2JA7K

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
total genus 26
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja7K00
4A3JK 3M4OK 3S17K 3H0GK 4A93K 4Y52C 5FLMK 4A3FC 3S1QC 5C3EK 2VUMC 4C3IK 4AYBL 4Y52K 5FLMC 4G7OA 3GTJC 4KMUA 5C4XC 2WB1D 4A3JC 3M4OC 3H0GC 1TWAK 5IP7C 4C3JK 1R9TK 2JA7K 3FKIC 4MQ9A 3PO2K 1I3QC 4QIWL 2R7ZK 5C3EC 2VUMK 3FKIK 3WODA 5IYBK 1TWHK 3GTPK 3S2DC 3S1MK 5C4XK 1TWFK 4A3MC 4BBSK 3EQLA 4BY7K 3CQZK 2NVXK 1TWHC 4Q5SA 3S1MC 4BY7C 3GTLK 3GTMK 2E2IC 2JA8C 5C4JC 2PA8L 2E2JK 3S14C 4BBSC 1TWFC 3HOXK 3H3VD 1TWGC 3H3VL 4YG2A 5M3MK 4G7HA 3S16K 2E2IK 3I4NK 5IYDK 1R9TC 2JA7C 4A3EK 2E2JC 4BBRK 5IP9C 1XPPA 5M5XK 4XLNA 4A3IC 3S14K 4BY1C 4LLGA 4A93C 5IYBC 4A3EC 1I6VA 4NOIA 4C2MK 4A3GC 3HKZD 4LJZA 2JA6K 4BY1K 3I4NC 3CQZC 2NVXC 1YNNA 5C44K 5M5YK 3GTOK 3I4MC 4XLPA 4BBRC 4A3IK 1TWAC 1HQMA 1SMYA 5IP7K 5TMCA 5C44C 5C4JK 4OIQA 1I3QK 1ZYRA 4YFKA 4A3GK 2JA6C 1TWGK 4A3KC 2YU9K 4A3BC 4JK1A 3HOVC 4A3MK 1Y1VC 2A6HA 5IYDC 2NVTK 5M5WK 2PA8D 1Y1WK 2PMZL 4MEXA 3GTMC 3HOUC 3S1RC 2O5IA 1I6HC 4A3BK 3HOVK 4X6AC 2A6EA 4ZH4A 4OIPA 3S1RK 1I6HK 3GTOC 3I4MK 3S16C 5IYCC 4QIWD 4GZYA 3HOZK 3DXJA 5IP9K 2WAQL 4A3LK 4A3KK 3M3YC 4QJVB 2YU9C 4Y7NK 4A3LC 3K7AC 3GTGC 2NVYC 3HOZC 2PMZD 3K7AK 4C3HK 4XSZA 1TWCK 4Y7NC 4QJVA 4X6AK 1YNJA 3GTGK 4BXXK 1Y1VK 2PPBA 5IYCK 5M3FK 2NVTC 1Y1WC 3HOUK 2WAQD 3GTKC 1K83C 2WB1L 4Q4ZA 3PO3C 3HOWK 3S2HC 1K83K 4LK1A 2R92C 2B63K 1BDFA 2A68A 4A3CK 2Y0SL 2NVQK 1I50K 4KN4A 5TMFA 5D4DA 4A3DK 4YFXA 4YFNA 2JA5K 3S1QK 3M3YK 4OIRA 2B63C 4XSXA 4G7ZA 4BXXC 2JA5C 2O5JA 3RZDC 3HOYC 1I50C 2NVYK 1IW7A 3PO3K 2R7ZC 1SFOK 1TWCC 3GTQC 4A3FK 3S2HK 2R93K 4LK0A 3S15C 2CW0A 4MEYA 2BE5A 4AYBD 2E2HC 3GTJK 3HKZL 3S1NK 4A3CC 2R93C 3GTLC 2NVQC 2A69A 2Y0SD 1WCMC 2JA8K 1SFOC 4OINA 2E2HK 4OIOA 3GTQK 3S1NC 3PO2C 4A3DC 3S17C 3RZOC 3S15K 3HOXC 3HOWC 3GTKK 3GTPC 3S2DK 3RZOK 3RZDK 3HOYK 2R92K 1WCMK 4KN7A 5FJ8K
chains in the Genus database with same CATH superfamily
3M4OK 3S17K 1EFWA 2GSOA 1EK8A 3H0GA 4BKWA 3S1QC 3GSIA 4KDDA 4AYBL 3GTJC 4KMUA 5IP7C 2VUMA 4MQ9A 3PO2K 4KM8A 1BJTA 1ZQ1C 5HL8A 4C45A 3S2DC 3V4GA 3FKIA 3EQLA 5IOQA 2E2IC 2EBBA 4RMFA 3S14C 3BP8C 1TWFC 3HOXK 3H3VL 5M3MK 1V5VA 3S16K 2JA7C 1G51A 4GFQA 4XLNA 4A3IC 4KC6A 4BY1C 1UV7A 4LQYA 4A3GC 5IOSA 4BY1K 3I4NC 3CQZC 2Y3PA 1YNNA 5C44K 2RGRA 3GTOK 4G0VA 5C44C 4O2DA 4OIQA 2NVXA 3A8KA 1ZVUA 4GTLA 4YFKA 3L4JA 2YU9K 4JK1A 1JQWA 1WSVA 1XXAA 1B4BA 5CHPA 2PMZL 4MEXA 5CJ9A 4OIPA 4KMHA 3I4MK 4KASA 4GZYA 1PJ7A 3T00A 4C2MC 3BP3A 3FOFA 2ZUFA 3HOZC 2YU9A 3GDZA 3BUEA 1TWCK 1Y1WA 4X6AK 2GSNA 3S0XA 1YNJA 3GTGK 4BXXK 1Y1VK 4PABA 2NVTC 1IQ0A 1J6VA 1K83C 4LR2A 4Q4ZA 2FQOA 3GIRA 4FZBA 1K83K 4LK1A 1BDFA 1X31C 1AB4A 2A68A 2KWAA 2Y0SL 4KM9A 2JA5A 3A8IA 3CAGA 5D4DA 4A3DK 4WJ4A 1WOOA 4G7ZA 1VH2A 2XCQA 1WIHA 2O5JA 1O2BA 4J3NA 3GTQC 1F7UA 4A3FK 4PAAA 1B4AA 1PJ5A 2BE5A 2R7ZA 2NVQC 2Y0SD 1WCMC 2JA8K 2XCRB 1J98A 3S17C 1EQRA 3RZOC 1DD5A 1XZQA 3HOWC 3GTPC 3RZOK 3HOYK 2W7VA 4DDQA 1WSRA 4A93K 3AQPA 1IS1A 2JH3A 1XZPA 4P9SA 4WILA 4A3JC 1I3QC 1O2FB 4QIWL 2PHCB 2VUMK 2FQTA 3WODA 1TWHK 3S1MK 5C4XK 1TWFK 4A3MC 1I3QA 1TWHC 1TWFA 3S1MC 1XXCA 1EI6A 3GTLK 3GTMK 4BBSC 1TWGC 1F93A 2E2IA 4YG2A 4G7HA 3I4NK 3TFHA 1R9TC 5IP9C 3G4CA 4LLGA 5IYBC 4NOIA 1TWAA 4GT9A 4LJZA 2NVXC 3ERED 2CFAA 4XLPA 4BBRC 1XXBA 4ILDA 5IP7K 1SMYA 5TMCA 5C4JK 3CQZA 3G4AA 3SZZA 5TJ3A 1F9NA 5IYDC 1L0WA 3TTGA 1XZQB 2PA8D 3HOUC 1I6HC 1Y1VA 3HOVK 1I6HK 3S16C 3HOZK 4A3LK 4A3KK 1DCPA 1IBAA 4A3LC 4LOWA 3T01A 3GTGC 2NVYC 3N0CA 4C3HK 4XSZA 3OREA 1HI9A 4GTEA 1RU0A 4C3HC 2NVYA 1WORA 3AD7C 5IYCK 5M3FK 4KAWX 3GTKC 1O29A 1O28A 2R92C 2RH6A 1I50A 4OIRA 2B63C 4XSXA 4GTAA 1O24A 5IORA 1IW7A 3PO3K 2V6UA 3IPJA 1TWCC 2R7ZC 3FHZA 3A8JA 3S2HK 1SFOA 2R93K 2CW0A 3GTJK 2R93C 4A3CC 5L46A 4KATA 3PO2C 3S15K 2P8TA 3GTLA 3S2DK 1WCMA 3Q3QA 3RZDK 2V6TA 4KN7A 4A3JK 5FLMK 4BLAA 2VUMC 3TFIA 5FLMC 4G0WA 5C4XC 2WB1D 3H0GC 1TWAK 3MMLB 2JA7K 1TWHA 3GTJA 5C3EC 4C3IC 4BBSK 3CQZK 3GEIA 4Q5SA 1TWGA 2JA8C 3H3VD 2P5MA 2ZUEA 1INNA 4A3EK 2E2JC 4BBRK 1XPPA 4A93C 4A3EC 1I6VA 3HKZD 1R9TA 5M5YK 3I4MC 1EH1A 1J6XA 3LAPA 3N0BA 1ISEA 1I3QK 1ZYRA 2JA6C 3QX3A 3HOVC 4A3MK 2CFAB 4KARA 2XCOA 1Y1WK 3GTMC 3T02A 3S1RC 2O5IA 4A3BK 3AH5A 2A6EA 3S1RK 4X6AC 3GTOC 3LAJA 1IL2A 3GEHA 1O2AA 5IP9K 1WOSA 3M3YC 4QJVB 2YU9C 1JOEA 3GEEA 3K7AC 1USMA 3K7AK 4Y7NC 3GTGA 4KMDA 2PPBA 4BLBA 3HOUK 1C0AA 2WAQD 2WB1L 3N3YA 2GSUA 2B63K 1ZBSA 4KB2A 2NVQK 4KN4A 4YFXA 2R92A 4YFNA 3AQOA 3S1QK 1JVIA 4BXXC 1TWCA 3HOYC 1I50C 4FM9A 2NVYK 5JFEA 2GAHC 4GTDA 2GAGC 3NUHA 3OPFA 5EGHA 3S15C 4AYBD 3S1NK 4AH6A 3TFJA 4P5AA 3SZYA 1SFOC 4OINA 1YCLA 3S1NC 4A3DC 1O25A 1VRQC 3GTKA 1WQHA 1O27A 3HOXC 1J6WA 2R92K 3H0GK 1DCHA 4Y52C 4A3FC 5C3EK 1VJEA 4C3IK 4Y52K 4G7OA 5E68A 3M4OC 4C3JK 1R9TK 1VLOA 3FKIC 2ZFZA 2R7ZK 4C3JC 3FKIK 5IYBK 2D6FC 3GTPK 3ADAC 4BY7K 2NVXK 5IOTA 4BY7C 1KQ4A 5C4JC 2PA8L 2E2JK 4G0UA 2E2IK 5IYDK 3S14K 5M5XK 1ZXOA 4C2MK 2JA7A 2JA6K 1GE9A 1F7VA 2JA6A 1WQFA 4A3IK 1TWAC 1HQMA 4A3GK 1TWGK 4A3KC 3LPXA 3GTMA 4A3BC 1Y1VC 2A6HA 3HXAA 2NVTK 5M5WK 5JVOA 1WQGA 1YX2A 4ZH4A 3VA7A 5IYCC 4QIWD 4WJ3M 1DCOA 3DXJA 4P5BA 2WAQL 1PJ6A 3GTOA 4M1XA 4Y7NK 4KB4A 2PMZD 1VGXA 4QJVA 2V6SA 1O26A 1Y1WC 4GTBA 3PO3C 3HOWK 3S2HC 1K83A 3AD9C 5EGEA 4A3CK 2B63A 1I50K 3OEPA 5TMFA 1IE0A 2JA5K 1WOPA 3M3YK 3FOEA 2JA5C 3RZDC 3JSTA 4GTCA 1SFOK 2R93A 4KMAA 4LK0A 4MEYA 1BGWA 1BS2A 2E2HC 3HKZL 1USOA 3GTQA 3GTLC 2A69A 3GTPA 3AD8C 2E2HK 4GTFA 4OIOA 3GTQK 4XCHA 2E2HA 1XZPB 3GTKK 3L4KA 1WCMK 5FJ8K
chains in the Genus database with same CATH topology
4A3JK 3M4OK 3S17K 3H0GK 4A93K 4Y52C 5FLMK 4A3FC 3S1QC 5C3EK 2VUMC 4C3IK 4AYBL 4Y52K 5FLMC 4G7OA 3GTJC 4KMUA 5C4XC 2WB1D 4A3JC 3M4OC 3H0GC 1TWAK 5IP7C 4C3JK 1R9TK 2JA7K 3FKIC 4MQ9A 3PO2K 1I3QC 4QIWL 2R7ZK 5C3EC 2VUMK 3FKIK 3WODA 5IYBK 1TWHK 3GTPK 3S2DC 3S1MK 5C4XK 1TWFK 4A3MC 4BBSK 3EQLA 4BY7K 3CQZK 2NVXK 1TWHC 4Q5SA 3S1MC 4BY7C 3GTLK 3GTMK 2E2IC 2JA8C 5C4JC 2PA8L 2E2JK 3S14C 4BBSC 1TWFC 3HOXK 3H3VD 1TWGC 3H3VL 4YG2A 5M3MK 4G7HA 3S16K 2E2IK 3I4NK 5IYDK 1R9TC 2JA7C 4A3EK 2E2JC 4BBRK 5IP9C 1XPPA 5M5XK 4XLNA 4A3IC 3S14K 4BY1C 4LLGA 4A93C 5IYBC 4A3EC 1I6VA 4NOIA 4C2MK 4A3GC 3HKZD 4LJZA 2JA6K 4BY1K 3I4NC 3CQZC 2NVXC 1YNNA 5C44K 5M5YK 3GTOK 3I4MC 4XLPA 4BBRC 4A3IK 1TWAC 1HQMA 1SMYA 5IP7K 5TMCA 5C44C 5C4JK 4OIQA 1I3QK 1ZYRA 4YFKA 4A3GK 2JA6C 1TWGK 4A3KC 2YU9K 4A3BC 4JK1A 3HOVC 4A3MK 1Y1VC 2A6HA 5IYDC 2NVTK 5M5WK 2PA8D 1Y1WK 2PMZL 4MEXA 3GTMC 3HOUC 3S1RC 2O5IA 1I6HC 4A3BK 3HOVK 4X6AC 2A6EA 4ZH4A 4OIPA 3S1RK 1I6HK 3GTOC 3I4MK 3S16C 5IYCC 4QIWD 4GZYA 3HOZK 3DXJA 5IP9K 2WAQL 4A3LK 4A3KK 3M3YC 4QJVB 2YU9C 4Y7NK 4A3LC 3K7AC 3GTGC 2NVYC 3HOZC 2PMZD 3K7AK 4C3HK 4XSZA 1TWCK 4Y7NC 4QJVA 4X6AK 1YNJA 3GTGK 4BXXK 1Y1VK 2PPBA 5IYCK 5M3FK 2NVTC 1Y1WC 3HOUK 2WAQD 3GTKC 1K83C 2WB1L 4Q4ZA 3PO3C 3HOWK 3S2HC 1K83K 4LK1A 2R92C 2B63K 1BDFA 2A68A 4A3CK 2Y0SL 2NVQK 1I50K 4KN4A 5TMFA 5D4DA 4A3DK 4YFXA 4YFNA 2JA5K 3S1QK 3M3YK 4OIRA 2B63C 4XSXA 4G7ZA 4BXXC 2JA5C 2O5JA 3RZDC 3HOYC 1I50C 2NVYK 1IW7A 3PO3K 2R7ZC 1SFOK 1TWCC 3GTQC 4A3FK 3S2HK 2R93K 4LK0A 3S15C 2CW0A 4MEYA 2BE5A 4AYBD 2E2HC 3GTJK 3HKZL 3S1NK 4A3CC 2R93C 3GTLC 2NVQC 2A69A 2Y0SD 1WCMC 2JA8K 1SFOC 4OINA 2E2HK 4OIOA 3GTQK 3S1NC 3PO2C 4A3DC 3S17C 3RZOC 3S15K 3HOXC 3HOWC 3GTKK 3GTPC 3S2DK 3RZOK 3RZDK 3HOYK 2R92K 1WCMK 4KN7A 5FJ8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J K;  3M4O K;  3S17 K;  3H0G K;  4A93 K;  4Y52 C;  5FLM K;  4A3F C;  3S1Q C;  5C3E K;  2VUM C;  4C3I K;  4AYB L;  4Y52 K;  5FLM C;  4G7O A;  3GTJ C;  4KMU A;  5C4X C;  2WB1 D;  4A3J C;  3M4O C;  3H0G C;  1TWA K;  5IP7 C;  4C3J K;  1R9T K;  2JA7 K;  3FKI C;  4MQ9 A;  3PO2 K;  1I3Q C;  4QIW L;  2R7Z K;  5C3E C;  2VUM K;  3FKI K;  3WOD A;  5IYB K;  1TWH K;  3GTP K;  3S2D C;  3S1M K;  5C4X K;  1TWF K;  4A3M C;  4BBS K;  3EQL A;  4BY7 K;  3CQZ K;  2NVX K;  1TWH C;  4Q5S A;  3S1M C;  4BY7 C;  3GTL K;  3GTM K;  2E2I C;  2JA8 C;  5C4J C;  2PA8 L;  2E2J K;  3S14 C;  4BBS C;  1TWF C;  3HOX K;  3H3V D;  1TWG C;  3H3V L;  4YG2 A;  5M3M K;  4G7H A;  3S16 K;  2E2I K;  3I4N K;  5IYD K;  1R9T C;  2JA7 C;  4A3E K;  2E2J C;  4BBR K;  5IP9 C;  1XPP A;  5M5X K;  4XLN A;  4A3I C;  3S14 K;  4BY1 C;  4LLG A;  4A93 C;  5IYB C;  4A3E C;  1I6V A;  4NOI A;  4C2M K;  4A3G C;  3HKZ D;  4LJZ A;  2JA6 K;  4BY1 K;  3I4N C;  3CQZ C;  2NVX C;  1YNN A;  5C44 K;  5M5Y K;  3GTO K;  3I4M C;  4XLP A;  4BBR C;  4A3I K;  1TWA C;  1HQM A;  1SMY A;  5IP7 K;  5TMC A;  5C44 C;  5C4J K;  4OIQ A;  1I3Q K;  1ZYR A;  4YFK A;  4A3G K;  2JA6 C;  1TWG K;  4A3K C;  2YU9 K;  4A3B C;  4JK1 A;  3HOV C;  4A3M K;  1Y1V C;  2A6H A;  5IYD C;  2NVT K;  5M5W K;  2PA8 D;  1Y1W K;  2PMZ L;  4MEX A;  3GTM C;  3HOU C;  3S1R C;  2O5I A;  1I6H C;  4A3B K;  3HOV K;  4X6A C;  2A6E A;  4ZH4 A;  4OIP A;  3S1R K;  1I6H K;  3GTO C;  3I4M K;  3S16 C;  5IYC C;  4QIW D;  4GZY A;  3HOZ K;  3DXJ A;  5IP9 K;  2WAQ L;  4A3L K;  4A3K K;  3M3Y C;  4QJV B;  2YU9 C;  4Y7N K;  4A3L C;  3K7A C;  3GTG C;  2NVY C;  3HOZ C;  2PMZ D;  3K7A K;  4C3H K;  4XSZ A;  1TWC K;  4Y7N C;  4QJV A;  4X6A K;  1YNJ A;  3GTG K;  4BXX K;  1Y1V K;  2PPB A;  5IYC K;  5M3F K;  2NVT C;  1Y1W C;  3HOU K;  2WAQ D;  3GTK C;  1K83 C;  2WB1 L;  4Q4Z A;  3PO3 C;  3HOW K;  3S2H C;  1K83 K;  4LK1 A;  2R92 C;  2B63 K;  1BDF A;  2A68 A;  4A3C K;  2Y0S L;  2NVQ K;  1I50 K;  4KN4 A;  5TMF A;  5D4D A;  4A3D K;  4YFX A;  4YFN A;  2JA5 K;  3S1Q K;  3M3Y K;  4OIR A;  2B63 C;  4XSX A;  4G7Z A;  4BXX C;  2JA5 C;  2O5J A;  3RZD C;  3HOY C;  1I50 C;  2NVY K;  1IW7 A;  3PO3 K;  2R7Z C;  1SFO K;  1TWC C;  3GTQ C;  4A3F K;  3S2H K;  2R93 K;  4LK0 A;  3S15 C;  2CW0 A;  4MEY A;  2BE5 A;  4AYB D;  2E2H C;  3GTJ K;  3HKZ L;  3S1N K;  4A3C C;  2R93 C;  3GTL C;  2NVQ C;  2A69 A;  2Y0S D;  1WCM C;  2JA8 K;  1SFO C;  4OIN A;  2E2H K;  4OIO A;  3GTQ K;  3S1N C;  3PO2 C;  4A3D C;  3S17 C;  3RZO C;  3S15 K;  3HOX C;  3HOW C;  3GTK K;  3GTP C;  3S2D K;  3RZO K;  3RZD K;  3HOY K;  2R92 K;  1WCM K;  4KN7 A;  5FJ8 K; 
#chains in the Genus database with same CATH topology
 3M4O K;  3S17 K;  1EFW A;  2GSO A;  1EK8 A;  3H0G A;  4BKW A;  3S1Q C;  3GSI A;  4KDD A;  4AYB L;  3GTJ C;  4KMU A;  5IP7 C;  2VUM A;  4MQ9 A;  3PO2 K;  4KM8 A;  1BJT A;  1ZQ1 C;  5HL8 A;  4C45 A;  3S2D C;  3V4G A;  3FKI A;  3EQL A;  5IOQ A;  2E2I C;  2EBB A;  4RMF A;  3S14 C;  3BP8 C;  1TWF C;  3HOX K;  3H3V L;  5M3M K;  1V5V A;  3S16 K;  2JA7 C;  1G51 A;  4GFQ A;  4XLN A;  4A3I C;  4KC6 A;  4BY1 C;  1UV7 A;  4LQY A;  4A3G C;  5IOS A;  4BY1 K;  3I4N C;  3CQZ C;  2Y3P A;  1YNN A;  5C44 K;  2RGR A;  3GTO K;  4G0V A;  5C44 C;  4O2D A;  4OIQ A;  2NVX A;  3A8K A;  1ZVU A;  4GTL A;  4YFK A;  3L4J A;  2YU9 K;  4JK1 A;  1JQW A;  1WSV A;  1XXA A;  1B4B A;  5CHP A;  2PMZ L;  4MEX A;  5CJ9 A;  4OIP A;  4KMH A;  3I4M K;  4KAS A;  4GZY A;  1PJ7 A;  3T00 A;  4C2M C;  3BP3 A;  3FOF A;  2ZUF A;  3HOZ C;  2YU9 A;  3GDZ A;  3BUE A;  1TWC K;  1Y1W A;  4X6A K;  2GSN A;  3S0X A;  1YNJ A;  3GTG K;  4BXX K;  1Y1V K;  4PAB A;  2NVT C;  1IQ0 A;  1J6V A;  1K83 C;  4LR2 A;  4Q4Z A;  2FQO A;  3GIR A;  4FZB A;  1K83 K;  4LK1 A;  1BDF A;  1X31 C;  1AB4 A;  2A68 A;  2KWA A;  2Y0S L;  4KM9 A;  2JA5 A;  3A8I A;  3CAG A;  5D4D A;  4A3D K;  4WJ4 A;  1WOO A;  4G7Z A;  1VH2 A;  2XCQ A;  1WIH A;  2O5J A;  1O2B A;  4J3N A;  3GTQ C;  1F7U A;  4A3F K;  4PAA A;  1B4A A;  1PJ5 A;  2BE5 A;  2R7Z A;  2NVQ C;  2Y0S D;  1WCM C;  2JA8 K;  2XCR B;  1J98 A;  3S17 C;  1EQR A;  3RZO C;  1DD5 A;  1XZQ A;  3HOW C;  3GTP C;  3RZO K;  3HOY K;  2W7V A;  4DDQ A;  1WSR A;  4A93 K;  3AQP A;  1IS1 A;  2JH3 A;  1XZP A;  4P9S A;  4WIL A;  4A3J C;  1I3Q C;  1O2F B;  4QIW L;  2PHC B;  2VUM K;  2FQT A;  3WOD A;  1TWH K;  3S1M K;  5C4X K;  1TWF K;  4A3M C;  1I3Q A;  1TWH C;  1TWF A;  3S1M C;  1XXC A;  1EI6 A;  3GTL K;  3GTM K;  4BBS C;  1TWG C;  1F93 A;  2E2I A;  4YG2 A;  4G7H A;  3I4N K;  3TFH A;  1R9T C;  5IP9 C;  3G4C A;  4LLG A;  5IYB C;  4NOI A;  1TWA A;  4GT9 A;  4LJZ A;  2NVX C;  3ERE D;  2CFA A;  4XLP A;  4BBR C;  1XXB A;  4ILD A;  5IP7 K;  1SMY A;  5TMC A;  5C4J K;  3CQZ A;  3G4A A;  3SZZ A;  5TJ3 A;  1F9N A;  5IYD C;  1L0W A;  3TTG A;  1XZQ B;  2PA8 D;  3HOU C;  1I6H C;  1Y1V A;  3HOV K;  1I6H K;  3S16 C;  3HOZ K;  4A3L K;  4A3K K;  1DCP A;  1IBA A;  4A3L C;  4LOW A;  3T01 A;  3GTG C;  2NVY C;  3N0C A;  4C3H K;  4XSZ A;  3ORE A;  1HI9 A;  4GTE A;  1RU0 A;  4C3H C;  2NVY A;  1WOR A;  3AD7 C;  5IYC K;  5M3F K;  4KAW X;  3GTK C;  1O29 A;  1O28 A;  2R92 C;  2RH6 A;  1I50 A;  4OIR A;  2B63 C;  4XSX A;  4GTA A;  1O24 A;  5IOR A;  1IW7 A;  3PO3 K;  2V6U A;  3IPJ A;  1TWC C;  2R7Z C;  3FHZ A;  3A8J A;  3S2H K;  1SFO A;  2R93 K;  2CW0 A;  3GTJ K;  2R93 C;  4A3C C;  5L46 A;  4KAT A;  3PO2 C;  3S15 K;  2P8T A;  3GTL A;  3S2D K;  1WCM A;  3Q3Q A;  3RZD K;  2V6T A;  4KN7 A;  4A3J K;  5FLM K;  4BLA A;  2VUM C;  3TFI A;  5FLM C;  4G0W A;  5C4X C;  2WB1 D;  3H0G C;  1TWA K;  3MML B;  2JA7 K;  1TWH A;  3GTJ A;  5C3E C;  4C3I C;  4BBS K;  3CQZ K;  3GEI A;  4Q5S A;  1TWG A;  2JA8 C;  3H3V D;  2P5M A;  2ZUE A;  1INN A;  4A3E K;  2E2J C;  4BBR K;  1XPP A;  4A93 C;  4A3E C;  1I6V A;  3HKZ D;  1R9T A;  5M5Y K;  3I4M C;  1EH1 A;  1J6X A;  3LAP A;  3N0B A;  1ISE A;  1I3Q K;  1ZYR A;  2JA6 C;  3QX3 A;  3HOV C;  4A3M K;  2CFA B;  4KAR A;  2XCO A;  1Y1W K;  3GTM C;  3T02 A;  3S1R C;  2O5I A;  4A3B K;  3AH5 A;  2A6E A;  3S1R K;  4X6A C;  3GTO C;  3LAJ A;  1IL2 A;  3GEH A;  1O2A A;  5IP9 K;  1WOS A;  3M3Y C;  4QJV B;  2YU9 C;  1JOE A;  3GEE A;  3K7A C;  1USM A;  3K7A K;  4Y7N C;  3GTG A;  4KMD A;  2PPB A;  4BLB A;  3HOU K;  1C0A A;  2WAQ D;  2WB1 L;  3N3Y A;  2GSU A;  2B63 K;  1ZBS A;  4KB2 A;  2NVQ K;  4KN4 A;  4YFX A;  2R92 A;  4YFN A;  3AQO A;  3S1Q K;  1JVI A;  4BXX C;  1TWC A;  3HOY C;  1I50 C;  4FM9 A;  2NVY K;  5JFE A;  2GAH C;  4GTD A;  2GAG C;  3NUH A;  3OPF A;  5EGH A;  3S15 C;  4AYB D;  3S1N K;  4AH6 A;  3TFJ A;  4P5A A;  3SZY A;  1SFO C;  4OIN A;  1YCL A;  3S1N C;  4A3D C;  1O25 A;  1VRQ C;  3GTK A;  1WQH A;  1O27 A;  3HOX C;  1J6W A;  2R92 K;  3H0G K;  1DCH A;  4Y52 C;  4A3F C;  5C3E K;  1VJE A;  4C3I K;  4Y52 K;  4G7O A;  5E68 A;  3M4O C;  4C3J K;  1R9T K;  1VLO A;  3FKI C;  2ZFZ A;  2R7Z K;  4C3J C;  3FKI K;  5IYB K;  2D6F C;  3GTP K;  3ADA C;  4BY7 K;  2NVX K;  5IOT A;  4BY7 C;  1KQ4 A;  5C4J C;  2PA8 L;  2E2J K;  4G0U A;  2E2I K;  5IYD K;  3S14 K;  5M5X K;  1ZXO A;  4C2M K;  2JA7 A;  2JA6 K;  1GE9 A;  1F7V A;  2JA6 A;  1WQF A;  4A3I K;  1TWA C;  1HQM A;  4A3G K;  1TWG K;  4A3K C;  3LPX A;  3GTM A;  4A3B C;  1Y1V C;  2A6H A;  3HXA A;  2NVT K;  5M5W K;  5JVO A;  1WQG A;  1YX2 A;  4ZH4 A;  3VA7 A;  5IYC C;  4QIW D;  4WJ3 M;  1DCO A;  3DXJ A;  4P5B A;  2WAQ L;  1PJ6 A;  3GTO A;  4M1X A;  4Y7N K;  4KB4 A;  2PMZ D;  1VGX A;  4QJV A;  2V6S A;  1O26 A;  1Y1W C;  4GTB A;  3PO3 C;  3HOW K;  3S2H C;  1K83 A;  3AD9 C;  5EGE A;  4A3C K;  2B63 A;  1I50 K;  3OEP A;  5TMF A;  1IE0 A;  2JA5 K;  1WOP A;  3M3Y K;  3FOE A;  2JA5 C;  3RZD C;  3JST A;  4GTC A;  1SFO K;  2R93 A;  4KMA A;  4LK0 A;  4MEY A;  1BGW A;  1BS2 A;  2E2H C;  3HKZ L;  1USO A;  3GTQ A;  3GTL C;  2A69 A;  3GTP A;  3AD8 C;  2E2H K;  4GTF A;  4OIO A;  3GTQ K;  4XCH A;  2E2H A;  1XZP B;  3GTK K;  3L4K A;  1WCM K;  5FJ8 K; 
#chains in the Genus database with same CATH homology
 4A3J K;  3M4O K;  3S17 K;  3H0G K;  4A93 K;  4Y52 C;  5FLM K;  4A3F C;  3S1Q C;  5C3E K;  2VUM C;  4C3I K;  4AYB L;  4Y52 K;  5FLM C;  4G7O A;  3GTJ C;  4KMU A;  5C4X C;  2WB1 D;  4A3J C;  3M4O C;  3H0G C;  1TWA K;  5IP7 C;  4C3J K;  1R9T K;  2JA7 K;  3FKI C;  4MQ9 A;  3PO2 K;  1I3Q C;  4QIW L;  2R7Z K;  5C3E C;  2VUM K;  3FKI K;  3WOD A;  5IYB K;  1TWH K;  3GTP K;  3S2D C;  3S1M K;  5C4X K;  1TWF K;  4A3M C;  4BBS K;  3EQL A;  4BY7 K;  3CQZ K;  2NVX K;  1TWH C;  4Q5S A;  3S1M C;  4BY7 C;  3GTL K;  3GTM K;  2E2I C;  2JA8 C;  5C4J C;  2PA8 L;  2E2J K;  3S14 C;  4BBS C;  1TWF C;  3HOX K;  3H3V D;  1TWG C;  3H3V L;  4YG2 A;  5M3M K;  4G7H A;  3S16 K;  2E2I K;  3I4N K;  5IYD K;  1R9T C;  2JA7 C;  4A3E K;  2E2J C;  4BBR K;  5IP9 C;  1XPP A;  5M5X K;  4XLN A;  4A3I C;  3S14 K;  4BY1 C;  4LLG A;  4A93 C;  5IYB C;  4A3E C;  1I6V A;  4NOI A;  4C2M K;  4A3G C;  3HKZ D;  4LJZ A;  2JA6 K;  4BY1 K;  3I4N C;  3CQZ C;  2NVX C;  1YNN A;  5C44 K;  5M5Y K;  3GTO K;  3I4M C;  4XLP A;  4BBR C;  4A3I K;  1TWA C;  1HQM A;  1SMY A;  5IP7 K;  5TMC A;  5C44 C;  5C4J K;  4OIQ A;  1I3Q K;  1ZYR A;  4YFK A;  4A3G K;  2JA6 C;  1TWG K;  4A3K C;  2YU9 K;  4A3B C;  4JK1 A;  3HOV C;  4A3M K;  1Y1V C;  2A6H A;  5IYD C;  2NVT K;  5M5W K;  2PA8 D;  1Y1W K;  2PMZ L;  4MEX A;  3GTM C;  3HOU C;  3S1R C;  2O5I A;  1I6H C;  4A3B K;  3HOV K;  4X6A C;  2A6E A;  4ZH4 A;  4OIP A;  3S1R K;  1I6H K;  3GTO C;  3I4M K;  3S16 C;  5IYC C;  4QIW D;  4GZY A;  3HOZ K;  3DXJ A;  5IP9 K;  2WAQ L;  4A3L K;  4A3K K;  3M3Y C;  4QJV B;  2YU9 C;  4Y7N K;  4A3L C;  3K7A C;  3GTG C;  2NVY C;  3HOZ C;  2PMZ D;  3K7A K;  4C3H K;  4XSZ A;  1TWC K;  4Y7N C;  4QJV A;  4X6A K;  1YNJ A;  3GTG K;  4BXX K;  1Y1V K;  2PPB A;  5IYC K;  5M3F K;  2NVT C;  1Y1W C;  3HOU K;  2WAQ D;  3GTK C;  1K83 C;  2WB1 L;  4Q4Z A;  3PO3 C;  3HOW K;  3S2H C;  1K83 K;  4LK1 A;  2R92 C;  2B63 K;  1BDF A;  2A68 A;  4A3C K;  2Y0S L;  2NVQ K;  1I50 K;  4KN4 A;  5TMF A;  5D4D A;  4A3D K;  4YFX A;  4YFN A;  2JA5 K;  3S1Q K;  3M3Y K;  4OIR A;  2B63 C;  4XSX A;  4G7Z A;  4BXX C;  2JA5 C;  2O5J A;  3RZD C;  3HOY C;  1I50 C;  2NVY K;  1IW7 A;  3PO3 K;  2R7Z C;  1SFO K;  1TWC C;  3GTQ C;  4A3F K;  3S2H K;  2R93 K;  4LK0 A;  3S15 C;  2CW0 A;  4MEY A;  2BE5 A;  4AYB D;  2E2H C;  3GTJ K;  3HKZ L;  3S1N K;  4A3C C;  2R93 C;  3GTL C;  2NVQ C;  2A69 A;  2Y0S D;  1WCM C;  2JA8 K;  1SFO C;  4OIN A;  2E2H K;  4OIO A;  3GTQ K;  3S1N C;  3PO2 C;  4A3D C;  3S17 C;  3RZO C;  3S15 K;  3HOX C;  3HOW C;  3GTK K;  3GTP C;  3S2D K;  3RZO K;  3RZD K;  3HOY K;  2R92 K;  1WCM K;  4KN7 A;  5FJ8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...