A;  2KJW A;  2VUM A;  3HVA A;  2IJF A;  3J80 Y;  3FOE A;  3S1Q K;  3MPD A;  4GTL A;  4RX6 A;  4OI3 A;  5EWF A;  4FNI A;  2C42 A;  4KB4 A;  1FHT A;  2UVW A;  3S1N K;  1TR0 A;  1GXL A;  2MJU A;  3BS9 A;  1VHI A;  2B8Q A;  2NS1 B;  3PG9 A;  2R93 A;  2G9O A;  1VBX A;  1L3S A;  1HQ2 A;  1RCX B;  2B63 A;  2GJI A;  4KDD A;  3N3Y A;  2BV3 A;  1RU1 A;  2VOD A;  1TWA C;  4QR2 A;  4N8N A;  1HD1 A;  5A2Q Y;  9RUB A;  1M5H A;  3ZTS A;  2BAN A;  3WC2 A;  3N6L A;  3A8J A;  5IC4 B;  1FK9 B;  4C0H A;  4LF4 F;  2HBZ B;  2OP5 A;  1VQ7 S;  3DHW C;  1WF2 A;  3AHP A;  5K8O A;  2ZIT A;  3CB4 A;  3JYT A;  2ZH4 A;  3BZQ A;  8AT1 B;  1N36 F;  4CLL A;  2W1B A;  1TP7 A;  2C2K B;  2ZH9 A;  3DNC A;  3HMJ G;  1TK5 A;  3IPJ A; 
#chains in the Genus database with same CATH homology
 1WOR A;  3GEE A;  5L46 A;  1WOO A;  2GAG C;  3GSI A;  4PAA A;  3TFI A;  3ADA C;  4PAB A;  3A8I A;  3TFH A;  3GIR A;  3AD9 C;  1V5V A;  1VRQ C;  1PJ5 A;  2GAH C;  3GEH A;  3TFJ A;  1X31 C;  1VLO A;  1YX2 A;  3AD8 C;  3A8J A;  1WOS A;  1XZP A;  1PJ6 A;  1XZP B;  3TTG A;  1WOP A;  1XZQ A;  1WSV A;  3AD7 C;  3GEI A;  1WSR A;  1XZQ B;  1PJ7 A;  3A8K A;  4P9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...