1TWFK

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twfK00
4BBSC 4QIWL 2E2IK 4MQ9A 1R9TC 4GZYA 3S15K 5IYCC 3M4OK 1I50K 2R93K 3WODA 4A3FK 3K7AK 4A3JC 4OIRA 1YNJA 5TMCA 5C4JC 1Y1WK 2E2IC 4A3BC 4A3GK 4QJVB 3S2DK 3GTLK 3S16K 2R92K 1IW7A 2O5JA 4A3CK 4BXXC 4X6AK 4BY7K 5IYBK 3GTJK 4AYBL 4C2MK 4A3GC 2E2HC 4YFNA 3GTLC 3DXJA 4QJVA 4XSZA 3S1QC 4BBRK 3S14C 4KN7A 3S1RC 5IP7C 2E2JC 4C3IK 2R7ZK 3GTJC 2JA8C 4OINA 4OIOA 4A3MC 2JA5K 3GTKK 3HOVC 5FJ8K 1TWAK 1WCMK 4Y7NC 3HOWK 2NVXK 3HKZD 1I3QK 1TWHK 1SMYA 2WAQD 4YFXA 4XLNA 2VUMC 2PMZD 3GTPK 4NOIA 4Q4ZA 5C4XC 3HOUK 3S2HK 2JA7K 3S1NK 3GTKC 3S1MK 2NVYK 2PMZL 3S15C 3RZOK 5TMFA 1I50C 3M4OC 2R93C 3GTGK 4A3FC 4Y52K 1HQMA 3CQZK 3K7AC 2NVTK 1I6HK 5IP9K 3PO2K 1Y1WC 2WB1D 3RZDK 2NVYC 1SFOK 3H3VD 3S2DC 5FLMK 4A3IK 3S16C 2NVQK 3GTMK 2R92C 3EQLA 4A3KK 4YG2A 3GTGC 4OIPA 2BE5A 1Y1VK 2WB1L 2VUMK 4A3CC 4X6AC 3H3VL 3PO3K 5IYBC 5C44K 2A6EA 4BY7C 2A68A 4LJZA 1TWFK 2JA6K 1TWCK 4LK0A 1SFOC 4A3IC 2A69A 5M5XK 3GTMC 4A3LK 4BBRC 5C3EK 4C3JK 3HOXK 4G7HA 1Y1VC 4A3EK 4C3HK 2YU9K 1I6VA 4KMUA 2R7ZC 3GTOK 3PO3C 4A3DK 1TWFC 4LK1A 3M3YK 2JA5C 4XSXA 4BY1K 3GTQK 3I4NK 3HOYK 3HKZL 2WAQL 4G7ZA 3I4MK 1K83K 1TWAC 1WCMC 3H0GK 3HOWC 2NVXC 3HOZK 1TWGK 1I3QC 1TWHC 3GTPC 3S17K 4A93K 3FKIK 3HOUC 3S2HC 2JA7C 4YFKA 4BY1C 3S1NC 3I4NC 1R9TK 3S1MC 5M5WK 5M3MK 3I4MC 4OIQA 4QIWD 2Y0SD 5IYCK 4MEXA 3RZOC 1TWGC 2B63K 5D4DA 4Y52C 4A3JK 3CQZC 2NVTC 5C4JK 4A3BK 4Q5SA 1YNNA 2Y0SL 5IP9C 3PO2C 1I6HC 3RZDC 5IYDK 5FLMC 2NVQC 2B63C 4A3KC 4XLPA 4G7OA 4BXXK 5IYDC 5C44C 2E2HK 2JA6C 1TWCC 4ZH4A 4AYBD 3S1QK 1ZYRA 3S14K 5C3EC 4A3LC 3S1RK 3HOXC 5IP7K 4LLGA 2E2JK 1BDFA 4A3EC 2YU9C 5M3FK 2PPBA 2JA8K 3GTOC 4A3DC 4JK1A 4KN4A 4A3MK 3M3YC 4MEYA 5M5YK 2O5IA 4BBSK 2PA8D 3HOVK 3GTQC 2A6HA 3HOYC 4Y7NK 1K83C 3H0GC 1XPPA 2CW0A 3HOZC 2PA8L 3S17C 4A93C 5C4XK 3FKIC
chains in the Genus database with same CATH superfamily
4KARA 4QIWL 1O28A 1WSRA 4P9SA 3S15K 2R93K 2R93A 4KAWX 4KDDA 3OREA 3S2DK 4BLBA 1IW7A 4X6AK 3AH5A 1ZVUA 4A3GC 4XSZA 3S1QC 3S14C 4KN7A 3S1RC 1F7UA 2E2JC 4KMDA 3LAJA 3GTJC 4OINA 1F93A 4A3MC 5CHPA 1DCPA 1TWHK 2VUMC 1TWHA 2P8TA 1O29A 3N0BA 1BJTA 5TMFA 1I50C 3ADAC 3AD9C 1EK8A 1USOA 4A3FC 1XZQB 3K7AC 3GTGK 1I6HK 4GTAA 2XCOA 2NVYC 1ZBSA 3H3VD 3Q3QA 4A3IK 3FHZA 3S16C 1B4BA 2W7VA 4A3KK 3L4KA 2R92C 2BE5A 2CFAA 5C44K 3T01A 1TWFK 4LK0A 5M5XK 5C3EK 1O2BA 3HOXK 5JFEA 1J6XA 1Y1VC 4G7HA 3GIRA 4C3IC 2R7ZC 4KMUA 3PO3C 4LK1A 3M3YK 3G4CA 3A8JA 4XSXA 3I4NK 1O25A 1WIHA 1L0WA 2NVXC 3GTPC 4A93K 4GTLA 2JA7C 3S1NC 4G0UA 3S1MC 4QIWD 4RMFA 1WOSA 4KMHA 3RZOC 3MMLB 4A3JK 2Y0SL 5IP9C 2XCRB 1IS1A 5FLMC 2B63C 1EH1A 4GTEA 5IYDC 2JA6C 1TWCC 3NUHA 1WQFA 1XZPB 4C3JC 5IP7K 4FM9A 4A3EC 1WORA 4C3HC 5M3FK 2YU9C 4JK1A 3A8IA 3HOVK 1HI9A 1K83C 3H0GC 1XPPA 1F7VA 3HOZC 2PA8L 3S17C 2E2IK 3GTKA 4MQ9A 1R9TC 3G4AA 4GTCA 3WODA 1VH2A 3FOEA 2ZUEA 4OIRA 1YNJA 5C4JC 4A3BC 1Y1WK 1Y1WA 3GTLK 4KB4A 1J98A 5IOQA 1XXAA 4A3CK 4BXXC 4BY7K 4C2MK 1JOEA 1SFOA 2V6TA 3GTMA 1O2AA 2JA8C 4OIOA 1X31C 1TWAK 1WCMK 1XXBA 3FOFA 1TWAA 1WCMA 4XLNA 2PMZD 4WJ4A 4Q4ZA 5L46A 3HOUK 1WQGA 1VLOA 1BS2A 5TJ3A 3BP8C 1WOPA 3M4OC 4P5BA 1TWGA 4Y52K 4KM8A 1HQMA 3CQZK 2NVTK 3CQZA 2WB1D 1WQHA 2NVQK 3EQLA 4YG2A 3GTGC 4OIPA 5IYBC 2A68A 4A3IC 4A3LK 4BBRC 3CAGA 4A3DK 1TWFC 2JA5C 3T02A 4BY1K 2ZUFA 1EQRA 1RU0A 3I4MK 3HOWC 1I3QC 3FKIK 3FKIA 3S2HC 4DDQA 3I4NC 5M5WK 3SZYA 4G0VA 4GFQA 1YNNA 3S0XA 3PO2C 3RZDC 2KWAA 4ILDA 1DCHA 2GAHC 4GTBA 2V6SA 5JVOA 3GEIA 3L4JA 4ZH4A 3BUEA 3S1QK 3S14K 3S1RK 4LLGA 2E2JK 1BDFA 1ISEA 3GTOC 3OEPA 3GTJA 4KN4A 4A3MK 1IL2A 4BBSK 3BP3A 3GTQC 4KB2A 3HOYC 2VUMK 4PAAA 2VUMA 4GZYA 5IYCC 1I50K 1I50A 4A3FK 3K7AK 2E2IC 2NVYA 3S16K 2R92K 2R92A 5EGHA 3OPFA 2E2HC 3GTLC 1JQWA 1PJ5A 3DXJA 4QJVA 3JSTA 4GTDA 1Y1VA 4C3IK 1XZQA 4KATA 2R7ZK 2R7ZA 4C2MC 2GAGC 1XXCA 3GTKK 5FJ8K 4Y7NC 5IOTA 2NVXK 3GTPK 2NVXA 4YFXA 3GTPA 5C4XC 2JA7K 3S1NK 2V6UA 2JA7A 1O24A 3S1MK 4J3NA 3TFHA 2GSNA 2P5MA 3IPJA 3RZOK 3S15C 2JH3A 2R93C 4BKWA 5IP9K 1IBAA 1SFOK 3S2DC 2FQTA 5FLMK 3AD8C 3GTMK 2RGRA 2B63A 1PJ7A 4X6AC 3H3VL 5IYDK 2FQOA 2A6EA 4LJZA 1JVIA 2JA6K 1TWCK 2GSUA 2JA6A 1TWCA 2A69A 2ZFZA 4C3JK 4C45A 4C3HK 4A3EK 1J6WA 2YU9K 2YU9A 1VGXA 3GSIA 5HL8A 3HKZL 2WAQL 3SZZA 1F9NA 4G7ZA 1K83K 3H0GK 1K83A 3HOZK 3H0GA 1TWGK 1TWHC 3S17K 2CFAB 4YFKA 4BY1C 1R9TK 1XZPA 5M3MK 1R9TA 3VA7A 4OIQA 3I4MC 2Y0SD 4MEXA 5C4JK 4A3BK 4Q5SA 1I6HC 4BLAA 3QX3A 1WSVA 3AD7C 4A3KC 4XLPA 4G7OA 4BXXK 5C44C 1INNA 3GEEA 5C3EC 3HOXC 1WOOA 1EFWA 2JA8K 1PJ6A 3M3YC 3N0CA 4MEYA 3A8KA 5M5YK 3LAPA 2PA8D 5EGEA 2RH6A 1C0AA 4A93C 4LR2A 4BBSC 4P5AA 4KMAA 3HXAA 4M1XA 5IOSA 1KQ4A 3M4OK 4A3JC 3TTGA 4LOWA 5TMCA 4A3GK 4QJVB 2O5JA 1VJEA 1G51A 3GTGA 4WILA 5IYBK 3GTJK 4AYBL 4YFNA 1O2FB 3TFJA 4BBRK 2XCQA 5IP7C 3N3YA 1TWFA 2JA5K 2JA5A 3HOVC 4O2DA 3HOWK 1J6VA 3HKZD 1I3QK 2WAQD 1SMYA 4WJ3M 1I3QA 1O27A 4NOIA 3S2HK 3GTKC 2NVYK 1V5VA 2PMZL 3AQPA 3PO2K 1Y1WC 2GSOA 3RZDK 3T00A 1Y1VK 1YX2A 2WB1L 4A3CC 3PO3K 4XCHA 4BY7C 1SFOC 3LPXA 3GTMC 1USMA 3GTOK 1I6VA 4AH6A 3GTOA 1ZQ1C 4GTFA 5CJ9A 1VRQC 3GTQK 1BGWA 3HOYK 3GTQA 1UV7A 1B4AA 1TWAC 1WCMC 4FZBA 1DD5A 2Y3PA 3GEHA 1AB4A 3GDZA 4G0WA 1O26A 3HOUC 1EI6A 3AQOA 2PHCB 4KC6A 5IYCK 2EBBA 1TWGC 2B63K 1YCLA 5D4DA 4Y52C 1GE9A 3CQZC 2NVTC 5E68A 2E2IA 1IQ0A 2NVQC 4LQYA 4PABA 2E2HK 4GT9A 2E2HA 4AYBD 3GTLA 1ZYRA 4A3LC 1DCOA 2PPBA 1IE0A 4A3DC 5IORA 2D6FC 2O5IA 3ERED 2A6HA 4KM9A 3TFIA 4Y7NK 2CW0A 1ZXOA 3V4GA 5C4XK 3FKIC 4KASA
chains in the Genus database with same CATH topology
4BBSC 4QIWL 2E2IK 4MQ9A 1R9TC 4GZYA 3S15K 5IYCC 3M4OK 1I50K 2R93K 3WODA 4A3FK 3K7AK 4A3JC 4OIRA 1YNJA 5TMCA 5C4JC 1Y1WK 2E2IC 4A3BC 4A3GK 4QJVB 3S2DK 3GTLK 3S16K 2R92K 1IW7A 2O5JA 4A3CK 4BXXC 4X6AK 4BY7K 5IYBK 3GTJK 4AYBL 4C2MK 4A3GC 2E2HC 4YFNA 3GTLC 3DXJA 4QJVA 4XSZA 3S1QC 4BBRK 3S14C 4KN7A 3S1RC 5IP7C 2E2JC 4C3IK 2R7ZK 3GTJC 2JA8C 4OINA 4OIOA 4A3MC 2JA5K 3GTKK 3HOVC 5FJ8K 1TWAK 1WCMK 4Y7NC 3HOWK 2NVXK 3HKZD 1I3QK 1TWHK 1SMYA 2WAQD 4YFXA 4XLNA 2VUMC 2PMZD 3GTPK 4NOIA 4Q4ZA 5C4XC 3HOUK 3S2HK 2JA7K 3S1NK 3GTKC 3S1MK 2NVYK 2PMZL 3S15C 3RZOK 5TMFA 1I50C 3M4OC 2R93C 3GTGK 4A3FC 4Y52K 1HQMA 3CQZK 3K7AC 2NVTK 1I6HK 5IP9K 3PO2K 1Y1WC 2WB1D 3RZDK 2NVYC 1SFOK 3H3VD 3S2DC 5FLMK 4A3IK 3S16C 2NVQK 3GTMK 2R92C 3EQLA 4A3KK 4YG2A 3GTGC 4OIPA 2BE5A 1Y1VK 2WB1L 2VUMK 4A3CC 4X6AC 3H3VL 3PO3K 5IYBC 5C44K 2A6EA 4BY7C 2A68A 4LJZA 1TWFK 2JA6K 1TWCK 4LK0A 1SFOC 4A3IC 2A69A 5M5XK 3GTMC 4A3LK 4BBRC 5C3EK 4C3JK 3HOXK 4G7HA 1Y1VC 4A3EK 4C3HK 2YU9K 1I6VA 4KMUA 2R7ZC 3GTOK 3PO3C 4A3DK 1TWFC 4LK1A 3M3YK 2JA5C 4XSXA 4BY1K 3GTQK 3I4NK 3HOYK 3HKZL 2WAQL 4G7ZA 3I4MK 1K83K 1TWAC 1WCMC 3H0GK 3HOWC 2NVXC 3HOZK 1TWGK 1I3QC 1TWHC 3GTPC 3S17K 4A93K 3FKIK 3HOUC 3S2HC 2JA7C 4YFKA 4BY1C 3S1NC 3I4NC 1R9TK 3S1MC 5M5WK 5M3MK 3I4MC 4OIQA 4QIWD 2Y0SD 5IYCK 4MEXA 3RZOC 1TWGC 2B63K 5D4DA 4Y52C 4A3JK 3CQZC 2NVTC 5C4JK 4A3BK 4Q5SA 1YNNA 2Y0SL 5IP9C 3PO2C 1I6HC 3RZDC 5IYDK 5FLMC 2NVQC 2B63C 4A3KC 4XLPA 4G7OA 4BXXK 5IYDC 5C44C 2E2HK 2JA6C 1TWCC 4ZH4A 4AYBD 3S1QK 1ZYRA 3S14K 5C3EC 4A3LC 3S1RK 3HOXC 5IP7K 4LLGA 2E2JK 1BDFA 4A3EC 2YU9C 5M3FK 2PPBA 2JA8K 3GTOC 4A3DC 4JK1A 4KN4A 4A3MK 3M3YC 4MEYA 5M5YK 2O5IA 4BBSK 2PA8D 3HOVK 3GTQC 2A6HA 3HOYC 4Y7NK 1K83C 3H0GC 1XPPA 2CW0A 3HOZC 2PA8L 3S17C 4A93C 5C4XK 3FKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS C;  4QIW L;  2E2I K;  4MQ9 A;  1R9T C;  4GZY A;  3S15 K;  5IYC C;  3M4O K;  1I50 K;  2R93 K;  3WOD A;  4A3F K;  3K7A K;  4A3J C;  4OIR A;  1YNJ A;  5TMC A;  5C4J C;  1Y1W K;  2E2I C;  4A3B C;  4A3G K;  4QJV B;  3S2D K;  3GTL K;  3S16 K;  2R92 K;  1IW7 A;  2O5J A;  4A3C K;  4BXX C;  4X6A K;  4BY7 K;  5IYB K;  3GTJ K;  4AYB L;  4C2M K;  4A3G C;  2E2H C;  4YFN A;  3GTL C;  3DXJ A;  4QJV A;  4XSZ A;  3S1Q C;  4BBR K;  3S14 C;  4KN7 A;  3S1R C;  5IP7 C;  2E2J C;  4C3I K;  2R7Z K;  3GTJ C;  2JA8 C;  4OIN A;  4OIO A;  4A3M C;  2JA5 K;  3GTK K;  3HOV C;  5FJ8 K;  1TWA K;  1WCM K;  4Y7N C;  3HOW K;  2NVX K;  3HKZ D;  1I3Q K;  1TWH K;  1SMY A;  2WAQ D;  4YFX A;  4XLN A;  2VUM C;  2PMZ D;  3GTP K;  4NOI A;  4Q4Z A;  5C4X C;  3HOU K;  3S2H K;  2JA7 K;  3S1N K;  3GTK C;  3S1M K;  2NVY K;  2PMZ L;  3S15 C;  3RZO K;  5TMF A;  1I50 C;  3M4O C;  2R93 C;  3GTG K;  4A3F C;  4Y52 K;  1HQM A;  3CQZ K;  3K7A C;  2NVT K;  1I6H K;  5IP9 K;  3PO2 K;  1Y1W C;  2WB1 D;  3RZD K;  2NVY C;  1SFO K;  3H3V D;  3S2D C;  5FLM K;  4A3I K;  3S16 C;  2NVQ K;  3GTM K;  2R92 C;  3EQL A;  4A3K K;  4YG2 A;  3GTG C;  4OIP A;  2BE5 A;  1Y1V K;  2WB1 L;  2VUM K;  4A3C C;  4X6A C;  3H3V L;  3PO3 K;  5IYB C;  5C44 K;  2A6E A;  4BY7 C;  2A68 A;  4LJZ A;  1TWF K;  2JA6 K;  1TWC K;  4LK0 A;  1SFO C;  4A3I C;  2A69 A;  5M5X K;  3GTM C;  4A3L K;  4BBR C;  5C3E K;  4C3J K;  3HOX K;  4G7H A;  1Y1V C;  4A3E K;  4C3H K;  2YU9 K;  1I6V A;  4KMU A;  2R7Z C;  3GTO K;  3PO3 C;  4A3D K;  1TWF C;  4LK1 A;  3M3Y K;  2JA5 C;  4XSX A;  4BY1 K;  3GTQ K;  3I4N K;  3HOY K;  3HKZ L;  2WAQ L;  4G7Z A;  3I4M K;  1K83 K;  1TWA C;  1WCM C;  3H0G K;  3HOW C;  2NVX C;  3HOZ K;  1TWG K;  1I3Q C;  1TWH C;  3GTP C;  3S17 K;  4A93 K;  3FKI K;  3HOU C;  3S2H C;  2JA7 C;  4YFK A;  4BY1 C;  3S1N C;  3I4N C;  1R9T K;  3S1M C;  5M5W K;  5M3M K;  3I4M C;  4OIQ A;  4QIW D;  2Y0S D;  5IYC K;  4MEX A;  3RZO C;  1TWG C;  2B63 K;  5D4D A;  4Y52 C;  4A3J K;  3CQZ C;  2NVT C;  5C4J K;  4A3B K;  4Q5S A;  1YNN A;  2Y0S L;  5IP9 C;  3PO2 C;  1I6H C;  3RZD C;  5IYD K;  5FLM C;  2NVQ C;  2B63 C;  4A3K C;  4XLP A;  4G7O A;  4BXX K;  5IYD C;  5C44 C;  2E2H K;  2JA6 C;  1TWC C;  4ZH4 A;  4AYB D;  3S1Q K;  1ZYR A;  3S14 K;  5C3E C;  4A3L C;  3S1R K;  3HOX C;  5IP7 K;  4LLG A;  2E2J K;  1BDF A;  4A3E C;  2YU9 C;  5M3F K;  2PPB A;  2JA8 K;  3GTO C;  4A3D C;  4JK1 A;  4KN4 A;  4A3M K;  3M3Y C;  4MEY A;  5M5Y K;  2O5I A;  4BBS K;  2PA8 D;  3HOV K;  3GTQ C;  2A6H A;  3HOY C;  4Y7N K;  1K83 C;  3H0G C;  1XPP A;  2CW0 A;  3HOZ C;  2PA8 L;  3S17 C;  4A93 C;  5C4X K;  3FKI C; 
#chains in the Genus database with same CATH topology
 4KAR A;  4QIW L;  1O28 A;  1WSR A;  4P9S A;  3S15 K;  2R93 K;  2R93 A;  4KAW X;  4KDD A;  3ORE A;  3S2D K;  4BLB A;  1IW7 A;  4X6A K;  3AH5 A;  1ZVU A;  4A3G C;  4XSZ A;  3S1Q C;  3S14 C;  4KN7 A;  3S1R C;  1F7U A;  2E2J C;  4KMD A;  3LAJ A;  3GTJ C;  4OIN A;  1F93 A;  4A3M C;  5CHP A;  1DCP A;  1TWH K;  2VUM C;  1TWH A;  2P8T A;  1O29 A;  3N0B A;  1BJT A;  5TMF A;  1I50 C;  3ADA C;  3AD9 C;  1EK8 A;  1USO A;  4A3F C;  1XZQ B;  3K7A C;  3GTG K;  1I6H K;  4GTA A;  2XCO A;  2NVY C;  1ZBS A;  3H3V D;  3Q3Q A;  4A3I K;  3FHZ A;  3S16 C;  1B4B A;  2W7V A;  4A3K K;  3L4K A;  2R92 C;  2BE5 A;  2CFA A;  5C44 K;  3T01 A;  1TWF K;  4LK0 A;  5M5X K;  5C3E K;  1O2B A;  3HOX K;  5JFE A;  1J6X A;  1Y1V C;  4G7H A;  3GIR A;  4C3I C;  2R7Z C;  4KMU A;  3PO3 C;  4LK1 A;  3M3Y K;  3G4C A;  3A8J A;  4XSX A;  3I4N K;  1O25 A;  1WIH A;  1L0W A;  2NVX C;  3GTP C;  4A93 K;  4GTL A;  2JA7 C;  3S1N C;  4G0U A;  3S1M C;  4QIW D;  4RMF A;  1WOS A;  4KMH A;  3RZO C;  3MML B;  4A3J K;  2Y0S L;  5IP9 C;  2XCR B;  1IS1 A;  5FLM C;  2B63 C;  1EH1 A;  4GTE A;  5IYD C;  2JA6 C;  1TWC C;  3NUH A;  1WQF A;  1XZP B;  4C3J C;  5IP7 K;  4FM9 A;  4A3E C;  1WOR A;  4C3H C;  5M3F K;  2YU9 C;  4JK1 A;  3A8I A;  3HOV K;  1HI9 A;  1K83 C;  3H0G C;  1XPP A;  1F7V A;  3HOZ C;  2PA8 L;  3S17 C;  2E2I K;  3GTK A;  4MQ9 A;  1R9T C;  3G4A A;  4GTC A;  3WOD A;  1VH2 A;  3FOE A;  2ZUE A;  4OIR A;  1YNJ A;  5C4J C;  4A3B C;  1Y1W K;  1Y1W A;  3GTL K;  4KB4 A;  1J98 A;  5IOQ A;  1XXA A;  4A3C K;  4BXX C;  4BY7 K;  4C2M K;  1JOE A;  1SFO A;  2V6T A;  3GTM A;  1O2A A;  2JA8 C;  4OIO A;  1X31 C;  1TWA K;  1WCM K;  1XXB A;  3FOF A;  1TWA A;  1WCM A;  4XLN A;  2PMZ D;  4WJ4 A;  4Q4Z A;  5L46 A;  3HOU K;  1WQG A;  1VLO A;  1BS2 A;  5TJ3 A;  3BP8 C;  1WOP A;  3M4O C;  4P5B A;  1TWG A;  4Y52 K;  4KM8 A;  1HQM A;  3CQZ K;  2NVT K;  3CQZ A;  2WB1 D;  1WQH A;  2NVQ K;  3EQL A;  4YG2 A;  3GTG C;  4OIP A;  5IYB C;  2A68 A;  4A3I C;  4A3L K;  4BBR C;  3CAG A;  4A3D K;  1TWF C;  2JA5 C;  3T02 A;  4BY1 K;  2ZUF A;  1EQR A;  1RU0 A;  3I4M K;  3HOW C;  1I3Q C;  3FKI K;  3FKI A;  3S2H C;  4DDQ A;  3I4N C;  5M5W K;  3SZY A;  4G0V A;  4GFQ A;  1YNN A;  3S0X A;  3PO2 C;  3RZD C;  2KWA A;  4ILD A;  1DCH A;  2GAH C;  4GTB A;  2V6S A;  5JVO A;  3GEI A;  3L4J A;  4ZH4 A;  3BUE A;  3S1Q K;  3S14 K;  3S1R K;  4LLG A;  2E2J K;  1BDF A;  1ISE A;  3GTO C;  3OEP A;  3GTJ A;  4KN4 A;  4A3M K;  1IL2 A;  4BBS K;  3BP3 A;  3GTQ C;  4KB2 A;  3HOY C;  2VUM K;  4PAA A;  2VUM A;  4GZY A;  5IYC C;  1I50 K;  1I50 A;  4A3F K;  3K7A K;  2E2I C;  2NVY A;  3S16 K;  2R92 K;  2R92 A;  5EGH A;  3OPF A;  2E2H C;  3GTL C;  1JQW A;  1PJ5 A;  3DXJ A;  4QJV A;  3JST A;  4GTD A;  1Y1V A;  4C3I K;  1XZQ A;  4KAT A;  2R7Z K;  2R7Z A;  4C2M C;  2GAG C;  1XXC A;  3GTK K;  5FJ8 K;  4Y7N C;  5IOT A;  2NVX K;  3GTP K;  2NVX A;  4YFX A;  3GTP A;  5C4X C;  2JA7 K;  3S1N K;  2V6U A;  2JA7 A;  1O24 A;  3S1M K;  4J3N A;  3TFH A;  2GSN A;  2P5M A;  3IPJ A;  3RZO K;  3S15 C;  2JH3 A;  2R93 C;  4BKW A;  5IP9 K;  1IBA A;  1SFO K;  3S2D C;  2FQT A;  5FLM K;  3AD8 C;  3GTM K;  2RGR A;  2B63 A;  1PJ7 A;  4X6A C;  3H3V L;  5IYD K;  2FQO A;  2A6E A;  4LJZ A;  1JVI A;  2JA6 K;  1TWC K;  2GSU A;  2JA6 A;  1TWC A;  2A69 A;  2ZFZ A;  4C3J K;  4C45 A;  4C3H K;  4A3E K;  1J6W A;  2YU9 K;  2YU9 A;  1VGX A;  3GSI A;  5HL8 A;  3HKZ L;  2WAQ L;  3SZZ A;  1F9N A;  4G7Z A;  1K83 K;  3H0G K;  1K83 A;  3HOZ K;  3H0G A;  1TWG K;  1TWH C;  3S17 K;  2CFA B;  4YFK A;  4BY1 C;  1R9T K;  1XZP A;  5M3M K;  1R9T A;  3VA7 A;  4OIQ A;  3I4M C;  2Y0S D;  4MEX A;  5C4J K;  4A3B K;  4Q5S A;  1I6H C;  4BLA A;  3QX3 A;  1WSV A;  3AD7 C;  4A3K C;  4XLP A;  4G7O A;  4BXX K;  5C44 C;  1INN A;  3GEE A;  5C3E C;  3HOX C;  1WOO A;  1EFW A;  2JA8 K;  1PJ6 A;  3M3Y C;  3N0C A;  4MEY A;  3A8K A;  5M5Y K;  3LAP A;  2PA8 D;  5EGE A;  2RH6 A;  1C0A A;  4A93 C;  4LR2 A;  4BBS C;  4P5A A;  4KMA A;  3HXA A;  4M1X A;  5IOS A;  1KQ4 A;  3M4O K;  4A3J C;  3TTG A;  4LOW A;  5TMC A;  4A3G K;  4QJV B;  2O5J A;  1VJE A;  1G51 A;  3GTG A;  4WIL A;  5IYB K;  3GTJ K;  4AYB L;  4YFN A;  1O2F B;  3TFJ A;  4BBR K;  2XCQ A;  5IP7 C;  3N3Y A;  1TWF A;  2JA5 K;  2JA5 A;  3HOV C;  4O2D A;  3HOW K;  1J6V A;  3HKZ D;  1I3Q K;  2WAQ D;  1SMY A;  4WJ3 M;  1I3Q A;  1O27 A;  4NOI A;  3S2H K;  3GTK C;  2NVY K;  1V5V A;  2PMZ L;  3AQP A;  3PO2 K;  1Y1W C;  2GSO A;  3RZD K;  3T00 A;  1Y1V K;  1YX2 A;  2WB1 L;  4A3C C;  3PO3 K;  4XCH A;  4BY7 C;  1SFO C;  3LPX A;  3GTM C;  1USM A;  3GTO K;  1I6V A;  4AH6 A;  3GTO A;  1ZQ1 C;  4GTF A;  5CJ9 A;  1VRQ C;  3GTQ K;  1BGW A;  3HOY K;  3GTQ A;  1UV7 A;  1B4A A;  1TWA C;  1WCM C;  4FZB A;  1DD5 A;  2Y3P A;  3GEH A;  1AB4 A;  3GDZ A;  4G0W A;  1O26 A;  3HOU C;  1EI6 A;  3AQO A;  2PHC B;  4KC6 A;  5IYC K;  2EBB A;  1TWG C;  2B63 K;  1YCL A;  5D4D A;  4Y52 C;  1GE9 A;  3CQZ C;  2NVT C;  5E68 A;  2E2I A;  1IQ0 A;  2NVQ C;  4LQY A;  4PAB A;  2E2H K;  4GT9 A;  2E2H A;  4AYB D;  3GTL A;  1ZYR A;  4A3L C;  1DCO A;  2PPB A;  1IE0 A;  4A3D C;  5IOR A;  2D6F C;  2O5I A;  3ERE D;  2A6H A;  4KM9 A;  3TFI A;  4Y7N K;  2CW0 A;  1ZXO A;  3V4G A;  5C4X K;  3FKI C;  4KAS A; 
#chains in the Genus database with same CATH homology
 4BBS C;  4QIW L;  2E2I K;  4MQ9 A;  1R9T C;  4GZY A;  3S15 K;  5IYC C;  3M4O K;  1I50 K;  2R93 K;  3WOD A;  4A3F K;  3K7A K;  4A3J C;  4OIR A;  1YNJ A;  5TMC A;  5C4J C;  1Y1W K;  2E2I C;  4A3B C;  4A3G K;  4QJV B;  3S2D K;  3GTL K;  3S16 K;  2R92 K;  1IW7 A;  2O5J A;  4A3C K;  4BXX C;  4X6A K;  4BY7 K;  5IYB K;  3GTJ K;  4AYB L;  4C2M K;  4A3G C;  2E2H C;  4YFN A;  3GTL C;  3DXJ A;  4QJV A;  4XSZ A;  3S1Q C;  4BBR K;  3S14 C;  4KN7 A;  3S1R C;  5IP7 C;  2E2J C;  4C3I K;  2R7Z K;  3GTJ C;  2JA8 C;  4OIN A;  4OIO A;  4A3M C;  2JA5 K;  3GTK K;  3HOV C;  5FJ8 K;  1TWA K;  1WCM K;  4Y7N C;  3HOW K;  2NVX K;  3HKZ D;  1I3Q K;  1TWH K;  1SMY A;  2WAQ D;  4YFX A;  4XLN A;  2VUM C;  2PMZ D;  3GTP K;  4NOI A;  4Q4Z A;  5C4X C;  3HOU K;  3S2H K;  2JA7 K;  3S1N K;  3GTK C;  3S1M K;  2NVY K;  2PMZ L;  3S15 C;  3RZO K;  5TMF A;  1I50 C;  3M4O C;  2R93 C;  3GTG K;  4A3F C;  4Y52 K;  1HQM A;  3CQZ K;  3K7A C;  2NVT K;  1I6H K;  5IP9 K;  3PO2 K;  1Y1W C;  2WB1 D;  3RZD K;  2NVY C;  1SFO K;  3H3V D;  3S2D C;  5FLM K;  4A3I K;  3S16 C;  2NVQ K;  3GTM K;  2R92 C;  3EQL A;  4A3K K;  4YG2 A;  3GTG C;  4OIP A;  2BE5 A;  1Y1V K;  2WB1 L;  2VUM K;  4A3C C;  4X6A C;  3H3V L;  3PO3 K;  5IYB C;  5C44 K;  2A6E A;  4BY7 C;  2A68 A;  4LJZ A;  1TWF K;  2JA6 K;  1TWC K;  4LK0 A;  1SFO C;  4A3I C;  2A69 A;  5M5X K;  3GTM C;  4A3L K;  4BBR C;  5C3E K;  4C3J K;  3HOX K;  4G7H A;  1Y1V C;  4A3E K;  4C3H K;  2YU9 K;  1I6V A;  4KMU A;  2R7Z C;  3GTO K;  3PO3 C;  4A3D K;  1TWF C;  4LK1 A;  3M3Y K;  2JA5 C;  4XSX A;  4BY1 K;  3GTQ K;  3I4N K;  3HOY K;  3HKZ L;  2WAQ L;  4G7Z A;  3I4M K;  1K83 K;  1TWA C;  1WCM C;  3H0G K;  3HOW C;  2NVX C;  3HOZ K;  1TWG K;  1I3Q C;  1TWH C;  3GTP C;  3S17 K;  4A93 K;  3FKI K;  3HOU C;  3S2H C;  2JA7 C;  4YFK A;  4BY1 C;  3S1N C;  3I4N C;  1R9T K;  3S1M C;  5M5W K;  5M3M K;  3I4M C;  4OIQ A;  4QIW D;  2Y0S D;  5IYC K;  4MEX A;  3RZO C;  1TWG C;  2B63 K;  5D4D A;  4Y52 C;  4A3J K;  3CQZ C;  2NVT C;  5C4J K;  4A3B K;  4Q5S A;  1YNN A;  2Y0S L;  5IP9 C;  3PO2 C;  1I6H C;  3RZD C;  5IYD K;  5FLM C;  2NVQ C;  2B63 C;  4A3K C;  4XLP A;  4G7O A;  4BXX K;  5IYD C;  5C44 C;  2E2H K;  2JA6 C;  1TWC C;  4ZH4 A;  4AYB D;  3S1Q K;  1ZYR A;  3S14 K;  5C3E C;  4A3L C;  3S1R K;  3HOX C;  5IP7 K;  4LLG A;  2E2J K;  1BDF A;  4A3E C;  2YU9 C;  5M3F K;  2PPB A;  2JA8 K;  3GTO C;  4A3D C;  4JK1 A;  4KN4 A;  4A3M K;  3M3Y C;  4MEY A;  5M5Y K;  2O5I A;  4BBS K;  2PA8 D;  3HOV K;  3GTQ C;  2A6H A;  3HOY C;  4Y7N K;  1K83 C;  3H0G C;  1XPP A;  2CW0 A;  3HOZ C;  2PA8 L;  3S17 C;  4A93 C;  5C4X K;  3FKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...