1TWFK

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twfK00
1I6HC 2R93C 4Y52C 2WAQL 3HOXC 4A3BK 2PA8L 5IYDC 5FJ8K 4A3EK 4YFNA 2E2IC 2E2HK 5M5XK 4A3GC 2B63C 3GTQK 5TMFA 4BY7K 4BBRK 5TMCA 2NVYK 2Y0SD 3K7AK 1R9TC 4QIWL 3HOWC 4A3LK 5FLMK 1I50C 4LK1A 5IP9K 4A3IC 1XPPA 4Q4ZA 3M4OK 4G7OA 5C3EC 1SFOC 3S17K 3S16K 5C4XC 3S1RC 3GTKK 3M3YC 3GTJK 1Y1VK 1Y1WC 3HOVC 3GTMK 5IP7K 4A3CK 5IYBK 2R7ZK 2R92K 4X6AK 4Y7NK 2CW0A 3S2HC 3S2DK 4A3MC 5C4JK 4A3KC 1K83C 1TWGC 5M5WK 1I6VA 1YNJA 1TWHK 3FKIK 2YU9K 4KMUA 2JA7K 3PO3K 4LJZA 3HOZC 2PPBA 4G7HA 3S1NK 2WAQD 1TWAK 3S14K 1ZYRA 2PA8D 4QJVB 1BDFA 2NVQK 3GTPK 1TWCC 3HOUC 3HOYC 1TWFK 1HQMA 1WCMC 4A3FK 3S15C 2O5IA 4MQ9A 4C3IK 4JK1A 5IYCK 2E2JK 4LLGA 3GTGC 4OINA 2A68A 3GTOC 1I3QC 4A3JC 3S1MC 1IW7A 2R93K 2WB1L 2PMZD 3HOXK 5M3FK 2JA5C 5IYDK 4YFKA 4XLPA 5M5YK 4A3EC 4ZH4A 5C44K 2E2HC 4BY1C 4OIQA 3GTLK 4BY7C 4A3GK 3H0GK 4A3DK 1R9TK 4YG2A 3CQZK 1I50K 4KN4A 4A3IK 4OIOA 3RZDK 3RZOK 2NVTK 3M4OC 3S2HK 2JA6C 5C3EK 1SFOK 3S17C 4BXXK 2A69A 3M3YK 3HKZD 4BBSC 3DXJA 2NVXC 1Y1VC 2VUMC 4A93K 3HOVK 3PO2C 3I4NK 4G7ZA 4A3CC 4MEXA 4AYBL 2JA8C 2R92C 3S1QK 1I6HK 4KN7A 1K83K 4C3JK 3I4MK 2YU9C 1TWHC 2JA7C 3PO3C 4Y52K 4A3BC 3H3VL 2WB1D 3HOZK 2E2IK 2PMZL 2B63K 3GTQC 3GTPC 3HOUK 4BBRC 2NVYC 4GZYA 3K7AC 3HOWK 4MEYA 4A3LC 5FLMC 4XLNA 3S15K 5IP9C 4Q5SA 5M3MK 2A6EA 3I4MC 5C4XK 3S16C 5D4DA 3S1RK 3GTKC 3S1MK 3GTJC 4OIRA 4LK0A 4C3HK 3HKZL 1Y1WK 4YFXA 2JA5K 3WODA 5IP7C 4NOIA 3GTMC 2O5JA 4BY1K 5C44C 5IYBC 4A3JK 2Y0SL 2R7ZC 1SMYA 4Y7NC 3H0GC 3GTLC 3S2DC 4X6AC 4QIWD 4QJVA 4XSZA 4AYBD 1TWGK 5C4JC 2A6HA 4A3KK 3FKIC 4A3MK 4A3DC 4OIPA 4C2MK 3CQZC 3S1NC 3RZOC 3RZDC 1TWAC 3S14C 3H3VD 2NVTC 2NVQC 3HOYK 2JA6K 1TWCK 4XSXA 4BXXC 1TWFC 3EQLA 1WCMK 1YNNA 4BBSK 4A3FC 2NVXK 2VUMK 4A93C 3PO2K 3I4NC 2BE5A 5IYCC 2E2JC 3GTGK 2JA8K 3GTOK 1I3QK 3S1QC
chains in the Genus database with same CATH superfamily
1I6HC 5IYDC 2GAGC 5FJ8K 2E2HK 3L4KA 2E2IC 4BY7K 2NVXA 2GAHC 2V6SA 4BBRK 5TMCA 2Y0SD 1R9TC 4A3LK 4GTCA 3V4GA 4LK1A 5IP9K 1XPPA 1O2FB 2Y3PA 5C4XC 2P8TA 2YU9A 3GTJK 3A8IA 1Y1WC 1EFWA 5IP7K 3GTMA 5HL8A 4X6AK 3TFIA 3S2HK 5C4JK 1K83C 3FHZA 3PO3K 4KMUA 4PABA 2PPBA 3S1NK 1TWCA 1ZYRA 1VGXA 3GTPK 1O28A 1TWFK 4LR2A 4BLAA 4A3FK 2R7ZA 3GTGC 4OINA 3S1MC 4KMHA 2JH3A 3GSIA 2PMZD 4AH6A 4YFKA 5M5YK 5C44K 4A3GK 3H0GK 1IQ0A 3IPJA 1O29A 1I50K 3M4OC 4RMFA 2JA6C 1SFOK 4BXXK 2A69A 3MMLB 1WSRA 1JVIA 2NVXC 1B4BA 1Y1VC 1Y1WA 1J6VA 3GIRA 4AYBL 2R92C 4KATA 1I6HK 4C3JK 1WSVA 1VH2A 3G4CA 3GTKA 1G51A 2E2IK 4BBRC 5IORA 2V6UA 2VUMA 4GTEA 4GZYA 2KWAA 4A3LC 4XLNA 5IP9C 5JVOA 1WOSA 3FOFA 1TWHA 4KM9A 5C4XK 1WIHA 3GTJC 4O2DA 3VA7A 3GTJA 1Y1WK 2JA5K 5IP7C 2O5JA 1O27A 3GTLC 4X6AC 1IL2A 3S2HC 4QJVA 4XSZA 5C4JC 1J6WA 2GSUA 4A3DC 1PJ5A 3FKIA 3LPXA 4OIPA 1F7UA 3S1NC 3RZOC 4PAAA 4XSXA 1TWFC 3EQLA 4BBSK 4A3FC 2VUMK 4A93C 1IS1A 3I4NC 3GTGK 2EBBA 4KASA 2WAQL 2JA6A 4YFNA 1DCHA 4A3GC 1F93A 1XXBA 1I50C 3M4OK 1SFOA 4G7OA 1SFOC 3S16K 3S1RC 2B63A 2XCQA 1Y1VK 4G0VA 2R7ZK 2R92K 4Y7NK 2CW0A 3SZYA 3S2DK 4A3KC 4C3JC 4BKWA 1YNJA 1C0AA 1VJEA 1TWAK 3BP3A 1BDFA 1WQGA 4KARA 2E2JK 3GEHA 1IW7A 4GFQA 2R93K 4WILA 2JA5C 5E68A 4OIQA 4GTDA 3GTLK 3TTGA 1Y1VA 3A8JA 4A3DK 1PJ7A 4YG2A 4A3IK 4KN4A 3RZOK 3AQOA 4GTFA 5C3EK 4BBSC 2VUMC 4A93K 3GDZA 3I4NK 3GEEA 2CFAA 4KN7A 2YU9C 1TWHC 3N0CA 4KMDA 2PMZL 3OEPA 3HOUK 3Q3QA 3G4AA 3LAJA 4MEYA 1TWGA 1J6XA 4Q5SA 4C3IC 2P5MA 1F9NA 2ZUEA 3S16C 1VRQC 3S1RK 1KQ4A 3WODA 4WJ3M 2RGRA 1TWFA 3S0XA 4A3JK 2R7ZC 4Y7NC 3S2DC 4QIWD 4A3KK 4AYBD 4M1XA 4C2MK 5EGEA 1TWAC 2NVTC 2GSNA 1TWAA 1AB4A 1YNNA 2JA5A 2E2HA 1YX2A 2XCOA 2FQTA 2BE5A 4KAWX 2E2JC 2JA8K 1JQWA 2R93A 2R93C 2PA8L 5M5XK 2B63C 4DDQA 2GSOA 3FOEA 4QIWL 1R9TA 5FLMK 4A3IC 4Q4ZA 1JOEA 5C3EC 1USOA 4GTLA 1XZQA 1YCLA 3TFJA 3SZZA 5IYBK 4FM9A 3GEIA 5M5WK 1TWGC 2YU9K 1TWHK 3FKIK 4LJZA 2CFAB 2WAQD 3S14K 2PA8D 3HOUC 2NVQK 3HOYC 1TWCC 3GTLA 1WCMC 4LOWA 3ERED 4XCHA 4KMAA 4C3IK 1VLOA 1WOPA 4LLGA 2A68A 5IOTA 3QX3A 2WB1L 4KC6A 3HOXK 5M3FK 4G0WA 3JSTA 4A3EC 4ZH4A 1X31C 1EK8A 1UV7A 4C2MC 1XXAA 2V6TA 2RH6A 2NVTK 1XZQB 3S17C 3T00A 3M3YK 1IBAA 3HKZD 3HXAA 3HOVK 4J3NA 2R92A 3TFHA 1WORA 4A3CC 2JA8C 2ZUFA 3I4MK 1XZPB 1K83A 2JA7C 1ISEA 3AD8C 3HOZK 2B63K 1DCOA 1WCMA 1EH1A 5FLMC 1O2BA 3S15K 5M3MK 1EI6A 2A6EA 5D4DA 3GTGA 4OIRA 1USMA 4BLBA 4C45A 4BY1K 5IYBC 2Y0SL 1SMYA 1PJ6A 3AD9C 1TWGK 2A6HA 3FKIC 3N0BA 3CQZC 3RZDC 3S14C 3CQZA 1O25A 3BUEA 2NVQC 3HOYK 1TWCK 1XXCA 1O26A 4WJ4A 1WCMK 5L46A 3H0GA 2XCRB 3PO2K 2FQOA 1J98A 1I3QA 1IE0A 3S1QC 5JFEA 4Y52C 5TJ3A 3HOXC 3AQPA 4A3BK 4A3EK 3GTQK 5TMFA 5IOQA 2NVYK 3K7AK 1BGWA 3HOWC 5EGHA 4GTAA 1BS2A 4GT9A 4P9SA 1GE9A 3S17K 1O24A 3GTKK 3M3YC 1RU0A 5IOSA 3A8KA 4C3HC 1DCPA 3HOVC 3GTMK 1L0WA 4A3CK 1BJTA 1ZVUA 3T02A 4A3MC 3I4MC 1I6VA 2JA7K 1WQFA 4KB4A 3HOZC 4G7HA 4QJVB 1O2AA 2NVYA 1HQMA 5CJ9A 3ADAC 5CHPA 3NUHA 4KB2A 3S15C 2O5IA 4MQ9A 4KM8A 1ZXOA 4JK1A 5IYCK 1WQHA 3GTOC 1I3QC 4A3JC 1HI9A 2D6FC 3GTOA 3LAPA 3N3YA 5IYDK 4XLPA 4BY7C 2E2HC 4BY1C 3BP8C 1INNA 3L4JA 1ZQ1C 4G0UA 4P5BA 1R9TK 1DD5A 3AD7C 3CQZK 1I50A 4OIOA 3RZDK 2E2IA 1ZBSA 3DXJA 1WOOA 1XZPA 3PO2C 4G7ZA 4MEXA 3AH5A 3S1QK 1K83K 4Y52K 3PO3C 4A3BC 3H3VL 2WB1D 4GTBA 3GTPA 3GTQC 3GTPC 4LQYA 3GTQA 4KDDA 2NVYC 3OREA 3K7AC 3OPFA 3HOWK 1EQRA 2W7VA 4ILDA 2JA7A 3GTKC 3S1MK 4LK0A 4C3HK 3HKZL 4YFXA 3GTMC 4NOIA 5C44C 3H0GC 4A3MK 3CAGA 4FZBA 1F7VA 3H3VD 2JA6K 2PHCB 4BXXC 2ZFZA 4P5AA 2NVXK 3T01A 5IYCC 1V5VA 1B4AA 3GTOK 1I3QK
chains in the Genus database with same CATH topology
1I6HC 2R93C 4Y52C 2WAQL 3HOXC 4A3BK 2PA8L 5IYDC 5FJ8K 4A3EK 4YFNA 2E2IC 2E2HK 5M5XK 4A3GC 2B63C 3GTQK 5TMFA 4BY7K 4BBRK 5TMCA 2NVYK 2Y0SD 3K7AK 1R9TC 4QIWL 3HOWC 4A3LK 5FLMK 1I50C 4LK1A 5IP9K 4A3IC 1XPPA 4Q4ZA 3M4OK 4G7OA 5C3EC 1SFOC 3S17K 3S16K 5C4XC 3S1RC 3GTKK 3M3YC 3GTJK 1Y1VK 1Y1WC 3HOVC 3GTMK 5IP7K 4A3CK 5IYBK 2R7ZK 2R92K 4X6AK 4Y7NK 2CW0A 3S2HC 3S2DK 4A3MC 5C4JK 4A3KC 1K83C 1TWGC 5M5WK 1I6VA 1YNJA 1TWHK 3FKIK 2YU9K 4KMUA 2JA7K 3PO3K 4LJZA 3HOZC 2PPBA 4G7HA 3S1NK 2WAQD 1TWAK 3S14K 1ZYRA 2PA8D 4QJVB 1BDFA 2NVQK 3GTPK 1TWCC 3HOUC 3HOYC 1TWFK 1HQMA 1WCMC 4A3FK 3S15C 2O5IA 4MQ9A 4C3IK 4JK1A 5IYCK 2E2JK 4LLGA 3GTGC 4OINA 2A68A 3GTOC 1I3QC 4A3JC 3S1MC 1IW7A 2R93K 2WB1L 2PMZD 3HOXK 5M3FK 2JA5C 5IYDK 4YFKA 4XLPA 5M5YK 4A3EC 4ZH4A 5C44K 2E2HC 4BY1C 4OIQA 3GTLK 4BY7C 4A3GK 3H0GK 4A3DK 1R9TK 4YG2A 3CQZK 1I50K 4KN4A 4A3IK 4OIOA 3RZDK 3RZOK 2NVTK 3M4OC 3S2HK 2JA6C 5C3EK 1SFOK 3S17C 4BXXK 2A69A 3M3YK 3HKZD 4BBSC 3DXJA 2NVXC 1Y1VC 2VUMC 4A93K 3HOVK 3PO2C 3I4NK 4G7ZA 4A3CC 4MEXA 4AYBL 2JA8C 2R92C 3S1QK 1I6HK 4KN7A 1K83K 4C3JK 3I4MK 2YU9C 1TWHC 2JA7C 3PO3C 4Y52K 4A3BC 3H3VL 2WB1D 3HOZK 2E2IK 2PMZL 2B63K 3GTQC 3GTPC 3HOUK 4BBRC 2NVYC 4GZYA 3K7AC 3HOWK 4MEYA 4A3LC 5FLMC 4XLNA 3S15K 5IP9C 4Q5SA 5M3MK 2A6EA 3I4MC 5C4XK 3S16C 5D4DA 3S1RK 3GTKC 3S1MK 3GTJC 4OIRA 4LK0A 4C3HK 3HKZL 1Y1WK 4YFXA 2JA5K 3WODA 5IP7C 4NOIA 3GTMC 2O5JA 4BY1K 5C44C 5IYBC 4A3JK 2Y0SL 2R7ZC 1SMYA 4Y7NC 3H0GC 3GTLC 3S2DC 4X6AC 4QIWD 4QJVA 4XSZA 4AYBD 1TWGK 5C4JC 2A6HA 4A3KK 3FKIC 4A3MK 4A3DC 4OIPA 4C2MK 3CQZC 3S1NC 3RZOC 3RZDC 1TWAC 3S14C 3H3VD 2NVTC 2NVQC 3HOYK 2JA6K 1TWCK 4XSXA 4BXXC 1TWFC 3EQLA 1WCMK 1YNNA 4BBSK 4A3FC 2NVXK 2VUMK 4A93C 3PO2K 3I4NC 2BE5A 5IYCC 2E2JC 3GTGK 2JA8K 3GTOK 1I3QK 3S1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6H C;  2R93 C;  4Y52 C;  2WAQ L;  3HOX C;  4A3B K;  2PA8 L;  5IYD C;  5FJ8 K;  4A3E K;  4YFN A;  2E2I C;  2E2H K;  5M5X K;  4A3G C;  2B63 C;  3GTQ K;  5TMF A;  4BY7 K;  4BBR K;  5TMC A;  2NVY K;  2Y0S D;  3K7A K;  1R9T C;  4QIW L;  3HOW C;  4A3L K;  5FLM K;  1I50 C;  4LK1 A;  5IP9 K;  4A3I C;  1XPP A;  4Q4Z A;  3M4O K;  4G7O A;  5C3E C;  1SFO C;  3S17 K;  3S16 K;  5C4X C;  3S1R C;  3GTK K;  3M3Y C;  3GTJ K;  1Y1V K;  1Y1W C;  3HOV C;  3GTM K;  5IP7 K;  4A3C K;  5IYB K;  2R7Z K;  2R92 K;  4X6A K;  4Y7N K;  2CW0 A;  3S2H C;  3S2D K;  4A3M C;  5C4J K;  4A3K C;  1K83 C;  1TWG C;  5M5W K;  1I6V A;  1YNJ A;  1TWH K;  3FKI K;  2YU9 K;  4KMU A;  2JA7 K;  3PO3 K;  4LJZ A;  3HOZ C;  2PPB A;  4G7H A;  3S1N K;  2WAQ D;  1TWA K;  3S14 K;  1ZYR A;  2PA8 D;  4QJV B;  1BDF A;  2NVQ K;  3GTP K;  1TWC C;  3HOU C;  3HOY C;  1TWF K;  1HQM A;  1WCM C;  4A3F K;  3S15 C;  2O5I A;  4MQ9 A;  4C3I K;  4JK1 A;  5IYC K;  2E2J K;  4LLG A;  3GTG C;  4OIN A;  2A68 A;  3GTO C;  1I3Q C;  4A3J C;  3S1M C;  1IW7 A;  2R93 K;  2WB1 L;  2PMZ D;  3HOX K;  5M3F K;  2JA5 C;  5IYD K;  4YFK A;  4XLP A;  5M5Y K;  4A3E C;  4ZH4 A;  5C44 K;  2E2H C;  4BY1 C;  4OIQ A;  3GTL K;  4BY7 C;  4A3G K;  3H0G K;  4A3D K;  1R9T K;  4YG2 A;  3CQZ K;  1I50 K;  4KN4 A;  4A3I K;  4OIO A;  3RZD K;  3RZO K;  2NVT K;  3M4O C;  3S2H K;  2JA6 C;  5C3E K;  1SFO K;  3S17 C;  4BXX K;  2A69 A;  3M3Y K;  3HKZ D;  4BBS C;  3DXJ A;  2NVX C;  1Y1V C;  2VUM C;  4A93 K;  3HOV K;  3PO2 C;  3I4N K;  4G7Z A;  4A3C C;  4MEX A;  4AYB L;  2JA8 C;  2R92 C;  3S1Q K;  1I6H K;  4KN7 A;  1K83 K;  4C3J K;  3I4M K;  2YU9 C;  1TWH C;  2JA7 C;  3PO3 C;  4Y52 K;  4A3B C;  3H3V L;  2WB1 D;  3HOZ K;  2E2I K;  2PMZ L;  2B63 K;  3GTQ C;  3GTP C;  3HOU K;  4BBR C;  2NVY C;  4GZY A;  3K7A C;  3HOW K;  4MEY A;  4A3L C;  5FLM C;  4XLN A;  3S15 K;  5IP9 C;  4Q5S A;  5M3M K;  2A6E A;  3I4M C;  5C4X K;  3S16 C;  5D4D A;  3S1R K;  3GTK C;  3S1M K;  3GTJ C;  4OIR A;  4LK0 A;  4C3H K;  3HKZ L;  1Y1W K;  4YFX A;  2JA5 K;  3WOD A;  5IP7 C;  4NOI A;  3GTM C;  2O5J A;  4BY1 K;  5C44 C;  5IYB C;  4A3J K;  2Y0S L;  2R7Z C;  1SMY A;  4Y7N C;  3H0G C;  3GTL C;  3S2D C;  4X6A C;  4QIW D;  4QJV A;  4XSZ A;  4AYB D;  1TWG K;  5C4J C;  2A6H A;  4A3K K;  3FKI C;  4A3M K;  4A3D C;  4OIP A;  4C2M K;  3CQZ C;  3S1N C;  3RZO C;  3RZD C;  1TWA C;  3S14 C;  3H3V D;  2NVT C;  2NVQ C;  3HOY K;  2JA6 K;  1TWC K;  4XSX A;  4BXX C;  1TWF C;  3EQL A;  1WCM K;  1YNN A;  4BBS K;  4A3F C;  2NVX K;  2VUM K;  4A93 C;  3PO2 K;  3I4N C;  2BE5 A;  5IYC C;  2E2J C;  3GTG K;  2JA8 K;  3GTO K;  1I3Q K;  3S1Q C; 
#chains in the Genus database with same CATH topology
 1I6H C;  5IYD C;  2GAG C;  5FJ8 K;  2E2H K;  3L4K A;  2E2I C;  4BY7 K;  2NVX A;  2GAH C;  2V6S A;  4BBR K;  5TMC A;  2Y0S D;  1R9T C;  4A3L K;  4GTC A;  3V4G A;  4LK1 A;  5IP9 K;  1XPP A;  1O2F B;  2Y3P A;  5C4X C;  2P8T A;  2YU9 A;  3GTJ K;  3A8I A;  1Y1W C;  1EFW A;  5IP7 K;  3GTM A;  5HL8 A;  4X6A K;  3TFI A;  3S2H K;  5C4J K;  1K83 C;  3FHZ A;  3PO3 K;  4KMU A;  4PAB A;  2PPB A;  3S1N K;  1TWC A;  1ZYR A;  1VGX A;  3GTP K;  1O28 A;  1TWF K;  4LR2 A;  4BLA A;  4A3F K;  2R7Z A;  3GTG C;  4OIN A;  3S1M C;  4KMH A;  2JH3 A;  3GSI A;  2PMZ D;  4AH6 A;  4YFK A;  5M5Y K;  5C44 K;  4A3G K;  3H0G K;  1IQ0 A;  3IPJ A;  1O29 A;  1I50 K;  3M4O C;  4RMF A;  2JA6 C;  1SFO K;  4BXX K;  2A69 A;  3MML B;  1WSR A;  1JVI A;  2NVX C;  1B4B A;  1Y1V C;  1Y1W A;  1J6V A;  3GIR A;  4AYB L;  2R92 C;  4KAT A;  1I6H K;  4C3J K;  1WSV A;  1VH2 A;  3G4C A;  3GTK A;  1G51 A;  2E2I K;  4BBR C;  5IOR A;  2V6U A;  2VUM A;  4GTE A;  4GZY A;  2KWA A;  4A3L C;  4XLN A;  5IP9 C;  5JVO A;  1WOS A;  3FOF A;  1TWH A;  4KM9 A;  5C4X K;  1WIH A;  3GTJ C;  4O2D A;  3VA7 A;  3GTJ A;  1Y1W K;  2JA5 K;  5IP7 C;  2O5J A;  1O27 A;  3GTL C;  4X6A C;  1IL2 A;  3S2H C;  4QJV A;  4XSZ A;  5C4J C;  1J6W A;  2GSU A;  4A3D C;  1PJ5 A;  3FKI A;  3LPX A;  4OIP A;  1F7U A;  3S1N C;  3RZO C;  4PAA A;  4XSX A;  1TWF C;  3EQL A;  4BBS K;  4A3F C;  2VUM K;  4A93 C;  1IS1 A;  3I4N C;  3GTG K;  2EBB A;  4KAS A;  2WAQ L;  2JA6 A;  4YFN A;  1DCH A;  4A3G C;  1F93 A;  1XXB A;  1I50 C;  3M4O K;  1SFO A;  4G7O A;  1SFO C;  3S16 K;  3S1R C;  2B63 A;  2XCQ A;  1Y1V K;  4G0V A;  2R7Z K;  2R92 K;  4Y7N K;  2CW0 A;  3SZY A;  3S2D K;  4A3K C;  4C3J C;  4BKW A;  1YNJ A;  1C0A A;  1VJE A;  1TWA K;  3BP3 A;  1BDF A;  1WQG A;  4KAR A;  2E2J K;  3GEH A;  1IW7 A;  4GFQ A;  2R93 K;  4WIL A;  2JA5 C;  5E68 A;  4OIQ A;  4GTD A;  3GTL K;  3TTG A;  1Y1V A;  3A8J A;  4A3D K;  1PJ7 A;  4YG2 A;  4A3I K;  4KN4 A;  3RZO K;  3AQO A;  4GTF A;  5C3E K;  4BBS C;  2VUM C;  4A93 K;  3GDZ A;  3I4N K;  3GEE A;  2CFA A;  4KN7 A;  2YU9 C;  1TWH C;  3N0C A;  4KMD A;  2PMZ L;  3OEP A;  3HOU K;  3Q3Q A;  3G4A A;  3LAJ A;  4MEY A;  1TWG A;  1J6X A;  4Q5S A;  4C3I C;  2P5M A;  1F9N A;  2ZUE A;  3S16 C;  1VRQ C;  3S1R K;  1KQ4 A;  3WOD A;  4WJ3 M;  2RGR A;  1TWF A;  3S0X A;  4A3J K;  2R7Z C;  4Y7N C;  3S2D C;  4QIW D;  4A3K K;  4AYB D;  4M1X A;  4C2M K;  5EGE A;  1TWA C;  2NVT C;  2GSN A;  1TWA A;  1AB4 A;  1YNN A;  2JA5 A;  2E2H A;  1YX2 A;  2XCO A;  2FQT A;  2BE5 A;  4KAW X;  2E2J C;  2JA8 K;  1JQW A;  2R93 A;  2R93 C;  2PA8 L;  5M5X K;  2B63 C;  4DDQ A;  2GSO A;  3FOE A;  4QIW L;  1R9T A;  5FLM K;  4A3I C;  4Q4Z A;  1JOE A;  5C3E C;  1USO A;  4GTL A;  1XZQ A;  1YCL A;  3TFJ A;  3SZZ A;  5IYB K;  4FM9 A;  3GEI A;  5M5W K;  1TWG C;  2YU9 K;  1TWH K;  3FKI K;  4LJZ A;  2CFA B;  2WAQ D;  3S14 K;  2PA8 D;  3HOU C;  2NVQ K;  3HOY C;  1TWC C;  3GTL A;  1WCM C;  4LOW A;  3ERE D;  4XCH A;  4KMA A;  4C3I K;  1VLO A;  1WOP A;  4LLG A;  2A68 A;  5IOT A;  3QX3 A;  2WB1 L;  4KC6 A;  3HOX K;  5M3F K;  4G0W A;  3JST A;  4A3E C;  4ZH4 A;  1X31 C;  1EK8 A;  1UV7 A;  4C2M C;  1XXA A;  2V6T A;  2RH6 A;  2NVT K;  1XZQ B;  3S17 C;  3T00 A;  3M3Y K;  1IBA A;  3HKZ D;  3HXA A;  3HOV K;  4J3N A;  2R92 A;  3TFH A;  1WOR A;  4A3C C;  2JA8 C;  2ZUF A;  3I4M K;  1XZP B;  1K83 A;  2JA7 C;  1ISE A;  3AD8 C;  3HOZ K;  2B63 K;  1DCO A;  1WCM A;  1EH1 A;  5FLM C;  1O2B A;  3S15 K;  5M3M K;  1EI6 A;  2A6E A;  5D4D A;  3GTG A;  4OIR A;  1USM A;  4BLB A;  4C45 A;  4BY1 K;  5IYB C;  2Y0S L;  1SMY A;  1PJ6 A;  3AD9 C;  1TWG K;  2A6H A;  3FKI C;  3N0B A;  3CQZ C;  3RZD C;  3S14 C;  3CQZ A;  1O25 A;  3BUE A;  2NVQ C;  3HOY K;  1TWC K;  1XXC A;  1O26 A;  4WJ4 A;  1WCM K;  5L46 A;  3H0G A;  2XCR B;  3PO2 K;  2FQO A;  1J98 A;  1I3Q A;  1IE0 A;  3S1Q C;  5JFE A;  4Y52 C;  5TJ3 A;  3HOX C;  3AQP A;  4A3B K;  4A3E K;  3GTQ K;  5TMF A;  5IOQ A;  2NVY K;  3K7A K;  1BGW A;  3HOW C;  5EGH A;  4GTA A;  1BS2 A;  4GT9 A;  4P9S A;  1GE9 A;  3S17 K;  1O24 A;  3GTK K;  3M3Y C;  1RU0 A;  5IOS A;  3A8K A;  4C3H C;  1DCP A;  3HOV C;  3GTM K;  1L0W A;  4A3C K;  1BJT A;  1ZVU A;  3T02 A;  4A3M C;  3I4M C;  1I6V A;  2JA7 K;  1WQF A;  4KB4 A;  3HOZ C;  4G7H A;  4QJV B;  1O2A A;  2NVY A;  1HQM A;  5CJ9 A;  3ADA C;  5CHP A;  3NUH A;  4KB2 A;  3S15 C;  2O5I A;  4MQ9 A;  4KM8 A;  1ZXO A;  4JK1 A;  5IYC K;  1WQH A;  3GTO C;  1I3Q C;  4A3J C;  1HI9 A;  2D6F C;  3GTO A;  3LAP A;  3N3Y A;  5IYD K;  4XLP A;  4BY7 C;  2E2H C;  4BY1 C;  3BP8 C;  1INN A;  3L4J A;  1ZQ1 C;  4G0U A;  4P5B A;  1R9T K;  1DD5 A;  3AD7 C;  3CQZ K;  1I50 A;  4OIO A;  3RZD K;  2E2I A;  1ZBS A;  3DXJ A;  1WOO A;  1XZP A;  3PO2 C;  4G7Z A;  4MEX A;  3AH5 A;  3S1Q K;  1K83 K;  4Y52 K;  3PO3 C;  4A3B C;  3H3V L;  2WB1 D;  4GTB A;  3GTP A;  3GTQ C;  3GTP C;  4LQY A;  3GTQ A;  4KDD A;  2NVY C;  3ORE A;  3K7A C;  3OPF A;  3HOW K;  1EQR A;  2W7V A;  4ILD A;  2JA7 A;  3GTK C;  3S1M K;  4LK0 A;  4C3H K;  3HKZ L;  4YFX A;  3GTM C;  4NOI A;  5C44 C;  3H0G C;  4A3M K;  3CAG A;  4FZB A;  1F7V A;  3H3V D;  2JA6 K;  2PHC B;  4BXX C;  2ZFZ A;  4P5A A;  2NVX K;  3T01 A;  5IYC C;  1V5V A;  1B4A A;  3GTO K;  1I3Q K; 
#chains in the Genus database with same CATH homology
 1I6H C;  2R93 C;  4Y52 C;  2WAQ L;  3HOX C;  4A3B K;  2PA8 L;  5IYD C;  5FJ8 K;  4A3E K;  4YFN A;  2E2I C;  2E2H K;  5M5X K;  4A3G C;  2B63 C;  3GTQ K;  5TMF A;  4BY7 K;  4BBR K;  5TMC A;  2NVY K;  2Y0S D;  3K7A K;  1R9T C;  4QIW L;  3HOW C;  4A3L K;  5FLM K;  1I50 C;  4LK1 A;  5IP9 K;  4A3I C;  1XPP A;  4Q4Z A;  3M4O K;  4G7O A;  5C3E C;  1SFO C;  3S17 K;  3S16 K;  5C4X C;  3S1R C;  3GTK K;  3M3Y C;  3GTJ K;  1Y1V K;  1Y1W C;  3HOV C;  3GTM K;  5IP7 K;  4A3C K;  5IYB K;  2R7Z K;  2R92 K;  4X6A K;  4Y7N K;  2CW0 A;  3S2H C;  3S2D K;  4A3M C;  5C4J K;  4A3K C;  1K83 C;  1TWG C;  5M5W K;  1I6V A;  1YNJ A;  1TWH K;  3FKI K;  2YU9 K;  4KMU A;  2JA7 K;  3PO3 K;  4LJZ A;  3HOZ C;  2PPB A;  4G7H A;  3S1N K;  2WAQ D;  1TWA K;  3S14 K;  1ZYR A;  2PA8 D;  4QJV B;  1BDF A;  2NVQ K;  3GTP K;  1TWC C;  3HOU C;  3HOY C;  1TWF K;  1HQM A;  1WCM C;  4A3F K;  3S15 C;  2O5I A;  4MQ9 A;  4C3I K;  4JK1 A;  5IYC K;  2E2J K;  4LLG A;  3GTG C;  4OIN A;  2A68 A;  3GTO C;  1I3Q C;  4A3J C;  3S1M C;  1IW7 A;  2R93 K;  2WB1 L;  2PMZ D;  3HOX K;  5M3F K;  2JA5 C;  5IYD K;  4YFK A;  4XLP A;  5M5Y K;  4A3E C;  4ZH4 A;  5C44 K;  2E2H C;  4BY1 C;  4OIQ A;  3GTL K;  4BY7 C;  4A3G K;  3H0G K;  4A3D K;  1R9T K;  4YG2 A;  3CQZ K;  1I50 K;  4KN4 A;  4A3I K;  4OIO A;  3RZD K;  3RZO K;  2NVT K;  3M4O C;  3S2H K;  2JA6 C;  5C3E K;  1SFO K;  3S17 C;  4BXX K;  2A69 A;  3M3Y K;  3HKZ D;  4BBS C;  3DXJ A;  2NVX C;  1Y1V C;  2VUM C;  4A93 K;  3HOV K;  3PO2 C;  3I4N K;  4G7Z A;  4A3C C;  4MEX A;  4AYB L;  2JA8 C;  2R92 C;  3S1Q K;  1I6H K;  4KN7 A;  1K83 K;  4C3J K;  3I4M K;  2YU9 C;  1TWH C;  2JA7 C;  3PO3 C;  4Y52 K;  4A3B C;  3H3V L;  2WB1 D;  3HOZ K;  2E2I K;  2PMZ L;  2B63 K;  3GTQ C;  3GTP C;  3HOU K;  4BBR C;  2NVY C;  4GZY A;  3K7A C;  3HOW K;  4MEY A;  4A3L C;  5FLM C;  4XLN A;  3S15 K;  5IP9 C;  4Q5S A;  5M3M K;  2A6E A;  3I4M C;  5C4X K;  3S16 C;  5D4D A;  3S1R K;  3GTK C;  3S1M K;  3GTJ C;  4OIR A;  4LK0 A;  4C3H K;  3HKZ L;  1Y1W K;  4YFX A;  2JA5 K;  3WOD A;  5IP7 C;  4NOI A;  3GTM C;  2O5J A;  4BY1 K;  5C44 C;  5IYB C;  4A3J K;  2Y0S L;  2R7Z C;  1SMY A;  4Y7N C;  3H0G C;  3GTL C;  3S2D C;  4X6A C;  4QIW D;  4QJV A;  4XSZ A;  4AYB D;  1TWG K;  5C4J C;  2A6H A;  4A3K K;  3FKI C;  4A3M K;  4A3D C;  4OIP A;  4C2M K;  3CQZ C;  3S1N C;  3RZO C;  3RZD C;  1TWA C;  3S14 C;  3H3V D;  2NVT C;  2NVQ C;  3HOY K;  2JA6 K;  1TWC K;  4XSX A;  4BXX C;  1TWF C;  3EQL A;  1WCM K;  1YNN A;  4BBS K;  4A3F C;  2NVX K;  2VUM K;  4A93 C;  3PO2 K;  3I4N C;  2BE5 A;  5IYC C;  2E2J C;  3GTG K;  2JA8 K;  3GTO K;  1I3Q K;  3S1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...