2JA7K

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 26
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja7K00
3S2DK 3H0GK 1SFOK 5FLMC 4G7HA 4AYBD 2E2IK 3GTQC 2WB1L 4G7OA 3H3VD 4BBSK 5C44K 2CW0A 3S1MC 3FKIK 5M5XK 3FKIC 3GTGK 2R93C 4QIWD 3S14C 4C2MK 4A93C 2E2JK 1TWAK 2E2JC 3EQLA 1TWCC 4KN7A 3CQZK 5IP9C 3S16C 4XSZA 3M4OC 3CQZC 4Y7NK 1ZYRA 1Y1WK 1I6HC 2PMZL 1SMYA 2PA8L 5M5YK 3PO3K 4Y52K 4MQ9A 4Y52C 4OIRA 2NVXK 2JA5C 2JA8K 2NVXC 2JA8C 4YFKA 3HKZL 2PMZD 5C4JC 1YNJA 4KN4A 2BE5A 4QJVA 4A3JC 5IYBK 3GTLC 5IP7K 3HOWK 4BXXC 3HKZD 5FLMK 4A3MK 3GTKC 4C3IK 4A3MC 3GTQK 2JA7C 1Y1VC 3I4NC 3GTJC 5C4XC 2A6HA 3S1MK 3S1RC 1I50C 3DXJA 4A3EC 2A69A 5FJ8K 3S14K 2R93K 4XLNA 1TWHC 4A93K 2WB1D 4BY1K 1TWCK 4QJVB 4BY1C 2VUMC 2JA6K 3M4OK 5IP9K 3S16K 2PPBA 2JA6C 1WCMK 5IYCC 1WCMC 3S15K 2E2HK 2R92C 3HOYK 3S15C 4BBRK 2E2HC 3HOYC 1I6HK 5TMCA 2WAQL 1TWGK 5TMFA 4BBRC 2O5JA 4A3LC 1TWGC 3S1QC 3HOVC 1YNNA 2JA5K 5D4DA 4C3JK 3HOZC 3WODA 5C4JK 2O5IA 3S17C 2WAQD 2PA8D 4A3JK 3GTLK 3I4MC 1IW7A 4JK1A 1R9TC 3GTPC 4BXXK 3S1NC 3GTKK 1XPPA 4KMUA 4A3CK 4X6AC 2JA7K 4A3CC 1Y1VK 3I4NK 3RZDK 3GTJK 5C4XK 4A3FC 3RZDC 3S1RK 1I50K 4XSXA 4A3EK 4Q5SA 3PO2C 2R7ZK 1K83C 4OINA 1TWHK 2R7ZC 4OIOA 3RZOC 2VUMK 4OIQA 4MEXA 5IYCK 2Y0SL 1I3QK 1TWFK 2B63C 3HOUC 2NVTC 1I3QC 1TWFC 2R92K 1HQMA 4A3LK 2NVYC 3S1QK 4A3DC 3HOVK 4LK1A 3HOXC 4AYBL 5M3FK 4A3IK 4A3KC 3GTMC 3GTOK 4YG2A 3K7AC 4A3IC 3GTOC 3H3VL 2NVQK 3HOZK 3S17K 2NVQC 1SFOC 2YU9C 3GTGC 5IYDC 3M3YC 3I4MK 4QIWL 3S2DC 3H0GC 1R9TK 4G7ZA 2E2IC 3GTPK 2A6EA 3S1NK 4BY7K 4BBSC 5C44C 4X6AK 5M3MK 4A3FK 5IYDK 3PO2K 1TWAC 1K83K 1BDFA 3S2HK 5C3EK 3RZOK 3S2HC 5C3EC 4LK0A 4GZYA 4YFXA 4Y7NC 1Y1WC 4A3BK 4A3GK 4A3BC 4ZH4A 2B63K 4A3GC 3HOUK 2NVTK 3PO3C 4NOIA 4LLGA 4YFNA 2NVYK 1I6VA 4A3DK 4OIPA 4LJZA 3HOXK 4Q4ZA 4A3KK 3GTMK 4C3HK 3K7AK 2Y0SD 4XLPA 4MEYA 5M5WK 2A68A 5IYBC 2YU9K 5IP7C 3HOWC 3M3YK 4BY7C
chains in the Genus database with same CATH superfamily
1RU0A 4G7HA 4P9SA 1J98A 3H3VD 5C44K 2ZUEA 1AB4A 4QIWD 3S14C 1WQHA 3BUEA 2E2JK 2GSUA 1WOOA 3M4OC 3CQZC 5CJ9A 1JVIA 1ZYRA 1I6HC 2PMZL 2PA8L 1GE9A 4Y52K 4OIRA 1WCMA 2NVXK 2R92A 3T01A 1WOSA 2E2HA 3GEHA 4YFKA 3HKZL 2PMZD 2W7VA 5C4JC 3AD9C 4KN4A 4DDQA 1BS2A 2Y3PA 1INNA 3HKZD 1XXCA 1R9TA 3GTJC 4XLNA 1TWHC 5IORA 2WB1D 1EK8A 1TWCK 2VUMC 1V5VA 3BP3A 1WCMK 2E2HK 3S15C 2O5JA 3HOYC 2WAQL 4FZBA 1TWGC 2B63A 3OPFA 1IL2A 5E68A 1I3QA 1TWFA 5D4DA 2JA5K 2V6UA 3HOZC 2O5IA 5L46A 2WAQD 2NVYA 1F7VA 3GTLK 4LR2A 1IW7A 4JK1A 4WJ3M 3GTKK 4BLAA 1Y1VK 4G0VA 3I4NK 1O2AA 3RZDC 1I50K 3GDZA 1O26A 4OIOA 1J6WA 1ZXOA 2XCRB 1UV7A 3SZYA 1I3QK 1TWFK 3LPXA 3HOUC 1VGXA 3S1QK 3HOXC 4AYBL 3HXAA 3GTMC 3S17K 2NVQK 2YU9C 3GTGC 4WILA 3GTPK 3A8IA 3GSIA 5C44C 4X6AK 1KQ4A 3GTQA 1K83K 3S2HK 2XCOA 3N3YA 3FHZA 3IPJA 5JFEA 4GZYA 4KMDA 1USMA 4A3GK 1EH1A 1ISEA 3VA7A 2RGRA 4YFNA 4LJZA 4A3KK 4G0WA 3K7AK 1VJEA 1PJ7A 5M3FK 3TFJA 3M3YK 4BY7C 1EI6A 3AH5A 3FKIC 2P5MA 2JA7A 4C2MK 1YX2A 4GTLA 4J3NA 1TWAK 1TWCC 4XSZA 2R93A 1Y1WK 1XZQB 4M1XA 1J6VA 2JA5C 2JA8C 1YNJA 3GTLC 5IYBK 4KMHA 3HOWK 2XCQA 4A3MK 3GTKC 4C3IK 4KM9A 1Y1VC 3I4NC 2A6HA 3S1MK 1I50C 4O2DA 2A69A 3AD8C 2R93K 4A93K 4BY1K 3G4AA 4QJVB 1HI9A 2EBBA 5IP9K 3S16K 2JA6C 2R7ZA 3G4CA 4BBRC 1BGWA 3S1QC 3JSTA 1WQGA 1YNNA 4C3JK 3S17C 1WSVA 3LAPA 2PA8D 1ZQ1C 4A3JK 3GTPC 2ZUFA 4KARA 1SFOA 1XPPA 4KMUA 3TFIA 4X6AC 4A3CC 3TFHA 2GSOA 3H0GA 2E2IA 1VRQC 4XSXA 4A3EK 1VLOA 1F9NA 2R7ZK 1K83C 4OINA 3A8KA 4PAAA 5IYCK 1BJTA 1F7UA 2R92K 1O29A 3HOVK 4A3IK 4A3KC 4XCHA 3K7AC 4PABA 3GTOC 5HL8A 3M3YC 4BKWA 4ILDA 1R9TK 2A6EA 5M3MK 4C2MC 1TWAC 1DD5A 5C3EC 3ADAC 1Y1WC 4A3BC 2B63K 4NOIA 3CQZA 1G51A 2NVYK 4OIPA 1XZPB 4Q4ZA 5M5WK 5IYBC 2CFAA 3HOWC 3S2DK 1ZBSA 4AYBD 4C3IC 4P5AA 1XZQA 4G7OA 4AH6A 4BBSK 4LQYA 3T02A 3S1MC 4LOWA 4RMFA 2R93C 4A93C 3GTJA 2E2JC 3EQLA 3CQZK 5IP9C 3S16C 1TWHA 4Y7NK 2VUMA 3PO3K 3ERED 4MQ9A 4Y52C 2FQOA 2NVXC 4C3JC 2P8TA 1TWGA 3CAGA 2BE5A 4QJVA 3FOFA 4A3JC 1F93A 1EFWA 5FLMK 3GTQK 1EQRA 3GEEA 3DXJA 4A3EC 5FJ8K 3TTGA 3S0XA 4GTFA 1X31C 2CFAB 5IYCC 1JOEA 1WCMC 3S15K 2R92C 3HOYK 2E2HC 4G0UA 1TWGK 5TMFA 3HOVC 3FOEA 3WODA 3GTMA 1IS1A 1R9TC 4BXXK 3OREA 2YU9A 5EGHA 2JA7K 3RZDK 5C4XK 3S1RK 4P5BA 4Q5SA 3OEPA 4KC6A 1DCHA 3T00A 1O28A 2ZFZA 5JVOA 3LAJA 4OIQA 2Y0SL 2B63C 1I3QC 1TWFC 4GTCA 4A3LK 2NVYC 4LK1A 1YCLA 1XXAA 4YG2A 3H3VL 1O27A 3A8JA 2NVQC 3AQPA 3L4KA 3I4MK 4QIWL 3S2DC 4G7ZA 3S1NK 4BBSC 4A3FK 1WIHA 4KATA 1XZPA 3PO2K 1BDFA 3FKIA 3RZOK 3S2HC 1USOA 4Y7NC 4ZH4A 1TWCA 4A3GC 2NVTK 3SZZA 3PO3C 1IQ0A 4LLGA 2GAHC 1I6VA 2FQTA 3QX3A 4A3DK 5CHPA 3V4GA 1L0WA 4C3HK 3BP8C 2PHCB 3Q3QA 2A68A 1SFOK 2JA5A 5IOTA 4BY7K 5IYDK 3NUHA 1B4BA 3H0GK 5FLMC 2E2IK 3GTQC 2WB1L 3GTLA 1VH2A 2CW0A 3FKIK 5M5XK 3GTGK 3GTKA 4FM9A 1WSRA 1PJ6A 1Y1VA 1IE0A 1DCPA 5EGEA 1I50A 4KN7A 2GAGC 4KB2A 4GTBA 1SMYA 5M5YK 2JA6A 4C45A 2JA8K 2KWAA 4GTDA 5IP7K 4BXXC 4A3MC 2JA7C 1C0AA 3GTPA 5C4XC 3S1RC 1XXBA 3S14K 5TJ3A 3GEIA 4BY1C 3AD7C 2JA6K 4BLBA 3M4OK 3N0CA 1K83A 2PPBA 2V6TA 1B4AA 1I6HK 3MMLB 4BBRK 5TMCA 4A3LC 1IBAA 4KM8A 3AQOA 5C4JK 4GT9A 4KMAA 4KB4A 3I4MC 3GTOA 3L4JA 3S1NC 4A3CK 3N0BA 2RH6A 1DCOA 1JQWA 3GTJK 4A3FC 5IOSA 1O2BA 3PO2C 1TWHK 2R7ZC 1WQFA 5IOQA 3RZOC 2VUMK 1TWAA 4GTAA 4MEXA 4KASA 2NVTC 1HQMA 4KDDA 1Y1WA 4A3DC 4C3HC 3GTOK 1O25A 4A3IC 3HOZK 2D6FC 1SFOC 1PJ5A 1O24A 5IYDC 4KAWX 3H0GC 1WOPA 2E2IC 2GSNA 3GTGA 4WJ4A 4GTEA 2V6SA 1J6XA 5C3EK 4LK0A 4YFXA 4A3BK 1O2FB 3HOUK 4GFQA 2JH3A 3GIRA 1WORA 3HOXK 3GTMK 4XLPA 2Y0SD 4MEYA 1ZVUA 2YU9K 5IP7C 2NVXA
chains in the Genus database with same CATH topology
3S2DK 3H0GK 1SFOK 5FLMC 4G7HA 4AYBD 2E2IK 3GTQC 2WB1L 4G7OA 3H3VD 4BBSK 5C44K 2CW0A 3S1MC 3FKIK 5M5XK 3FKIC 3GTGK 2R93C 4QIWD 3S14C 4C2MK 4A93C 2E2JK 1TWAK 2E2JC 3EQLA 1TWCC 4KN7A 3CQZK 5IP9C 3S16C 4XSZA 3M4OC 3CQZC 4Y7NK 1ZYRA 1Y1WK 1I6HC 2PMZL 1SMYA 2PA8L 5M5YK 3PO3K 4Y52K 4MQ9A 4Y52C 4OIRA 2NVXK 2JA5C 2JA8K 2NVXC 2JA8C 4YFKA 3HKZL 2PMZD 5C4JC 1YNJA 4KN4A 2BE5A 4QJVA 4A3JC 5IYBK 3GTLC 5IP7K 3HOWK 4BXXC 3HKZD 5FLMK 4A3MK 3GTKC 4C3IK 4A3MC 3GTQK 2JA7C 1Y1VC 3I4NC 3GTJC 5C4XC 2A6HA 3S1MK 3S1RC 1I50C 3DXJA 4A3EC 2A69A 5FJ8K 3S14K 2R93K 4XLNA 1TWHC 4A93K 2WB1D 4BY1K 1TWCK 4QJVB 4BY1C 2VUMC 2JA6K 3M4OK 5IP9K 3S16K 2PPBA 2JA6C 1WCMK 5IYCC 1WCMC 3S15K 2E2HK 2R92C 3HOYK 3S15C 4BBRK 2E2HC 3HOYC 1I6HK 5TMCA 2WAQL 1TWGK 5TMFA 4BBRC 2O5JA 4A3LC 1TWGC 3S1QC 3HOVC 1YNNA 2JA5K 5D4DA 4C3JK 3HOZC 3WODA 5C4JK 2O5IA 3S17C 2WAQD 2PA8D 4A3JK 3GTLK 3I4MC 1IW7A 4JK1A 1R9TC 3GTPC 4BXXK 3S1NC 3GTKK 1XPPA 4KMUA 4A3CK 4X6AC 2JA7K 4A3CC 1Y1VK 3I4NK 3RZDK 3GTJK 5C4XK 4A3FC 3RZDC 3S1RK 1I50K 4XSXA 4A3EK 4Q5SA 3PO2C 2R7ZK 1K83C 4OINA 1TWHK 2R7ZC 4OIOA 3RZOC 2VUMK 4OIQA 4MEXA 5IYCK 2Y0SL 1I3QK 1TWFK 2B63C 3HOUC 2NVTC 1I3QC 1TWFC 2R92K 1HQMA 4A3LK 2NVYC 3S1QK 4A3DC 3HOVK 4LK1A 3HOXC 4AYBL 5M3FK 4A3IK 4A3KC 3GTMC 3GTOK 4YG2A 3K7AC 4A3IC 3GTOC 3H3VL 2NVQK 3HOZK 3S17K 2NVQC 1SFOC 2YU9C 3GTGC 5IYDC 3M3YC 3I4MK 4QIWL 3S2DC 3H0GC 1R9TK 4G7ZA 2E2IC 3GTPK 2A6EA 3S1NK 4BY7K 4BBSC 5C44C 4X6AK 5M3MK 4A3FK 5IYDK 3PO2K 1TWAC 1K83K 1BDFA 3S2HK 5C3EK 3RZOK 3S2HC 5C3EC 4LK0A 4GZYA 4YFXA 4Y7NC 1Y1WC 4A3BK 4A3GK 4A3BC 4ZH4A 2B63K 4A3GC 3HOUK 2NVTK 3PO3C 4NOIA 4LLGA 4YFNA 2NVYK 1I6VA 4A3DK 4OIPA 4LJZA 3HOXK 4Q4ZA 4A3KK 3GTMK 4C3HK 3K7AK 2Y0SD 4XLPA 4MEYA 5M5WK 2A68A 5IYBC 2YU9K 5IP7C 3HOWC 3M3YK 4BY7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D K;  3H0G K;  1SFO K;  5FLM C;  4G7H A;  4AYB D;  2E2I K;  3GTQ C;  2WB1 L;  4G7O A;  3H3V D;  4BBS K;  5C44 K;  2CW0 A;  3S1M C;  3FKI K;  5M5X K;  3FKI C;  3GTG K;  2R93 C;  4QIW D;  3S14 C;  4C2M K;  4A93 C;  2E2J K;  1TWA K;  2E2J C;  3EQL A;  1TWC C;  4KN7 A;  3CQZ K;  5IP9 C;  3S16 C;  4XSZ A;  3M4O C;  3CQZ C;  4Y7N K;  1ZYR A;  1Y1W K;  1I6H C;  2PMZ L;  1SMY A;  2PA8 L;  5M5Y K;  3PO3 K;  4Y52 K;  4MQ9 A;  4Y52 C;  4OIR A;  2NVX K;  2JA5 C;  2JA8 K;  2NVX C;  2JA8 C;  4YFK A;  3HKZ L;  2PMZ D;  5C4J C;  1YNJ A;  4KN4 A;  2BE5 A;  4QJV A;  4A3J C;  5IYB K;  3GTL C;  5IP7 K;  3HOW K;  4BXX C;  3HKZ D;  5FLM K;  4A3M K;  3GTK C;  4C3I K;  4A3M C;  3GTQ K;  2JA7 C;  1Y1V C;  3I4N C;  3GTJ C;  5C4X C;  2A6H A;  3S1M K;  3S1R C;  1I50 C;  3DXJ A;  4A3E C;  2A69 A;  5FJ8 K;  3S14 K;  2R93 K;  4XLN A;  1TWH C;  4A93 K;  2WB1 D;  4BY1 K;  1TWC K;  4QJV B;  4BY1 C;  2VUM C;  2JA6 K;  3M4O K;  5IP9 K;  3S16 K;  2PPB A;  2JA6 C;  1WCM K;  5IYC C;  1WCM C;  3S15 K;  2E2H K;  2R92 C;  3HOY K;  3S15 C;  4BBR K;  2E2H C;  3HOY C;  1I6H K;  5TMC A;  2WAQ L;  1TWG K;  5TMF A;  4BBR C;  2O5J A;  4A3L C;  1TWG C;  3S1Q C;  3HOV C;  1YNN A;  2JA5 K;  5D4D A;  4C3J K;  3HOZ C;  3WOD A;  5C4J K;  2O5I A;  3S17 C;  2WAQ D;  2PA8 D;  4A3J K;  3GTL K;  3I4M C;  1IW7 A;  4JK1 A;  1R9T C;  3GTP C;  4BXX K;  3S1N C;  3GTK K;  1XPP A;  4KMU A;  4A3C K;  4X6A C;  2JA7 K;  4A3C C;  1Y1V K;  3I4N K;  3RZD K;  3GTJ K;  5C4X K;  4A3F C;  3RZD C;  3S1R K;  1I50 K;  4XSX A;  4A3E K;  4Q5S A;  3PO2 C;  2R7Z K;  1K83 C;  4OIN A;  1TWH K;  2R7Z C;  4OIO A;  3RZO C;  2VUM K;  4OIQ A;  4MEX A;  5IYC K;  2Y0S L;  1I3Q K;  1TWF K;  2B63 C;  3HOU C;  2NVT C;  1I3Q C;  1TWF C;  2R92 K;  1HQM A;  4A3L K;  2NVY C;  3S1Q K;  4A3D C;  3HOV K;  4LK1 A;  3HOX C;  4AYB L;  5M3F K;  4A3I K;  4A3K C;  3GTM C;  3GTO K;  4YG2 A;  3K7A C;  4A3I C;  3GTO C;  3H3V L;  2NVQ K;  3HOZ K;  3S17 K;  2NVQ C;  1SFO C;  2YU9 C;  3GTG C;  5IYD C;  3M3Y C;  3I4M K;  4QIW L;  3S2D C;  3H0G C;  1R9T K;  4G7Z A;  2E2I C;  3GTP K;  2A6E A;  3S1N K;  4BY7 K;  4BBS C;  5C44 C;  4X6A K;  5M3M K;  4A3F K;  5IYD K;  3PO2 K;  1TWA C;  1K83 K;  1BDF A;  3S2H K;  5C3E K;  3RZO K;  3S2H C;  5C3E C;  4LK0 A;  4GZY A;  4YFX A;  4Y7N C;  1Y1W C;  4A3B K;  4A3G K;  4A3B C;  4ZH4 A;  2B63 K;  4A3G C;  3HOU K;  2NVT K;  3PO3 C;  4NOI A;  4LLG A;  4YFN A;  2NVY K;  1I6V A;  4A3D K;  4OIP A;  4LJZ A;  3HOX K;  4Q4Z A;  4A3K K;  3GTM K;  4C3H K;  3K7A K;  2Y0S D;  4XLP A;  4MEY A;  5M5W K;  2A68 A;  5IYB C;  2YU9 K;  5IP7 C;  3HOW C;  3M3Y K;  4BY7 C; 
#chains in the Genus database with same CATH topology
 1RU0 A;  4G7H A;  4P9S A;  1J98 A;  3H3V D;  5C44 K;  2ZUE A;  1AB4 A;  4QIW D;  3S14 C;  1WQH A;  3BUE A;  2E2J K;  2GSU A;  1WOO A;  3M4O C;  3CQZ C;  5CJ9 A;  1JVI A;  1ZYR A;  1I6H C;  2PMZ L;  2PA8 L;  1GE9 A;  4Y52 K;  4OIR A;  1WCM A;  2NVX K;  2R92 A;  3T01 A;  1WOS A;  2E2H A;  3GEH A;  4YFK A;  3HKZ L;  2PMZ D;  2W7V A;  5C4J C;  3AD9 C;  4KN4 A;  4DDQ A;  1BS2 A;  2Y3P A;  1INN A;  3HKZ D;  1XXC A;  1R9T A;  3GTJ C;  4XLN A;  1TWH C;  5IOR A;  2WB1 D;  1EK8 A;  1TWC K;  2VUM C;  1V5V A;  3BP3 A;  1WCM K;  2E2H K;  3S15 C;  2O5J A;  3HOY C;  2WAQ L;  4FZB A;  1TWG C;  2B63 A;  3OPF A;  1IL2 A;  5E68 A;  1I3Q A;  1TWF A;  5D4D A;  2JA5 K;  2V6U A;  3HOZ C;  2O5I A;  5L46 A;  2WAQ D;  2NVY A;  1F7V A;  3GTL K;  4LR2 A;  1IW7 A;  4JK1 A;  4WJ3 M;  3GTK K;  4BLA A;  1Y1V K;  4G0V A;  3I4N K;  1O2A A;  3RZD C;  1I50 K;  3GDZ A;  1O26 A;  4OIO A;  1J6W A;  1ZXO A;  2XCR B;  1UV7 A;  3SZY A;  1I3Q K;  1TWF K;  3LPX A;  3HOU C;  1VGX A;  3S1Q K;  3HOX C;  4AYB L;  3HXA A;  3GTM C;  3S17 K;  2NVQ K;  2YU9 C;  3GTG C;  4WIL A;  3GTP K;  3A8I A;  3GSI A;  5C44 C;  4X6A K;  1KQ4 A;  3GTQ A;  1K83 K;  3S2H K;  2XCO A;  3N3Y A;  3FHZ A;  3IPJ A;  5JFE A;  4GZY A;  4KMD A;  1USM A;  4A3G K;  1EH1 A;  1ISE A;  3VA7 A;  2RGR A;  4YFN A;  4LJZ A;  4A3K K;  4G0W A;  3K7A K;  1VJE A;  1PJ7 A;  5M3F K;  3TFJ A;  3M3Y K;  4BY7 C;  1EI6 A;  3AH5 A;  3FKI C;  2P5M A;  2JA7 A;  4C2M K;  1YX2 A;  4GTL A;  4J3N A;  1TWA K;  1TWC C;  4XSZ A;  2R93 A;  1Y1W K;  1XZQ B;  4M1X A;  1J6V A;  2JA5 C;  2JA8 C;  1YNJ A;  3GTL C;  5IYB K;  4KMH A;  3HOW K;  2XCQ A;  4A3M K;  3GTK C;  4C3I K;  4KM9 A;  1Y1V C;  3I4N C;  2A6H A;  3S1M K;  1I50 C;  4O2D A;  2A69 A;  3AD8 C;  2R93 K;  4A93 K;  4BY1 K;  3G4A A;  4QJV B;  1HI9 A;  2EBB A;  5IP9 K;  3S16 K;  2JA6 C;  2R7Z A;  3G4C A;  4BBR C;  1BGW A;  3S1Q C;  3JST A;  1WQG A;  1YNN A;  4C3J K;  3S17 C;  1WSV A;  3LAP A;  2PA8 D;  1ZQ1 C;  4A3J K;  3GTP C;  2ZUF A;  4KAR A;  1SFO A;  1XPP A;  4KMU A;  3TFI A;  4X6A C;  4A3C C;  3TFH A;  2GSO A;  3H0G A;  2E2I A;  1VRQ C;  4XSX A;  4A3E K;  1VLO A;  1F9N A;  2R7Z K;  1K83 C;  4OIN A;  3A8K A;  4PAA A;  5IYC K;  1BJT A;  1F7U A;  2R92 K;  1O29 A;  3HOV K;  4A3I K;  4A3K C;  4XCH A;  3K7A C;  4PAB A;  3GTO C;  5HL8 A;  3M3Y C;  4BKW A;  4ILD A;  1R9T K;  2A6E A;  5M3M K;  4C2M C;  1TWA C;  1DD5 A;  5C3E C;  3ADA C;  1Y1W C;  4A3B C;  2B63 K;  4NOI A;  3CQZ A;  1G51 A;  2NVY K;  4OIP A;  1XZP B;  4Q4Z A;  5M5W K;  5IYB C;  2CFA A;  3HOW C;  3S2D K;  1ZBS A;  4AYB D;  4C3I C;  4P5A A;  1XZQ A;  4G7O A;  4AH6 A;  4BBS K;  4LQY A;  3T02 A;  3S1M C;  4LOW A;  4RMF A;  2R93 C;  4A93 C;  3GTJ A;  2E2J C;  3EQL A;  3CQZ K;  5IP9 C;  3S16 C;  1TWH A;  4Y7N K;  2VUM A;  3PO3 K;  3ERE D;  4MQ9 A;  4Y52 C;  2FQO A;  2NVX C;  4C3J C;  2P8T A;  1TWG A;  3CAG A;  2BE5 A;  4QJV A;  3FOF A;  4A3J C;  1F93 A;  1EFW A;  5FLM K;  3GTQ K;  1EQR A;  3GEE A;  3DXJ A;  4A3E C;  5FJ8 K;  3TTG A;  3S0X A;  4GTF A;  1X31 C;  2CFA B;  5IYC C;  1JOE A;  1WCM C;  3S15 K;  2R92 C;  3HOY K;  2E2H C;  4G0U A;  1TWG K;  5TMF A;  3HOV C;  3FOE A;  3WOD A;  3GTM A;  1IS1 A;  1R9T C;  4BXX K;  3ORE A;  2YU9 A;  5EGH A;  2JA7 K;  3RZD K;  5C4X K;  3S1R K;  4P5B A;  4Q5S A;  3OEP A;  4KC6 A;  1DCH A;  3T00 A;  1O28 A;  2ZFZ A;  5JVO A;  3LAJ A;  4OIQ A;  2Y0S L;  2B63 C;  1I3Q C;  1TWF C;  4GTC A;  4A3L K;  2NVY C;  4LK1 A;  1YCL A;  1XXA A;  4YG2 A;  3H3V L;  1O27 A;  3A8J A;  2NVQ C;  3AQP A;  3L4K A;  3I4M K;  4QIW L;  3S2D C;  4G7Z A;  3S1N K;  4BBS C;  4A3F K;  1WIH A;  4KAT A;  1XZP A;  3PO2 K;  1BDF A;  3FKI A;  3RZO K;  3S2H C;  1USO A;  4Y7N C;  4ZH4 A;  1TWC A;  4A3G C;  2NVT K;  3SZZ A;  3PO3 C;  1IQ0 A;  4LLG A;  2GAH C;  1I6V A;  2FQT A;  3QX3 A;  4A3D K;  5CHP A;  3V4G A;  1L0W A;  4C3H K;  3BP8 C;  2PHC B;  3Q3Q A;  2A68 A;  1SFO K;  2JA5 A;  5IOT A;  4BY7 K;  5IYD K;  3NUH A;  1B4B A;  3H0G K;  5FLM C;  2E2I K;  3GTQ C;  2WB1 L;  3GTL A;  1VH2 A;  2CW0 A;  3FKI K;  5M5X K;  3GTG K;  3GTK A;  4FM9 A;  1WSR A;  1PJ6 A;  1Y1V A;  1IE0 A;  1DCP A;  5EGE A;  1I50 A;  4KN7 A;  2GAG C;  4KB2 A;  4GTB A;  1SMY A;  5M5Y K;  2JA6 A;  4C45 A;  2JA8 K;  2KWA A;  4GTD A;  5IP7 K;  4BXX C;  4A3M C;  2JA7 C;  1C0A A;  3GTP A;  5C4X C;  3S1R C;  1XXB A;  3S14 K;  5TJ3 A;  3GEI A;  4BY1 C;  3AD7 C;  2JA6 K;  4BLB A;  3M4O K;  3N0C A;  1K83 A;  2PPB A;  2V6T A;  1B4A A;  1I6H K;  3MML B;  4BBR K;  5TMC A;  4A3L C;  1IBA A;  4KM8 A;  3AQO A;  5C4J K;  4GT9 A;  4KMA A;  4KB4 A;  3I4M C;  3GTO A;  3L4J A;  3S1N C;  4A3C K;  3N0B A;  2RH6 A;  1DCO A;  1JQW A;  3GTJ K;  4A3F C;  5IOS A;  1O2B A;  3PO2 C;  1TWH K;  2R7Z C;  1WQF A;  5IOQ A;  3RZO C;  2VUM K;  1TWA A;  4GTA A;  4MEX A;  4KAS A;  2NVT C;  1HQM A;  4KDD A;  1Y1W A;  4A3D C;  4C3H C;  3GTO K;  1O25 A;  4A3I C;  3HOZ K;  2D6F C;  1SFO C;  1PJ5 A;  1O24 A;  5IYD C;  4KAW X;  3H0G C;  1WOP A;  2E2I C;  2GSN A;  3GTG A;  4WJ4 A;  4GTE A;  2V6S A;  1J6X A;  5C3E K;  4LK0 A;  4YFX A;  4A3B K;  1O2F B;  3HOU K;  4GFQ A;  2JH3 A;  3GIR A;  1WOR A;  3HOX K;  3GTM K;  4XLP A;  2Y0S D;  4MEY A;  1ZVU A;  2YU9 K;  5IP7 C;  2NVX A; 
#chains in the Genus database with same CATH homology
 3S2D K;  3H0G K;  1SFO K;  5FLM C;  4G7H A;  4AYB D;  2E2I K;  3GTQ C;  2WB1 L;  4G7O A;  3H3V D;  4BBS K;  5C44 K;  2CW0 A;  3S1M C;  3FKI K;  5M5X K;  3FKI C;  3GTG K;  2R93 C;  4QIW D;  3S14 C;  4C2M K;  4A93 C;  2E2J K;  1TWA K;  2E2J C;  3EQL A;  1TWC C;  4KN7 A;  3CQZ K;  5IP9 C;  3S16 C;  4XSZ A;  3M4O C;  3CQZ C;  4Y7N K;  1ZYR A;  1Y1W K;  1I6H C;  2PMZ L;  1SMY A;  2PA8 L;  5M5Y K;  3PO3 K;  4Y52 K;  4MQ9 A;  4Y52 C;  4OIR A;  2NVX K;  2JA5 C;  2JA8 K;  2NVX C;  2JA8 C;  4YFK A;  3HKZ L;  2PMZ D;  5C4J C;  1YNJ A;  4KN4 A;  2BE5 A;  4QJV A;  4A3J C;  5IYB K;  3GTL C;  5IP7 K;  3HOW K;  4BXX C;  3HKZ D;  5FLM K;  4A3M K;  3GTK C;  4C3I K;  4A3M C;  3GTQ K;  2JA7 C;  1Y1V C;  3I4N C;  3GTJ C;  5C4X C;  2A6H A;  3S1M K;  3S1R C;  1I50 C;  3DXJ A;  4A3E C;  2A69 A;  5FJ8 K;  3S14 K;  2R93 K;  4XLN A;  1TWH C;  4A93 K;  2WB1 D;  4BY1 K;  1TWC K;  4QJV B;  4BY1 C;  2VUM C;  2JA6 K;  3M4O K;  5IP9 K;  3S16 K;  2PPB A;  2JA6 C;  1WCM K;  5IYC C;  1WCM C;  3S15 K;  2E2H K;  2R92 C;  3HOY K;  3S15 C;  4BBR K;  2E2H C;  3HOY C;  1I6H K;  5TMC A;  2WAQ L;  1TWG K;  5TMF A;  4BBR C;  2O5J A;  4A3L C;  1TWG C;  3S1Q C;  3HOV C;  1YNN A;  2JA5 K;  5D4D A;  4C3J K;  3HOZ C;  3WOD A;  5C4J K;  2O5I A;  3S17 C;  2WAQ D;  2PA8 D;  4A3J K;  3GTL K;  3I4M C;  1IW7 A;  4JK1 A;  1R9T C;  3GTP C;  4BXX K;  3S1N C;  3GTK K;  1XPP A;  4KMU A;  4A3C K;  4X6A C;  2JA7 K;  4A3C C;  1Y1V K;  3I4N K;  3RZD K;  3GTJ K;  5C4X K;  4A3F C;  3RZD C;  3S1R K;  1I50 K;  4XSX A;  4A3E K;  4Q5S A;  3PO2 C;  2R7Z K;  1K83 C;  4OIN A;  1TWH K;  2R7Z C;  4OIO A;  3RZO C;  2VUM K;  4OIQ A;  4MEX A;  5IYC K;  2Y0S L;  1I3Q K;  1TWF K;  2B63 C;  3HOU C;  2NVT C;  1I3Q C;  1TWF C;  2R92 K;  1HQM A;  4A3L K;  2NVY C;  3S1Q K;  4A3D C;  3HOV K;  4LK1 A;  3HOX C;  4AYB L;  5M3F K;  4A3I K;  4A3K C;  3GTM C;  3GTO K;  4YG2 A;  3K7A C;  4A3I C;  3GTO C;  3H3V L;  2NVQ K;  3HOZ K;  3S17 K;  2NVQ C;  1SFO C;  2YU9 C;  3GTG C;  5IYD C;  3M3Y C;  3I4M K;  4QIW L;  3S2D C;  3H0G C;  1R9T K;  4G7Z A;  2E2I C;  3GTP K;  2A6E A;  3S1N K;  4BY7 K;  4BBS C;  5C44 C;  4X6A K;  5M3M K;  4A3F K;  5IYD K;  3PO2 K;  1TWA C;  1K83 K;  1BDF A;  3S2H K;  5C3E K;  3RZO K;  3S2H C;  5C3E C;  4LK0 A;  4GZY A;  4YFX A;  4Y7N C;  1Y1W C;  4A3B K;  4A3G K;  4A3B C;  4ZH4 A;  2B63 K;  4A3G C;  3HOU K;  2NVT K;  3PO3 C;  4NOI A;  4LLG A;  4YFN A;  2NVY K;  1I6V A;  4A3D K;  4OIP A;  4LJZ A;  3HOX K;  4Q4Z A;  4A3K K;  3GTM K;  4C3H K;  3K7A K;  2Y0S D;  4XLP A;  4MEY A;  5M5W K;  2A68 A;  5IYB C;  2YU9 K;  5IP7 C;  3HOW C;  3M3Y K;  4BY7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...