2JA7K

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja7K00
4Y7NK 3PO3K 4YG2A 2E2HK 2NVYC 3HOWC 3I4NK 3I4MC 1TWGC 3RZDK 4BXXC 1I6HK 2B63K 2E2JC 2A68A 4YFXA 5C4XC 2JA8K 5IYBC 4BBRK 3GTGK 4A3LC 2E2IC 3H3VL 3GTKC 4A3KC 4XLNA 4G7HA 2NVTC 2JA6C 4BY1C 4A3CK 4QIWL 1TWHK 3S16K 2R7ZK 2WAQL 4XSZA 3GTPK 3S1RK 2Y0SD 2WB1L 4OIPA 3M4OC 3S2DK 1HQMA 5IYDK 1WCMK 4A3BK 4X6AK 2JA5K 3CQZC 3WODA 5M5YK 4A3GC 4NOIA 3GTOC 1I6VA 3GTMC 1XPPA 3GTJK 5M3FK 2NVYK 4A3FK 1K83K 1YNJA 1TWGK 3HOWK 3I4MK 3S15C 4BXXK 3EQLA 4LLGA 4XLPA 4G7ZA 2E2JK 2R92K 3S17C 4A3DC 2NVQC 3K7AK 4OIQA 3RZOC 2PMZD 3GTQC 5IYBK 3S1QC 2O5IA 4A93K 3HOUC 3H0GK 4Y52K 2YU9C 3PO2C 2E2IK 4Q4ZA 1I50C 5M5XK 3GTKK 5IP9K 4JK1A 3HOZK 3HKZD 4C3HK 4A3JC 4A3KK 1TWAC 4A3IK 4A3MC 1R9TC 2PA8D 1I3QC 2PPBA 4A3EC 4MQ9A 1SFOC 3HOYK 3S1NC 4BBSC 4AYBL 5C3EC 3GTLC 3HOXC 3M4OK 5IYCK 5C44K 4OINA 3S14C 4C2MK 1Y1WC 2E2HC 1SMYA 3I4NC 5M5WK 3M3YC 3GTOK 3S2HC 3GTMK 3S1MC 5IP7C 3H3VD 2R93C 5M3MK 3HOVC 2JA8C 4QJVA 4BBRC 4KN4A 3GTGC 4LK0A 4C3IK 3S17K 1TWFC 4QIWD 4ZH4A 2JA7C 2WAQD 5C4XK 3GTQK 3RZOK 3S1QK 2WB1D 3HOUK 1ZYRA 3DXJA 3FKIC 4OIRA 4A3LK 4YFNA 5FJ8K 1I50K 4A3CC 1TWHC 2R7ZC 1R9TK 4Q5SA 4MEXA 4LK1A 1TWAK 5C4JC 4A3MK 1I3QK 1Y1VC 4A3EK 5TMFA 2JA6K 4YFKA 5IYDC 1WCMC 5FLMC 4BY1K 2JA5C 2NVTK 4A3BC 5C3EK 3GTLK 4BBSK 3HOXK 2VUMC 4BY7C 2NVXC 1TWCC 5D4DA 4XSXA 3S14K 1Y1WK 4Y7NC 3PO3C 3CQZK 3GTJC 2A69A 2A6HA 4A3FC 2Y0SL 4A3GK 1K83C 3M3YK 1BDFA 3RZDC 2BE5A 3S2HK 1I6HC 2R92C 4Y52C 2B63C 3S1MK 4QJVB 3K7AC 5IP7K 2R93K 3HOVK 3S15K 4A93C 4G7OA 3H0GC 4A3DK 1TWFK 2NVQK 2JA7K 4AYBD 4GZYA 3HOZC 5IP9C 4KMUA 3FKIK 4A3IC 3HOYC 2YU9K 5TMCA 3PO2K 2O5JA 3S16C 2PMZL 4A3JK 3GTPC 3S1RC 5C4JK 3S1NK 1Y1VK 5IYCC 1IW7A 4LJZA 5FLMK 4MEYA 5C44C 1SFOK 3S2DC 4X6AC 4C3JK 2CW0A 4KN7A 2VUMK 3HKZL 4BY7K 2NVXK 1TWCK 1YNNA 4OIOA 2PA8L 2A6EA
chains in the Genus database with same CATH superfamily
2ZFZA 4Y7NK 1SFOA 3QX3A 3SZYA 3I4MC 4BXXC 2VUMA 2A68A 2JA8K 3ADAC 1EH1A 1ZVUA 3AQOA 1VGXA 5IOTA 2R93A 4C3HC 4A3KC 4G7HA 2JA6C 4BY1C 2R7ZK 3S2DK 1WCMK 5M5YK 2P8TA 4A3GC 4FM9A 1YCLA 4A3FK 1YNJA 1TWGK 3S15C 4GT9A 1TWCA 3T00A 4G7ZA 2E2JK 4Y52K 2NVQC 3RZOC 2PMZD 5IOQA 4G0VA 3GTQC 5IYBK 3S1QC 4DDQA 2O5IA 4A93K 3H0GK 2R92A 2GAGC 3HKZD 1R9TC 1TWAC 5C3EC 3HOXC 2V6UA 1PJ5A 5C44K 1USOA 1WOSA 3AQPA 3GIRA 4GTFA 1G51A 3GEIA 3S2HC 2JA8C 4GTCA 4LK0A 4QIWD 1BS2A 2WAQD 3N0CA 3HOUK 3FKIC 4KAWX 4OIRA 4A3LK 1I50K 1UV7A 2R7ZC 4MEXA 4KM9A 4A3EK 1WCMC 4BBSK 1ISEA 1HI9A 3GTLK 2VUMC 2NVXC 2JA6A 1Y1WK 4C45A 3CQZK 2A6HA 4A3FC 4GTAA 4BKWA 1BDFA 1I6HC 4Y52C 1JOEA 4QJVB 3S1MK 3HOVK 4A93C 3H0GC 3G4AA 3TTGA 1TWFK 4G0WA 4AYBD 3JSTA 4KMUA 5L46A 5JVOA 4M1XA 3GTQA 1IBAA 1Y1VK 5C44C 3IPJA 3LAPA 1R9TA 4OIOA 3G4CA 1TWAA 2CFAA 4WJ3M 3PO3K 1VJEA 1DCPA 2NVYC 3HOWC 3I4NK 3RZDK 4KM8A 2B63K 2GSOA 4WJ4A 4BBRK 3GTGK 4A3LC 1KQ4A 3H3VL 1O2BA 4XLNA 1J6XA 4P9SA 1TWHK 4XSZA 1IS1A 5IOSA 4OIPA 3L4KA 3FKIA 5IYDK 4A3BK 2JA5K 3CQZC 1WSVA 2R7ZA 3GTOC 2ZUEA 3GTMC 1WCMA 1WQFA 1K83K 1XZPA 2NVXA 3EQLA 4LLGA 4XLPA 1VLOA 4AH6A 1DCHA 3AD9C 3BP3A 2E2IK 5M5XK 3GTKK 5IP9K 4P5AA 5E68A 2PA8D 1I3QC 4KB2A 3H0GA 5CHPA 3CAGA 3M4OK 5IYCK 4G0UA 4FZBA 4GTBA 1EQRA 3S14C 5CJ9A 4KMHA 3I4NC 5M5WK 3M3YC 5M3MK 3ERED 4BBRC 3GTGC 4KN4A 3S17K 2JA7C 5JFEA 1F7UA 1ZBSA 2XCRB 2NVYA 2JH3A 1TWHC 1JQWA 4BLAA 1BGWA 4Q5SA 4LK1A 4A3MK 4G7OA 5TMFA 3TFHA 5IYDC 5FLMC 2NVTK 4A3BC 2JA5C 4C3JC 1PJ6A 2RH6A 4WILA 3GDZA 4GTEA 4Y7NC 1WIHA 4BLBA 2Y0SL 1K83C 1B4AA 5IP7K 2R93K 1J98A 1IE0A 3CQZA 1XXCA 5TJ3A 3GTOA 4A3DK 2XCOA 3GTMA 5IP9C 4KDDA 3TFIA 1F7VA 5TMCA 3PO2K 4KARA 1WORA 5C4JK 3S1NK 5IYCC 4LJZA 3A8KA 3S2DC 3AD7C 1XZQA 3OPFA 4BY7K 4GTLA 1TWCK 1I3QA 4YG2A 4LOWA 2E2HK 1TWGC 2E2JC 3LAJA 2EBBA 4YFXA 5IYBC 3FOFA 3HXAA 2GSNA 1RU0A 2NVTC 4A3CK 3GTGA 3S16K 2JA7A 4ILDA 3GTPK 3S1RK 2WB1L 1VRQC 5HL8A 1O26A 1TWHA 3MMLB 2XCQA 1I6VA 3N3YA 4KATA 3GTJK 2JA5A 3I4MK 4BXXK 1B4BA 4A3DC 3K7AK 1EFWA 1K83A 3HOUC 4PAAA 3PO2C 3AH5A 1I50C 1ZXOA 4KB4A 3V4GA 3HOZK 4C3HK 4A3KK 4A3IK 3HOYK 3S1NC 2PPBA 4A3EC 1WSRA 4MQ9A 4BBSC 3GTLC 1WOPA 4XCHA 3N0BA 4OINA 2FQTA 1Y1WC 2E2HC 1SMYA 1XZPB 3A8IA 3S1MC 3SZZA 3L4JA 3H3VD 1O28A 4LR2A 3HOVC 4KMDA 1WQHA 2W7VA 3OREA 4C3IK 1TWFC 4ZH4A 3RZOK 3GTQK 5C4XK 3S1QK 1XXBA 1ZYRA 3DXJA 1TWGA 2GAHC 5IORA 5FJ8K 4A3CC 1R9TK 2P5MA 1TWAK 1WQGA 4P5BA 1Y1VC 4YFKA 4KASA 5C3EK 3HOXK 3FHZA 4RMFA 4PABA 3PO3C 3GTJC 3RZDC 2BE5A 3S2HK 2B63C 3K7AC 3S0XA 4KC6A 1O27A 2FQOA 3GEEA 1C0AA 3HOZC 3FKIK 3Q3QA 4A3IC 3HOYC 2YU9K 2O5JA 2PMZL 4A3JK 1SFOK 1I50A 4KN7A 2VUMK 3HKZL 2NVXK 1J6VA 1YNNA 2A6EA 3AD8C 4GTDA 3GTLA 1V5VA 1I6HK 1EK8A 4C3IC 1Y1WA 5C4XC 2E2HA 2PHCB 2E2IC 1O2FB 3GTKC 1GE9A 1DD5A 1YX2A 3FOEA 1L0WA 4QIWL 1TWFA 2WAQL 2Y0SD 1XZQB 3M4OC 1HQMA 2ZUFA 4X6AK 1VH2A 3T01A 3WODA 3GTPA 4NOIA 1WOOA 1X31C 1Y1VA 1BJTA 1XPPA 5M3FK 2NVYK 3HOWK 2R92K 3OEPA 3S17C 4OIQA 3VA7A 1O29A 3GTJA 1XXAA 2YU9C 1F93A 4Q4ZA 2B63A 4JK1A 4A3JC 1IQ0A 2V6SA 1O24A 4A3MC 1USMA 1SFOC 3NUHA 4AYBL 2V6TA 3GEHA 1J6WA 4C2MK 3T02A 2CFAB 3A8JA 3GTOK 1PJ7A 3GTMK 5EGHA 4LQYA 5IP7C 3TFJA 2R93C 3GSIA 3BUEA 4QJVA 1JVIA 2WB1D 4J3NA 4YFNA 2RGRA 1IL2A 4O2DA 5C4JC 1I3QK 2JA6K 1ZQ1C 1INNA 4BY1K 4X6AC 3BP8C 2E2IA 3GTKA 3LPXA 4BY7C 1TWCC 5D4DA 4XSXA 3S14K 2KWAA 2A69A 4A3GK 3M3YK 1F9NA 2R92C 4KMAA 4GFQA 3S15K 1AB4A 2NVQK 2JA7K 4GZYA 1DCOA 1O25A 1O2AA 3S16C 1EI6A 2GSUA 2D6FC 3GTPC 3S1RC 1IW7A 5FLMK 4MEYA 2YU9A 4C3JK 4C2MC 2CW0A 5EGEA 2Y3PA 2PA8L
chains in the Genus database with same CATH topology
4Y7NK 3PO3K 4YG2A 2E2HK 2NVYC 3HOWC 3I4NK 3I4MC 1TWGC 3RZDK 4BXXC 1I6HK 2B63K 2E2JC 2A68A 4YFXA 5C4XC 2JA8K 5IYBC 4BBRK 3GTGK 4A3LC 2E2IC 3H3VL 3GTKC 4A3KC 4XLNA 4G7HA 2NVTC 2JA6C 4BY1C 4A3CK 4QIWL 1TWHK 3S16K 2R7ZK 2WAQL 4XSZA 3GTPK 3S1RK 2Y0SD 2WB1L 4OIPA 3M4OC 3S2DK 1HQMA 5IYDK 1WCMK 4A3BK 4X6AK 2JA5K 3CQZC 3WODA 5M5YK 4A3GC 4NOIA 3GTOC 1I6VA 3GTMC 1XPPA 3GTJK 5M3FK 2NVYK 4A3FK 1K83K 1YNJA 1TWGK 3HOWK 3I4MK 3S15C 4BXXK 3EQLA 4LLGA 4XLPA 4G7ZA 2E2JK 2R92K 3S17C 4A3DC 2NVQC 3K7AK 4OIQA 3RZOC 2PMZD 3GTQC 5IYBK 3S1QC 2O5IA 4A93K 3HOUC 3H0GK 4Y52K 2YU9C 3PO2C 2E2IK 4Q4ZA 1I50C 5M5XK 3GTKK 5IP9K 4JK1A 3HOZK 3HKZD 4C3HK 4A3JC 4A3KK 1TWAC 4A3IK 4A3MC 1R9TC 2PA8D 1I3QC 2PPBA 4A3EC 4MQ9A 1SFOC 3HOYK 3S1NC 4BBSC 4AYBL 5C3EC 3GTLC 3HOXC 3M4OK 5IYCK 5C44K 4OINA 3S14C 4C2MK 1Y1WC 2E2HC 1SMYA 3I4NC 5M5WK 3M3YC 3GTOK 3S2HC 3GTMK 3S1MC 5IP7C 3H3VD 2R93C 5M3MK 3HOVC 2JA8C 4QJVA 4BBRC 4KN4A 3GTGC 4LK0A 4C3IK 3S17K 1TWFC 4QIWD 4ZH4A 2JA7C 2WAQD 5C4XK 3GTQK 3RZOK 3S1QK 2WB1D 3HOUK 1ZYRA 3DXJA 3FKIC 4OIRA 4A3LK 4YFNA 5FJ8K 1I50K 4A3CC 1TWHC 2R7ZC 1R9TK 4Q5SA 4MEXA 4LK1A 1TWAK 5C4JC 4A3MK 1I3QK 1Y1VC 4A3EK 5TMFA 2JA6K 4YFKA 5IYDC 1WCMC 5FLMC 4BY1K 2JA5C 2NVTK 4A3BC 5C3EK 3GTLK 4BBSK 3HOXK 2VUMC 4BY7C 2NVXC 1TWCC 5D4DA 4XSXA 3S14K 1Y1WK 4Y7NC 3PO3C 3CQZK 3GTJC 2A69A 2A6HA 4A3FC 2Y0SL 4A3GK 1K83C 3M3YK 1BDFA 3RZDC 2BE5A 3S2HK 1I6HC 2R92C 4Y52C 2B63C 3S1MK 4QJVB 3K7AC 5IP7K 2R93K 3HOVK 3S15K 4A93C 4G7OA 3H0GC 4A3DK 1TWFK 2NVQK 2JA7K 4AYBD 4GZYA 3HOZC 5IP9C 4KMUA 3FKIK 4A3IC 3HOYC 2YU9K 5TMCA 3PO2K 2O5JA 3S16C 2PMZL 4A3JK 3GTPC 3S1RC 5C4JK 3S1NK 1Y1VK 5IYCC 1IW7A 4LJZA 5FLMK 4MEYA 5C44C 1SFOK 3S2DC 4X6AC 4C3JK 2CW0A 4KN7A 2VUMK 3HKZL 4BY7K 2NVXK 1TWCK 1YNNA 4OIOA 2PA8L 2A6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N K;  3PO3 K;  4YG2 A;  2E2H K;  2NVY C;  3HOW C;  3I4N K;  3I4M C;  1TWG C;  3RZD K;  4BXX C;  1I6H K;  2B63 K;  2E2J C;  2A68 A;  4YFX A;  5C4X C;  2JA8 K;  5IYB C;  4BBR K;  3GTG K;  4A3L C;  2E2I C;  3H3V L;  3GTK C;  4A3K C;  4XLN A;  4G7H A;  2NVT C;  2JA6 C;  4BY1 C;  4A3C K;  4QIW L;  1TWH K;  3S16 K;  2R7Z K;  2WAQ L;  4XSZ A;  3GTP K;  3S1R K;  2Y0S D;  2WB1 L;  4OIP A;  3M4O C;  3S2D K;  1HQM A;  5IYD K;  1WCM K;  4A3B K;  4X6A K;  2JA5 K;  3CQZ C;  3WOD A;  5M5Y K;  4A3G C;  4NOI A;  3GTO C;  1I6V A;  3GTM C;  1XPP A;  3GTJ K;  5M3F K;  2NVY K;  4A3F K;  1K83 K;  1YNJ A;  1TWG K;  3HOW K;  3I4M K;  3S15 C;  4BXX K;  3EQL A;  4LLG A;  4XLP A;  4G7Z A;  2E2J K;  2R92 K;  3S17 C;  4A3D C;  2NVQ C;  3K7A K;  4OIQ A;  3RZO C;  2PMZ D;  3GTQ C;  5IYB K;  3S1Q C;  2O5I A;  4A93 K;  3HOU C;  3H0G K;  4Y52 K;  2YU9 C;  3PO2 C;  2E2I K;  4Q4Z A;  1I50 C;  5M5X K;  3GTK K;  5IP9 K;  4JK1 A;  3HOZ K;  3HKZ D;  4C3H K;  4A3J C;  4A3K K;  1TWA C;  4A3I K;  4A3M C;  1R9T C;  2PA8 D;  1I3Q C;  2PPB A;  4A3E C;  4MQ9 A;  1SFO C;  3HOY K;  3S1N C;  4BBS C;  4AYB L;  5C3E C;  3GTL C;  3HOX C;  3M4O K;  5IYC K;  5C44 K;  4OIN A;  3S14 C;  4C2M K;  1Y1W C;  2E2H C;  1SMY A;  3I4N C;  5M5W K;  3M3Y C;  3GTO K;  3S2H C;  3GTM K;  3S1M C;  5IP7 C;  3H3V D;  2R93 C;  5M3M K;  3HOV C;  2JA8 C;  4QJV A;  4BBR C;  4KN4 A;  3GTG C;  4LK0 A;  4C3I K;  3S17 K;  1TWF C;  4QIW D;  4ZH4 A;  2JA7 C;  2WAQ D;  5C4X K;  3GTQ K;  3RZO K;  3S1Q K;  2WB1 D;  3HOU K;  1ZYR A;  3DXJ A;  3FKI C;  4OIR A;  4A3L K;  4YFN A;  5FJ8 K;  1I50 K;  4A3C C;  1TWH C;  2R7Z C;  1R9T K;  4Q5S A;  4MEX A;  4LK1 A;  1TWA K;  5C4J C;  4A3M K;  1I3Q K;  1Y1V C;  4A3E K;  5TMF A;  2JA6 K;  4YFK A;  5IYD C;  1WCM C;  5FLM C;  4BY1 K;  2JA5 C;  2NVT K;  4A3B C;  5C3E K;  3GTL K;  4BBS K;  3HOX K;  2VUM C;  4BY7 C;  2NVX C;  1TWC C;  5D4D A;  4XSX A;  3S14 K;  1Y1W K;  4Y7N C;  3PO3 C;  3CQZ K;  3GTJ C;  2A69 A;  2A6H A;  4A3F C;  2Y0S L;  4A3G K;  1K83 C;  3M3Y K;  1BDF A;  3RZD C;  2BE5 A;  3S2H K;  1I6H C;  2R92 C;  4Y52 C;  2B63 C;  3S1M K;  4QJV B;  3K7A C;  5IP7 K;  2R93 K;  3HOV K;  3S15 K;  4A93 C;  4G7O A;  3H0G C;  4A3D K;  1TWF K;  2NVQ K;  2JA7 K;  4AYB D;  4GZY A;  3HOZ C;  5IP9 C;  4KMU A;  3FKI K;  4A3I C;  3HOY C;  2YU9 K;  5TMC A;  3PO2 K;  2O5J A;  3S16 C;  2PMZ L;  4A3J K;  3GTP C;  3S1R C;  5C4J K;  3S1N K;  1Y1V K;  5IYC C;  1IW7 A;  4LJZ A;  5FLM K;  4MEY A;  5C44 C;  1SFO K;  3S2D C;  4X6A C;  4C3J K;  2CW0 A;  4KN7 A;  2VUM K;  3HKZ L;  4BY7 K;  2NVX K;  1TWC K;  1YNN A;  4OIO A;  2PA8 L;  2A6E A; 
#chains in the Genus database with same CATH topology
 2ZFZ A;  4Y7N K;  1SFO A;  3QX3 A;  3SZY A;  3I4M C;  4BXX C;  2VUM A;  2A68 A;  2JA8 K;  3ADA C;  1EH1 A;  1ZVU A;  3AQO A;  1VGX A;  5IOT A;  2R93 A;  4C3H C;  4A3K C;  4G7H A;  2JA6 C;  4BY1 C;  2R7Z K;  3S2D K;  1WCM K;  5M5Y K;  2P8T A;  4A3G C;  4FM9 A;  1YCL A;  4A3F K;  1YNJ A;  1TWG K;  3S15 C;  4GT9 A;  1TWC A;  3T00 A;  4G7Z A;  2E2J K;  4Y52 K;  2NVQ C;  3RZO C;  2PMZ D;  5IOQ A;  4G0V A;  3GTQ C;  5IYB K;  3S1Q C;  4DDQ A;  2O5I A;  4A93 K;  3H0G K;  2R92 A;  2GAG C;  3HKZ D;  1R9T C;  1TWA C;  5C3E C;  3HOX C;  2V6U A;  1PJ5 A;  5C44 K;  1USO A;  1WOS A;  3AQP A;  3GIR A;  4GTF A;  1G51 A;  3GEI A;  3S2H C;  2JA8 C;  4GTC A;  4LK0 A;  4QIW D;  1BS2 A;  2WAQ D;  3N0C A;  3HOU K;  3FKI C;  4KAW X;  4OIR A;  4A3L K;  1I50 K;  1UV7 A;  2R7Z C;  4MEX A;  4KM9 A;  4A3E K;  1WCM C;  4BBS K;  1ISE A;  1HI9 A;  3GTL K;  2VUM C;  2NVX C;  2JA6 A;  1Y1W K;  4C45 A;  3CQZ K;  2A6H A;  4A3F C;  4GTA A;  4BKW A;  1BDF A;  1I6H C;  4Y52 C;  1JOE A;  4QJV B;  3S1M K;  3HOV K;  4A93 C;  3H0G C;  3G4A A;  3TTG A;  1TWF K;  4G0W A;  4AYB D;  3JST A;  4KMU A;  5L46 A;  5JVO A;  4M1X A;  3GTQ A;  1IBA A;  1Y1V K;  5C44 C;  3IPJ A;  3LAP A;  1R9T A;  4OIO A;  3G4C A;  1TWA A;  2CFA A;  4WJ3 M;  3PO3 K;  1VJE A;  1DCP A;  2NVY C;  3HOW C;  3I4N K;  3RZD K;  4KM8 A;  2B63 K;  2GSO A;  4WJ4 A;  4BBR K;  3GTG K;  4A3L C;  1KQ4 A;  3H3V L;  1O2B A;  4XLN A;  1J6X A;  4P9S A;  1TWH K;  4XSZ A;  1IS1 A;  5IOS A;  4OIP A;  3L4K A;  3FKI A;  5IYD K;  4A3B K;  2JA5 K;  3CQZ C;  1WSV A;  2R7Z A;  3GTO C;  2ZUE A;  3GTM C;  1WCM A;  1WQF A;  1K83 K;  1XZP A;  2NVX A;  3EQL A;  4LLG A;  4XLP A;  1VLO A;  4AH6 A;  1DCH A;  3AD9 C;  3BP3 A;  2E2I K;  5M5X K;  3GTK K;  5IP9 K;  4P5A A;  5E68 A;  2PA8 D;  1I3Q C;  4KB2 A;  3H0G A;  5CHP A;  3CAG A;  3M4O K;  5IYC K;  4G0U A;  4FZB A;  4GTB A;  1EQR A;  3S14 C;  5CJ9 A;  4KMH A;  3I4N C;  5M5W K;  3M3Y C;  5M3M K;  3ERE D;  4BBR C;  3GTG C;  4KN4 A;  3S17 K;  2JA7 C;  5JFE A;  1F7U A;  1ZBS A;  2XCR B;  2NVY A;  2JH3 A;  1TWH C;  1JQW A;  4BLA A;  1BGW A;  4Q5S A;  4LK1 A;  4A3M K;  4G7O A;  5TMF A;  3TFH A;  5IYD C;  5FLM C;  2NVT K;  4A3B C;  2JA5 C;  4C3J C;  1PJ6 A;  2RH6 A;  4WIL A;  3GDZ A;  4GTE A;  4Y7N C;  1WIH A;  4BLB A;  2Y0S L;  1K83 C;  1B4A A;  5IP7 K;  2R93 K;  1J98 A;  1IE0 A;  3CQZ A;  1XXC A;  5TJ3 A;  3GTO A;  4A3D K;  2XCO A;  3GTM A;  5IP9 C;  4KDD A;  3TFI A;  1F7V A;  5TMC A;  3PO2 K;  4KAR A;  1WOR A;  5C4J K;  3S1N K;  5IYC C;  4LJZ A;  3A8K A;  3S2D C;  3AD7 C;  1XZQ A;  3OPF A;  4BY7 K;  4GTL A;  1TWC K;  1I3Q A;  4YG2 A;  4LOW A;  2E2H K;  1TWG C;  2E2J C;  3LAJ A;  2EBB A;  4YFX A;  5IYB C;  3FOF A;  3HXA A;  2GSN A;  1RU0 A;  2NVT C;  4A3C K;  3GTG A;  3S16 K;  2JA7 A;  4ILD A;  3GTP K;  3S1R K;  2WB1 L;  1VRQ C;  5HL8 A;  1O26 A;  1TWH A;  3MML B;  2XCQ A;  1I6V A;  3N3Y A;  4KAT A;  3GTJ K;  2JA5 A;  3I4M K;  4BXX K;  1B4B A;  4A3D C;  3K7A K;  1EFW A;  1K83 A;  3HOU C;  4PAA A;  3PO2 C;  3AH5 A;  1I50 C;  1ZXO A;  4KB4 A;  3V4G A;  3HOZ K;  4C3H K;  4A3K K;  4A3I K;  3HOY K;  3S1N C;  2PPB A;  4A3E C;  1WSR A;  4MQ9 A;  4BBS C;  3GTL C;  1WOP A;  4XCH A;  3N0B A;  4OIN A;  2FQT A;  1Y1W C;  2E2H C;  1SMY A;  1XZP B;  3A8I A;  3S1M C;  3SZZ A;  3L4J A;  3H3V D;  1O28 A;  4LR2 A;  3HOV C;  4KMD A;  1WQH A;  2W7V A;  3ORE A;  4C3I K;  1TWF C;  4ZH4 A;  3RZO K;  3GTQ K;  5C4X K;  3S1Q K;  1XXB A;  1ZYR A;  3DXJ A;  1TWG A;  2GAH C;  5IOR A;  5FJ8 K;  4A3C C;  1R9T K;  2P5M A;  1TWA K;  1WQG A;  4P5B A;  1Y1V C;  4YFK A;  4KAS A;  5C3E K;  3HOX K;  3FHZ A;  4RMF A;  4PAB A;  3PO3 C;  3GTJ C;  3RZD C;  2BE5 A;  3S2H K;  2B63 C;  3K7A C;  3S0X A;  4KC6 A;  1O27 A;  2FQO A;  3GEE A;  1C0A A;  3HOZ C;  3FKI K;  3Q3Q A;  4A3I C;  3HOY C;  2YU9 K;  2O5J A;  2PMZ L;  4A3J K;  1SFO K;  1I50 A;  4KN7 A;  2VUM K;  3HKZ L;  2NVX K;  1J6V A;  1YNN A;  2A6E A;  3AD8 C;  4GTD A;  3GTL A;  1V5V A;  1I6H K;  1EK8 A;  4C3I C;  1Y1W A;  5C4X C;  2E2H A;  2PHC B;  2E2I C;  1O2F B;  3GTK C;  1GE9 A;  1DD5 A;  1YX2 A;  3FOE A;  1L0W A;  4QIW L;  1TWF A;  2WAQ L;  2Y0S D;  1XZQ B;  3M4O C;  1HQM A;  2ZUF A;  4X6A K;  1VH2 A;  3T01 A;  3WOD A;  3GTP A;  4NOI A;  1WOO A;  1X31 C;  1Y1V A;  1BJT A;  1XPP A;  5M3F K;  2NVY K;  3HOW K;  2R92 K;  3OEP A;  3S17 C;  4OIQ A;  3VA7 A;  1O29 A;  3GTJ A;  1XXA A;  2YU9 C;  1F93 A;  4Q4Z A;  2B63 A;  4JK1 A;  4A3J C;  1IQ0 A;  2V6S A;  1O24 A;  4A3M C;  1USM A;  1SFO C;  3NUH A;  4AYB L;  2V6T A;  3GEH A;  1J6W A;  4C2M K;  3T02 A;  2CFA B;  3A8J A;  3GTO K;  1PJ7 A;  3GTM K;  5EGH A;  4LQY A;  5IP7 C;  3TFJ A;  2R93 C;  3GSI A;  3BUE A;  4QJV A;  1JVI A;  2WB1 D;  4J3N A;  4YFN A;  2RGR A;  1IL2 A;  4O2D A;  5C4J C;  1I3Q K;  2JA6 K;  1ZQ1 C;  1INN A;  4BY1 K;  4X6A C;  3BP8 C;  2E2I A;  3GTK A;  3LPX A;  4BY7 C;  1TWC C;  5D4D A;  4XSX A;  3S14 K;  2KWA A;  2A69 A;  4A3G K;  3M3Y K;  1F9N A;  2R92 C;  4KMA A;  4GFQ A;  3S15 K;  1AB4 A;  2NVQ K;  2JA7 K;  4GZY A;  1DCO A;  1O25 A;  1O2A A;  3S16 C;  1EI6 A;  2GSU A;  2D6F C;  3GTP C;  3S1R C;  1IW7 A;  5FLM K;  4MEY A;  2YU9 A;  4C3J K;  4C2M C;  2CW0 A;  5EGE A;  2Y3P A;  2PA8 L; 
#chains in the Genus database with same CATH homology
 4Y7N K;  3PO3 K;  4YG2 A;  2E2H K;  2NVY C;  3HOW C;  3I4N K;  3I4M C;  1TWG C;  3RZD K;  4BXX C;  1I6H K;  2B63 K;  2E2J C;  2A68 A;  4YFX A;  5C4X C;  2JA8 K;  5IYB C;  4BBR K;  3GTG K;  4A3L C;  2E2I C;  3H3V L;  3GTK C;  4A3K C;  4XLN A;  4G7H A;  2NVT C;  2JA6 C;  4BY1 C;  4A3C K;  4QIW L;  1TWH K;  3S16 K;  2R7Z K;  2WAQ L;  4XSZ A;  3GTP K;  3S1R K;  2Y0S D;  2WB1 L;  4OIP A;  3M4O C;  3S2D K;  1HQM A;  5IYD K;  1WCM K;  4A3B K;  4X6A K;  2JA5 K;  3CQZ C;  3WOD A;  5M5Y K;  4A3G C;  4NOI A;  3GTO C;  1I6V A;  3GTM C;  1XPP A;  3GTJ K;  5M3F K;  2NVY K;  4A3F K;  1K83 K;  1YNJ A;  1TWG K;  3HOW K;  3I4M K;  3S15 C;  4BXX K;  3EQL A;  4LLG A;  4XLP A;  4G7Z A;  2E2J K;  2R92 K;  3S17 C;  4A3D C;  2NVQ C;  3K7A K;  4OIQ A;  3RZO C;  2PMZ D;  3GTQ C;  5IYB K;  3S1Q C;  2O5I A;  4A93 K;  3HOU C;  3H0G K;  4Y52 K;  2YU9 C;  3PO2 C;  2E2I K;  4Q4Z A;  1I50 C;  5M5X K;  3GTK K;  5IP9 K;  4JK1 A;  3HOZ K;  3HKZ D;  4C3H K;  4A3J C;  4A3K K;  1TWA C;  4A3I K;  4A3M C;  1R9T C;  2PA8 D;  1I3Q C;  2PPB A;  4A3E C;  4MQ9 A;  1SFO C;  3HOY K;  3S1N C;  4BBS C;  4AYB L;  5C3E C;  3GTL C;  3HOX C;  3M4O K;  5IYC K;  5C44 K;  4OIN A;  3S14 C;  4C2M K;  1Y1W C;  2E2H C;  1SMY A;  3I4N C;  5M5W K;  3M3Y C;  3GTO K;  3S2H C;  3GTM K;  3S1M C;  5IP7 C;  3H3V D;  2R93 C;  5M3M K;  3HOV C;  2JA8 C;  4QJV A;  4BBR C;  4KN4 A;  3GTG C;  4LK0 A;  4C3I K;  3S17 K;  1TWF C;  4QIW D;  4ZH4 A;  2JA7 C;  2WAQ D;  5C4X K;  3GTQ K;  3RZO K;  3S1Q K;  2WB1 D;  3HOU K;  1ZYR A;  3DXJ A;  3FKI C;  4OIR A;  4A3L K;  4YFN A;  5FJ8 K;  1I50 K;  4A3C C;  1TWH C;  2R7Z C;  1R9T K;  4Q5S A;  4MEX A;  4LK1 A;  1TWA K;  5C4J C;  4A3M K;  1I3Q K;  1Y1V C;  4A3E K;  5TMF A;  2JA6 K;  4YFK A;  5IYD C;  1WCM C;  5FLM C;  4BY1 K;  2JA5 C;  2NVT K;  4A3B C;  5C3E K;  3GTL K;  4BBS K;  3HOX K;  2VUM C;  4BY7 C;  2NVX C;  1TWC C;  5D4D A;  4XSX A;  3S14 K;  1Y1W K;  4Y7N C;  3PO3 C;  3CQZ K;  3GTJ C;  2A69 A;  2A6H A;  4A3F C;  2Y0S L;  4A3G K;  1K83 C;  3M3Y K;  1BDF A;  3RZD C;  2BE5 A;  3S2H K;  1I6H C;  2R92 C;  4Y52 C;  2B63 C;  3S1M K;  4QJV B;  3K7A C;  5IP7 K;  2R93 K;  3HOV K;  3S15 K;  4A93 C;  4G7O A;  3H0G C;  4A3D K;  1TWF K;  2NVQ K;  2JA7 K;  4AYB D;  4GZY A;  3HOZ C;  5IP9 C;  4KMU A;  3FKI K;  4A3I C;  3HOY C;  2YU9 K;  5TMC A;  3PO2 K;  2O5J A;  3S16 C;  2PMZ L;  4A3J K;  3GTP C;  3S1R C;  5C4J K;  3S1N K;  1Y1V K;  5IYC C;  1IW7 A;  4LJZ A;  5FLM K;  4MEY A;  5C44 C;  1SFO K;  3S2D C;  4X6A C;  4C3J K;  2CW0 A;  4KN7 A;  2VUM K;  3HKZ L;  4BY7 K;  2NVX K;  1TWC K;  1YNN A;  4OIO A;  2PA8 L;  2A6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...