2JA7K

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja7K00
2E2HK 3S2HC 4YFKA 3S16K 4QJVA 2NVXC 3RZDK 2E2IC 2Y0SD 4A3BC 3H0GK 3H3VD 2A69A 2JA5C 2VUMC 3RZOC 4X6AK 4A3LC 4A3JC 4A3MK 5IYDK 5IYCC 2WB1L 5IP9C 5FLMC 5TMFA 5C44C 3GTKC 2PMZL 4C3HK 1WCMK 3GTGK 3S2DC 4A3CK 2E2JK 4KN4A 1TWGC 4Y7NC 3S1RC 3HOVC 1I50K 1TWFK 1ZYRA 3HKZD 4Y52K 3GTLK 3S14K 3S1QK 1I6HK 4LJZA 1I3QK 3S15C 1Y1WC 3HOWC 3S2HK 3S1NC 5IP7K 3GTPC 3K7AK 4A3EC 2NVTK 3GTQC 3S17K 4G7OA 4G7ZA 4A3BK 4A3DK 1I6VA 2JA5K 4MEXA 3GTOC 3GTMC 3S1MK 4BBSK 4A3LK 1YNJA 1TWHK 3I4MK 3HOZK 2YU9C 4BXXK 5TMCA 2R7ZK 2WAQD 1R9TC 2PA8D 1Y1VC 5C3EC 2A68A 4A3KC 4A93C 4C3JK 4BY7C 4OIQA 3CQZK 4BY1K 2B63C 2PPBA 4GZYA 2NVYC 4BBRC 2R92K 3FKIC 2O5JA 3HOXC 2A6HA 5M5YK 1Y1WK 3HOWK 3S1NK 2JA8K 4LLGA 4AYBL 3HOYK 4A3FK 1SFOC 2NVQC 4LK0A 4NOIA 5IYBC 3GTOK 1HQMA 5IP9K 5D4DA 5C4JK 3HOUK 3M3YC 4XLNA 2Y0SL 2JA6C 2NVXK 3H3VL 5C4XC 2E2IK 5M5XK 4A3GC 2CW0A 1K83C 3RZOK 2VUMK 2R93C 4BY7K 4A3JK 5IYCK 5FLMK 4QJVB 5C44K 3GTKK 3S16C 3RZDC 3S2DK 4A3IC 4YFXA 3HOXK 3I4NC 4KN7A 4KMUA 1TWGK 3HKZL 4XSXA 4C3IK 4Y7NK 4A3MC 3S1RK 3HOVK 4X6AC 4OIPA 4C2MK 1WCMC 2WB1D 3GTGC 1XPPA 2PMZD 1BDFA 4ZH4A 4QIWD 3PO3C 3S15K 4A3CC 1TWCC 2BE5A 3GTJC 3GTPK 4A3EK 4Q5SA 1I50C 1TWFC 4Q4ZA 3GTQK 4Y52C 3GTLC 3GTMK 1I6HC 4OIOA 4XLPA 2JA7C 2WAQL 4A3DC 2YU9K 3M4OC 2PA8L 4LK1A 1SMYA 5IP7C 1IW7A 3K7AC 1R9TK 4A3IK 2NVTC 4G7HA 1Y1VK 5C3EK 4A3KK 3PO2C 3WODA 3I4NK 3S17C 1TWAC 2A6EA 4A93K 3S1MC 4BBSC 4JK1A 4OINA 1TWHC 2E2HC 2B63K 3HOZC 3I4MC 4BXXC 2NVYK 4BBRK 5M3MK 2R7ZC 3FKIK 4QIWL 3H0GC 5M3FK 4XSZA 4YFNA 3PO3K 5IYDC 1TWCK 3GTJK 3CQZC 1SFOK 4BY1C 2NVQK 5FJ8K 4MQ9A 5IYBK 2R92C 3M3YK 2E2JC 2JA7K 5M5WK 4MEYA 2JA6K 3M4OK 4YG2A 1YNNA 3DXJA 5C4XK 3EQLA 2JA8C 3HOYC 4A3GK 4A3FC 1K83K 2R93K 2O5IA 3PO2K 3S14C 4OIRA 4AYBD 1TWAK 3S1QC 1I3QC 5C4JC 3HOUC
chains in the Genus database with same CATH superfamily
2E2HK 5IOTA 1WSRA 3H0GK 3H3VD 2A69A 2VUMC 3LAJA 5FLMC 5TMFA 5IOSA 5C44C 2PMZL 2E2IA 3Q3QA 1O29A 4A3CK 2E2JK 4KN4A 1XXBA 3S1RC 3GTKA 1J6XA 4KASA 5EGHA 3N3YA 4Y52K 3GTLK 3S14K 1J6VA 1TWGA 3FOFA 3S1NC 5IP7K 3GTQC 4A3DK 1O26A 4BKWA 5IORA 3S1MK 4BBSK 1YNJA 3I4MK 5TMCA 3GTPA 1VH2A 1F7UA 1L0WA 1RU0A 3GTMA 3SZZA 1VRQC 4BY1K 1UV7A 2O5JA 2A6HA 2D6FC 2V6SA 5M5YK 1Y1WK 1J98A 2JA8K 4A3FK 4LK0A 3FKIA 2ZUEA 3GTOK 5IP9K 3HOUK 1JOEA 2Y0SL 2V6TA 5C4XC 1SFOA 4A3GC 1K83C 2VUMK 1DCOA 4GTLA 5FLMK 4QJVB 5C44K 3S16C 3RZDC 2R93A 4A3MC 3S1RK 1AB4A 1B4BA 1BDFA 2RGRA 2BE5A 3GTJC 4Q4ZA 3GTQK 1IQ0A 2Y3PA 3LAPA 3GTGA 1I6HC 4OIOA 1TWCA 2PA8L 4LK1A 1TWFA 3K7AC 4A3IK 3G4AA 1TWAC 2A6EA 4G0VA 2JA7A 2JA6A 2E2HC 5M3MK 3TFJA 3H0GC 1WSVA 3CQZC 5FJ8K 3AD9C 2R92C 2P5MA 2E2JC 4GTBA 5M5WK 1XZPA 4WILA 5C4XK 3DXJA 3EQLA 3HOYC 4A3GK 1K83K 4GT9A 3S14C 5C4JC 3S16K 3RZDK 4FM9A 4A3JC 4A3MK 1O25A 4LQYA 2NVXA 1BJTA 1WIHA 2JA5A 3VA7A 3CAGA 3GEIA 3HKZD 3T01A 1I6HK 1XZQA 4LJZA 3L4JA 1Y1WC 3S2HK 3K7AK 5CHPA 1C0AA 3LPXA 1XXAA 4G7ZA 3GTOC 1G51A 4WJ3M 3T02A 1F9NA 4KATA 2YU9C 1O2FB 4A93C 1HI9A 3AQOA 2KWAA 4OIQA 3CQZK 2B63C 1DCPA 2PPBA 4GZYA 2NVYC 2R92K 1R9TA 1Y1VA 1VLOA 3GIRA 4LLGA 3HOYK 2P8TA 5IYBC 2CFAA 1HQMA 5D4DA 5C4JK 3M3YC 2JA6C 4O2DA 5JVOA 4GTEA 4BY7K 4A3JK 1INNA 3OREA 5EGEA 4KB2A 4A3IC 1WOSA 4ILDA 3AD7C 4XSXA 3A8KA 3OEPA 1WCMC 2PMZD 1JQWA 1I50C 1EI6A 2ZUFA 5HL8A 2WAQL 1YCLA 2YU9K 1IS1A 4G0UA 3S17C 4G7HA 4A93K 3GTLA 1TWHC 2B63K 3HOZC 4BXXC 2NVYK 2R7ZC 3AH5A 1USOA 5M3FK 4C3JC 3PO3K 1TWCK 5IYBK 3M3YK 3FHZA 2JA7K 1WQFA 2JA6K 3M4OK 4YG2A 5L46A 3PO2K 3S2HC 3GDZA 4YFKA 2E2IC 2Y0SD 2JH3A 3RZOC 4FZBA 1I3QA 3V4GA 2WB1L 2RH6A 1WORA 1O2BA 3GTKC 1WCMK 2GAGC 2VUMA 4J3NA 1TWGC 4P5AA 4Y7NC 1I50K 1ZYRA 4KARA 4C2MC 4KAWX 3S1QK 4GFQA 3S15C 1DCHA 3GTPC 1EK8A 3S17K 4G7OA 4A3BK 1I6VA 2JA5K 4M1XA 4DDQA 3GTMC 4A3LK 3SZYA 1TWHK 3HOZK 4BXXK 2R7ZK 3GTQA 3IPJA 2PA8D 2A68A 1XXCA 4A3KC 4C3JK 5IOQA 3ERED 4BY7C 4P9SA 4BBRC 3FKIC 3FOEA 3N0BA 1B4AA 3HOWK 4AYBL 1SFOC 3A8IA 4GTAA 4G0WA 4GTFA 4XLNA 1ZBSA 3H3VL 2E2IK 4XCHA 3RZOK 2R93C 5E68A 1WQHA 3GTKK 3JSTA 1VGXA 1O27A 1JVIA 1K83A 4YFXA 3HOXK 2XCQA 4KN7A 5JFEA 4KMUA 1TWGK 4X6AC 4WJ4A 4Y7NK 1ZQ1C 4RMFA 2XCOA 4C2MK 4C3HC 3GTGC 1XPPA 4ZH4A 4QIWD 3PO3C 3S15K 1GE9A 1TWCC 4Q5SA 3GTPK 1ZVUA 1TWFC 3GEEA 1I3QC 3T00A 3GTMK 1PJ7A 2JA7C 3GTJA 1ZXOA 3M4OC 2EBBA 3TFHA 1J6WA 2NVTC 4A3KK 3PO2C 3I4NK 1IE0A 2GAHC 4JK1A 4OINA 3AD8C 4BLBA 2ZFZA 4BBRK 1F7VA 3FKIK 2GSUA 4C45A 4LOWA 1TWAA 4XSZA 4LR2A 2E2HA 1VJEA 1V5VA 1SFOK 3H0GA 2FQTA 2GSOA 3CQZA 2R92A 2R93K 3S1QC 2CFAB 1IL2A 3QX3A 4P5BA 4QJVA 4KMAA 2NVXC 1O2AA 4KM8A 5CJ9A 4A3BC 2JA5C 4X6AK 4A3LC 5IYDK 5IYCC 4C3HK 3GTGK 3S2DC 2PHCB 4PAAA 3MMLB 4C3IC 1X31C 3N0CA 3HOVC 1TWFK 4KDDA 3L4KA 1WOPA 1I3QK 1F93A 3HOWC 2FQOA 4A3EC 1EQRA 4KM9A 2NVTK 4MEXA 1Y1WA 1BGWA 4GTDA 2WAQD 1R9TC 3GTOA 1Y1VC 5C3EC 2XCRB 2YU9A 4PABA 3NUHA 3HOXC 1WQGA 1PJ6A 3S1NK 2B63A 1PJ5A 3BUEA 2NVYA 2NVQC 4NOIA 3GEHA 2V6UA 2NVXK 5M5XK 2CW0A 1ISEA 4KC6A 2GSNA 3HXAA 4KMHA 5IYCK 3OPFA 3S2DK 4BLAA 3BP3A 3I4NC 4C3IK 3HKZL 3HOVK 4OIPA 1O28A 1O24A 1EFWA 2WB1D 1IBAA 4A3CC 3BP8C 1USMA 1YX2A 4A3EK 1WOOA 4Y52C 1WCMA 4GTCA 3GTLC 4KB4A 5TJ3A 3ADAC 3A8JA 4XLPA 1XZPB 1SMYA 5IP7C 1I50A 1IW7A 1R9TK 1Y1VK 5C3EK 4A3DC 3WODA 3AQPA 1BS2A 3S1MC 4BBSC 3GSIA 3I4MC 3TFIA 1EH1A 4QIWL 3TTGA 1DD5A 4YFNA 4KMDA 1TWHA 4AH6A 5IYDC 3GTJK 4BY1C 2NVQK 2R7ZA 4MQ9A 2W7VA 4MEYA 3S0XA 1YNNA 2JA8C 4A3FC 2O5IA 1XZQB 4AYBD 1TWAK 3G4CA 5IP9C 1KQ4A 4OIRA 3HOUC
chains in the Genus database with same CATH topology
2E2HK 3S2HC 4YFKA 3S16K 4QJVA 2NVXC 3RZDK 2E2IC 2Y0SD 4A3BC 3H0GK 3H3VD 2A69A 2JA5C 2VUMC 3RZOC 4X6AK 4A3LC 4A3JC 4A3MK 5IYDK 5IYCC 2WB1L 5IP9C 5FLMC 5TMFA 5C44C 3GTKC 2PMZL 4C3HK 1WCMK 3GTGK 3S2DC 4A3CK 2E2JK 4KN4A 1TWGC 4Y7NC 3S1RC 3HOVC 1I50K 1TWFK 1ZYRA 3HKZD 4Y52K 3GTLK 3S14K 3S1QK 1I6HK 4LJZA 1I3QK 3S15C 1Y1WC 3HOWC 3S2HK 3S1NC 5IP7K 3GTPC 3K7AK 4A3EC 2NVTK 3GTQC 3S17K 4G7OA 4G7ZA 4A3BK 4A3DK 1I6VA 2JA5K 4MEXA 3GTOC 3GTMC 3S1MK 4BBSK 4A3LK 1YNJA 1TWHK 3I4MK 3HOZK 2YU9C 4BXXK 5TMCA 2R7ZK 2WAQD 1R9TC 2PA8D 1Y1VC 5C3EC 2A68A 4A3KC 4A93C 4C3JK 4BY7C 4OIQA 3CQZK 4BY1K 2B63C 2PPBA 4GZYA 2NVYC 4BBRC 2R92K 3FKIC 2O5JA 3HOXC 2A6HA 5M5YK 1Y1WK 3HOWK 3S1NK 2JA8K 4LLGA 4AYBL 3HOYK 4A3FK 1SFOC 2NVQC 4LK0A 4NOIA 5IYBC 3GTOK 1HQMA 5IP9K 5D4DA 5C4JK 3HOUK 3M3YC 4XLNA 2Y0SL 2JA6C 2NVXK 3H3VL 5C4XC 2E2IK 5M5XK 4A3GC 2CW0A 1K83C 3RZOK 2VUMK 2R93C 4BY7K 4A3JK 5IYCK 5FLMK 4QJVB 5C44K 3GTKK 3S16C 3RZDC 3S2DK 4A3IC 4YFXA 3HOXK 3I4NC 4KN7A 4KMUA 1TWGK 3HKZL 4XSXA 4C3IK 4Y7NK 4A3MC 3S1RK 3HOVK 4X6AC 4OIPA 4C2MK 1WCMC 2WB1D 3GTGC 1XPPA 2PMZD 1BDFA 4ZH4A 4QIWD 3PO3C 3S15K 4A3CC 1TWCC 2BE5A 3GTJC 3GTPK 4A3EK 4Q5SA 1I50C 1TWFC 4Q4ZA 3GTQK 4Y52C 3GTLC 3GTMK 1I6HC 4OIOA 4XLPA 2JA7C 2WAQL 4A3DC 2YU9K 3M4OC 2PA8L 4LK1A 1SMYA 5IP7C 1IW7A 3K7AC 1R9TK 4A3IK 2NVTC 4G7HA 1Y1VK 5C3EK 4A3KK 3PO2C 3WODA 3I4NK 3S17C 1TWAC 2A6EA 4A93K 3S1MC 4BBSC 4JK1A 4OINA 1TWHC 2E2HC 2B63K 3HOZC 3I4MC 4BXXC 2NVYK 4BBRK 5M3MK 2R7ZC 3FKIK 4QIWL 3H0GC 5M3FK 4XSZA 4YFNA 3PO3K 5IYDC 1TWCK 3GTJK 3CQZC 1SFOK 4BY1C 2NVQK 5FJ8K 4MQ9A 5IYBK 2R92C 3M3YK 2E2JC 2JA7K 5M5WK 4MEYA 2JA6K 3M4OK 4YG2A 1YNNA 3DXJA 5C4XK 3EQLA 2JA8C 3HOYC 4A3GK 4A3FC 1K83K 2R93K 2O5IA 3PO2K 3S14C 4OIRA 4AYBD 1TWAK 3S1QC 1I3QC 5C4JC 3HOUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H K;  3S2H C;  4YFK A;  3S16 K;  4QJV A;  2NVX C;  3RZD K;  2E2I C;  2Y0S D;  4A3B C;  3H0G K;  3H3V D;  2A69 A;  2JA5 C;  2VUM C;  3RZO C;  4X6A K;  4A3L C;  4A3J C;  4A3M K;  5IYD K;  5IYC C;  2WB1 L;  5IP9 C;  5FLM C;  5TMF A;  5C44 C;  3GTK C;  2PMZ L;  4C3H K;  1WCM K;  3GTG K;  3S2D C;  4A3C K;  2E2J K;  4KN4 A;  1TWG C;  4Y7N C;  3S1R C;  3HOV C;  1I50 K;  1TWF K;  1ZYR A;  3HKZ D;  4Y52 K;  3GTL K;  3S14 K;  3S1Q K;  1I6H K;  4LJZ A;  1I3Q K;  3S15 C;  1Y1W C;  3HOW C;  3S2H K;  3S1N C;  5IP7 K;  3GTP C;  3K7A K;  4A3E C;  2NVT K;  3GTQ C;  3S17 K;  4G7O A;  4G7Z A;  4A3B K;  4A3D K;  1I6V A;  2JA5 K;  4MEX A;  3GTO C;  3GTM C;  3S1M K;  4BBS K;  4A3L K;  1YNJ A;  1TWH K;  3I4M K;  3HOZ K;  2YU9 C;  4BXX K;  5TMC A;  2R7Z K;  2WAQ D;  1R9T C;  2PA8 D;  1Y1V C;  5C3E C;  2A68 A;  4A3K C;  4A93 C;  4C3J K;  4BY7 C;  4OIQ A;  3CQZ K;  4BY1 K;  2B63 C;  2PPB A;  4GZY A;  2NVY C;  4BBR C;  2R92 K;  3FKI C;  2O5J A;  3HOX C;  2A6H A;  5M5Y K;  1Y1W K;  3HOW K;  3S1N K;  2JA8 K;  4LLG A;  4AYB L;  3HOY K;  4A3F K;  1SFO C;  2NVQ C;  4LK0 A;  4NOI A;  5IYB C;  3GTO K;  1HQM A;  5IP9 K;  5D4D A;  5C4J K;  3HOU K;  3M3Y C;  4XLN A;  2Y0S L;  2JA6 C;  2NVX K;  3H3V L;  5C4X C;  2E2I K;  5M5X K;  4A3G C;  2CW0 A;  1K83 C;  3RZO K;  2VUM K;  2R93 C;  4BY7 K;  4A3J K;  5IYC K;  5FLM K;  4QJV B;  5C44 K;  3GTK K;  3S16 C;  3RZD C;  3S2D K;  4A3I C;  4YFX A;  3HOX K;  3I4N C;  4KN7 A;  4KMU A;  1TWG K;  3HKZ L;  4XSX A;  4C3I K;  4Y7N K;  4A3M C;  3S1R K;  3HOV K;  4X6A C;  4OIP A;  4C2M K;  1WCM C;  2WB1 D;  3GTG C;  1XPP A;  2PMZ D;  1BDF A;  4ZH4 A;  4QIW D;  3PO3 C;  3S15 K;  4A3C C;  1TWC C;  2BE5 A;  3GTJ C;  3GTP K;  4A3E K;  4Q5S A;  1I50 C;  1TWF C;  4Q4Z A;  3GTQ K;  4Y52 C;  3GTL C;  3GTM K;  1I6H C;  4OIO A;  4XLP A;  2JA7 C;  2WAQ L;  4A3D C;  2YU9 K;  3M4O C;  2PA8 L;  4LK1 A;  1SMY A;  5IP7 C;  1IW7 A;  3K7A C;  1R9T K;  4A3I K;  2NVT C;  4G7H A;  1Y1V K;  5C3E K;  4A3K K;  3PO2 C;  3WOD A;  3I4N K;  3S17 C;  1TWA C;  2A6E A;  4A93 K;  3S1M C;  4BBS C;  4JK1 A;  4OIN A;  1TWH C;  2E2H C;  2B63 K;  3HOZ C;  3I4M C;  4BXX C;  2NVY K;  4BBR K;  5M3M K;  2R7Z C;  3FKI K;  4QIW L;  3H0G C;  5M3F K;  4XSZ A;  4YFN A;  3PO3 K;  5IYD C;  1TWC K;  3GTJ K;  3CQZ C;  1SFO K;  4BY1 C;  2NVQ K;  5FJ8 K;  4MQ9 A;  5IYB K;  2R92 C;  3M3Y K;  2E2J C;  2JA7 K;  5M5W K;  4MEY A;  2JA6 K;  3M4O K;  4YG2 A;  1YNN A;  3DXJ A;  5C4X K;  3EQL A;  2JA8 C;  3HOY C;  4A3G K;  4A3F C;  1K83 K;  2R93 K;  2O5I A;  3PO2 K;  3S14 C;  4OIR A;  4AYB D;  1TWA K;  3S1Q C;  1I3Q C;  5C4J C;  3HOU C; 
#chains in the Genus database with same CATH topology
 2E2H K;  5IOT A;  1WSR A;  3H0G K;  3H3V D;  2A69 A;  2VUM C;  3LAJ A;  5FLM C;  5TMF A;  5IOS A;  5C44 C;  2PMZ L;  2E2I A;  3Q3Q A;  1O29 A;  4A3C K;  2E2J K;  4KN4 A;  1XXB A;  3S1R C;  3GTK A;  1J6X A;  4KAS A;  5EGH A;  3N3Y A;  4Y52 K;  3GTL K;  3S14 K;  1J6V A;  1TWG A;  3FOF A;  3S1N C;  5IP7 K;  3GTQ C;  4A3D K;  1O26 A;  4BKW A;  5IOR A;  3S1M K;  4BBS K;  1YNJ A;  3I4M K;  5TMC A;  3GTP A;  1VH2 A;  1F7U A;  1L0W A;  1RU0 A;  3GTM A;  3SZZ A;  1VRQ C;  4BY1 K;  1UV7 A;  2O5J A;  2A6H A;  2D6F C;  2V6S A;  5M5Y K;  1Y1W K;  1J98 A;  2JA8 K;  4A3F K;  4LK0 A;  3FKI A;  2ZUE A;  3GTO K;  5IP9 K;  3HOU K;  1JOE A;  2Y0S L;  2V6T A;  5C4X C;  1SFO A;  4A3G C;  1K83 C;  2VUM K;  1DCO A;  4GTL A;  5FLM K;  4QJV B;  5C44 K;  3S16 C;  3RZD C;  2R93 A;  4A3M C;  3S1R K;  1AB4 A;  1B4B A;  1BDF A;  2RGR A;  2BE5 A;  3GTJ C;  4Q4Z A;  3GTQ K;  1IQ0 A;  2Y3P A;  3LAP A;  3GTG A;  1I6H C;  4OIO A;  1TWC A;  2PA8 L;  4LK1 A;  1TWF A;  3K7A C;  4A3I K;  3G4A A;  1TWA C;  2A6E A;  4G0V A;  2JA7 A;  2JA6 A;  2E2H C;  5M3M K;  3TFJ A;  3H0G C;  1WSV A;  3CQZ C;  5FJ8 K;  3AD9 C;  2R92 C;  2P5M A;  2E2J C;  4GTB A;  5M5W K;  1XZP A;  4WIL A;  5C4X K;  3DXJ A;  3EQL A;  3HOY C;  4A3G K;  1K83 K;  4GT9 A;  3S14 C;  5C4J C;  3S16 K;  3RZD K;  4FM9 A;  4A3J C;  4A3M K;  1O25 A;  4LQY A;  2NVX A;  1BJT A;  1WIH A;  2JA5 A;  3VA7 A;  3CAG A;  3GEI A;  3HKZ D;  3T01 A;  1I6H K;  1XZQ A;  4LJZ A;  3L4J A;  1Y1W C;  3S2H K;  3K7A K;  5CHP A;  1C0A A;  3LPX A;  1XXA A;  4G7Z A;  3GTO C;  1G51 A;  4WJ3 M;  3T02 A;  1F9N A;  4KAT A;  2YU9 C;  1O2F B;  4A93 C;  1HI9 A;  3AQO A;  2KWA A;  4OIQ A;  3CQZ K;  2B63 C;  1DCP A;  2PPB A;  4GZY A;  2NVY C;  2R92 K;  1R9T A;  1Y1V A;  1VLO A;  3GIR A;  4LLG A;  3HOY K;  2P8T A;  5IYB C;  2CFA A;  1HQM A;  5D4D A;  5C4J K;  3M3Y C;  2JA6 C;  4O2D A;  5JVO A;  4GTE A;  4BY7 K;  4A3J K;  1INN A;  3ORE A;  5EGE A;  4KB2 A;  4A3I C;  1WOS A;  4ILD A;  3AD7 C;  4XSX A;  3A8K A;  3OEP A;  1WCM C;  2PMZ D;  1JQW A;  1I50 C;  1EI6 A;  2ZUF A;  5HL8 A;  2WAQ L;  1YCL A;  2YU9 K;  1IS1 A;  4G0U A;  3S17 C;  4G7H A;  4A93 K;  3GTL A;  1TWH C;  2B63 K;  3HOZ C;  4BXX C;  2NVY K;  2R7Z C;  3AH5 A;  1USO A;  5M3F K;  4C3J C;  3PO3 K;  1TWC K;  5IYB K;  3M3Y K;  3FHZ A;  2JA7 K;  1WQF A;  2JA6 K;  3M4O K;  4YG2 A;  5L46 A;  3PO2 K;  3S2H C;  3GDZ A;  4YFK A;  2E2I C;  2Y0S D;  2JH3 A;  3RZO C;  4FZB A;  1I3Q A;  3V4G A;  2WB1 L;  2RH6 A;  1WOR A;  1O2B A;  3GTK C;  1WCM K;  2GAG C;  2VUM A;  4J3N A;  1TWG C;  4P5A A;  4Y7N C;  1I50 K;  1ZYR A;  4KAR A;  4C2M C;  4KAW X;  3S1Q K;  4GFQ A;  3S15 C;  1DCH A;  3GTP C;  1EK8 A;  3S17 K;  4G7O A;  4A3B K;  1I6V A;  2JA5 K;  4M1X A;  4DDQ A;  3GTM C;  4A3L K;  3SZY A;  1TWH K;  3HOZ K;  4BXX K;  2R7Z K;  3GTQ A;  3IPJ A;  2PA8 D;  2A68 A;  1XXC A;  4A3K C;  4C3J K;  5IOQ A;  3ERE D;  4BY7 C;  4P9S A;  4BBR C;  3FKI C;  3FOE A;  3N0B A;  1B4A A;  3HOW K;  4AYB L;  1SFO C;  3A8I A;  4GTA A;  4G0W A;  4GTF A;  4XLN A;  1ZBS A;  3H3V L;  2E2I K;  4XCH A;  3RZO K;  2R93 C;  5E68 A;  1WQH A;  3GTK K;  3JST A;  1VGX A;  1O27 A;  1JVI A;  1K83 A;  4YFX A;  3HOX K;  2XCQ A;  4KN7 A;  5JFE A;  4KMU A;  1TWG K;  4X6A C;  4WJ4 A;  4Y7N K;  1ZQ1 C;  4RMF A;  2XCO A;  4C2M K;  4C3H C;  3GTG C;  1XPP A;  4ZH4 A;  4QIW D;  3PO3 C;  3S15 K;  1GE9 A;  1TWC C;  4Q5S A;  3GTP K;  1ZVU A;  1TWF C;  3GEE A;  1I3Q C;  3T00 A;  3GTM K;  1PJ7 A;  2JA7 C;  3GTJ A;  1ZXO A;  3M4O C;  2EBB A;  3TFH A;  1J6W A;  2NVT C;  4A3K K;  3PO2 C;  3I4N K;  1IE0 A;  2GAH C;  4JK1 A;  4OIN A;  3AD8 C;  4BLB A;  2ZFZ A;  4BBR K;  1F7V A;  3FKI K;  2GSU A;  4C45 A;  4LOW A;  1TWA A;  4XSZ A;  4LR2 A;  2E2H A;  1VJE A;  1V5V A;  1SFO K;  3H0G A;  2FQT A;  2GSO A;  3CQZ A;  2R92 A;  2R93 K;  3S1Q C;  2CFA B;  1IL2 A;  3QX3 A;  4P5B A;  4QJV A;  4KMA A;  2NVX C;  1O2A A;  4KM8 A;  5CJ9 A;  4A3B C;  2JA5 C;  4X6A K;  4A3L C;  5IYD K;  5IYC C;  4C3H K;  3GTG K;  3S2D C;  2PHC B;  4PAA A;  3MML B;  4C3I C;  1X31 C;  3N0C A;  3HOV C;  1TWF K;  4KDD A;  3L4K A;  1WOP A;  1I3Q K;  1F93 A;  3HOW C;  2FQO A;  4A3E C;  1EQR A;  4KM9 A;  2NVT K;  4MEX A;  1Y1W A;  1BGW A;  4GTD A;  2WAQ D;  1R9T C;  3GTO A;  1Y1V C;  5C3E C;  2XCR B;  2YU9 A;  4PAB A;  3NUH A;  3HOX C;  1WQG A;  1PJ6 A;  3S1N K;  2B63 A;  1PJ5 A;  3BUE A;  2NVY A;  2NVQ C;  4NOI A;  3GEH A;  2V6U A;  2NVX K;  5M5X K;  2CW0 A;  1ISE A;  4KC6 A;  2GSN A;  3HXA A;  4KMH A;  5IYC K;  3OPF A;  3S2D K;  4BLA A;  3BP3 A;  3I4N C;  4C3I K;  3HKZ L;  3HOV K;  4OIP A;  1O28 A;  1O24 A;  1EFW A;  2WB1 D;  1IBA A;  4A3C C;  3BP8 C;  1USM A;  1YX2 A;  4A3E K;  1WOO A;  4Y52 C;  1WCM A;  4GTC A;  3GTL C;  4KB4 A;  5TJ3 A;  3ADA C;  3A8J A;  4XLP A;  1XZP B;  1SMY A;  5IP7 C;  1I50 A;  1IW7 A;  1R9T K;  1Y1V K;  5C3E K;  4A3D C;  3WOD A;  3AQP A;  1BS2 A;  3S1M C;  4BBS C;  3GSI A;  3I4M C;  3TFI A;  1EH1 A;  4QIW L;  3TTG A;  1DD5 A;  4YFN A;  4KMD A;  1TWH A;  4AH6 A;  5IYD C;  3GTJ K;  4BY1 C;  2NVQ K;  2R7Z A;  4MQ9 A;  2W7V A;  4MEY A;  3S0X A;  1YNN A;  2JA8 C;  4A3F C;  2O5I A;  1XZQ B;  4AYB D;  1TWA K;  3G4C A;  5IP9 C;  1KQ4 A;  4OIR A;  3HOU C; 
#chains in the Genus database with same CATH homology
 2E2H K;  3S2H C;  4YFK A;  3S16 K;  4QJV A;  2NVX C;  3RZD K;  2E2I C;  2Y0S D;  4A3B C;  3H0G K;  3H3V D;  2A69 A;  2JA5 C;  2VUM C;  3RZO C;  4X6A K;  4A3L C;  4A3J C;  4A3M K;  5IYD K;  5IYC C;  2WB1 L;  5IP9 C;  5FLM C;  5TMF A;  5C44 C;  3GTK C;  2PMZ L;  4C3H K;  1WCM K;  3GTG K;  3S2D C;  4A3C K;  2E2J K;  4KN4 A;  1TWG C;  4Y7N C;  3S1R C;  3HOV C;  1I50 K;  1TWF K;  1ZYR A;  3HKZ D;  4Y52 K;  3GTL K;  3S14 K;  3S1Q K;  1I6H K;  4LJZ A;  1I3Q K;  3S15 C;  1Y1W C;  3HOW C;  3S2H K;  3S1N C;  5IP7 K;  3GTP C;  3K7A K;  4A3E C;  2NVT K;  3GTQ C;  3S17 K;  4G7O A;  4G7Z A;  4A3B K;  4A3D K;  1I6V A;  2JA5 K;  4MEX A;  3GTO C;  3GTM C;  3S1M K;  4BBS K;  4A3L K;  1YNJ A;  1TWH K;  3I4M K;  3HOZ K;  2YU9 C;  4BXX K;  5TMC A;  2R7Z K;  2WAQ D;  1R9T C;  2PA8 D;  1Y1V C;  5C3E C;  2A68 A;  4A3K C;  4A93 C;  4C3J K;  4BY7 C;  4OIQ A;  3CQZ K;  4BY1 K;  2B63 C;  2PPB A;  4GZY A;  2NVY C;  4BBR C;  2R92 K;  3FKI C;  2O5J A;  3HOX C;  2A6H A;  5M5Y K;  1Y1W K;  3HOW K;  3S1N K;  2JA8 K;  4LLG A;  4AYB L;  3HOY K;  4A3F K;  1SFO C;  2NVQ C;  4LK0 A;  4NOI A;  5IYB C;  3GTO K;  1HQM A;  5IP9 K;  5D4D A;  5C4J K;  3HOU K;  3M3Y C;  4XLN A;  2Y0S L;  2JA6 C;  2NVX K;  3H3V L;  5C4X C;  2E2I K;  5M5X K;  4A3G C;  2CW0 A;  1K83 C;  3RZO K;  2VUM K;  2R93 C;  4BY7 K;  4A3J K;  5IYC K;  5FLM K;  4QJV B;  5C44 K;  3GTK K;  3S16 C;  3RZD C;  3S2D K;  4A3I C;  4YFX A;  3HOX K;  3I4N C;  4KN7 A;  4KMU A;  1TWG K;  3HKZ L;  4XSX A;  4C3I K;  4Y7N K;  4A3M C;  3S1R K;  3HOV K;  4X6A C;  4OIP A;  4C2M K;  1WCM C;  2WB1 D;  3GTG C;  1XPP A;  2PMZ D;  1BDF A;  4ZH4 A;  4QIW D;  3PO3 C;  3S15 K;  4A3C C;  1TWC C;  2BE5 A;  3GTJ C;  3GTP K;  4A3E K;  4Q5S A;  1I50 C;  1TWF C;  4Q4Z A;  3GTQ K;  4Y52 C;  3GTL C;  3GTM K;  1I6H C;  4OIO A;  4XLP A;  2JA7 C;  2WAQ L;  4A3D C;  2YU9 K;  3M4O C;  2PA8 L;  4LK1 A;  1SMY A;  5IP7 C;  1IW7 A;  3K7A C;  1R9T K;  4A3I K;  2NVT C;  4G7H A;  1Y1V K;  5C3E K;  4A3K K;  3PO2 C;  3WOD A;  3I4N K;  3S17 C;  1TWA C;  2A6E A;  4A93 K;  3S1M C;  4BBS C;  4JK1 A;  4OIN A;  1TWH C;  2E2H C;  2B63 K;  3HOZ C;  3I4M C;  4BXX C;  2NVY K;  4BBR K;  5M3M K;  2R7Z C;  3FKI K;  4QIW L;  3H0G C;  5M3F K;  4XSZ A;  4YFN A;  3PO3 K;  5IYD C;  1TWC K;  3GTJ K;  3CQZ C;  1SFO K;  4BY1 C;  2NVQ K;  5FJ8 K;  4MQ9 A;  5IYB K;  2R92 C;  3M3Y K;  2E2J C;  2JA7 K;  5M5W K;  4MEY A;  2JA6 K;  3M4O K;  4YG2 A;  1YNN A;  3DXJ A;  5C4X K;  3EQL A;  2JA8 C;  3HOY C;  4A3G K;  4A3F C;  1K83 K;  2R93 K;  2O5I A;  3PO2 K;  3S14 C;  4OIR A;  4AYB D;  1TWA K;  3S1Q C;  1I3Q C;  5C4J C;  3HOU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...