1TWFK

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twfK00
1I3QK 3PO2C 5IYDK 3GTKK 4LK0A 2E2JK 3S1MK 4A3BK 4G7OA 5C4XC 2CW0A 4AYBD 4C3JK 5M3MK 2B63C 2NVXK 4ZH4A 2NVQC 3S2HK 4A3JK 3S1QK 2VUMK 4A93K 1TWGC 3RZOK 3K7AK 3M4OC 3HOUC 3GTQC 4A3IK 4A3GC 3I4NC 2JA5C 3M3YK 1I50C 3H0GK 2PA8D 3HKZD 4LJZA 2WAQD 4C3IK 5TMCA 1SFOC 1WCMK 1R9TK 3GTPK 3I4MC 4A3CC 1K83K 2R92K 1YNJA 2R7ZK 1TWAK 4YFKA 3HOXC 3EQLA 4XLNA 3FKIK 2R93C 1TWHK 4LK1A 4OINA 3HOZK 3HOVK 5M3FK 5C44K 3S1RK 5IYCK 5C4JK 4A3KC 2A6HA 3GTJK 2A6EA 2WB1D 4KMUA 4JK1A 3GTLK 4BBRK 4Y7NK 4BXXC 1I6HK 3PO3C 2WB1L 4LLGA 1Y1WC 2PMZD 1TWCK 3GTMK 3HOWK 2PMZL 5M5XK 1I3QC 5IYDC 2PPBA 3GTKC 1Y1VK 1I6VA 4YFXA 5FLMK 2E2JC 3S16K 4A3BC 3S2HC 3S1MC 3HOYK 3S1QC 2NVXC 4X6AK 2JA8K 4A3JC 2VUMC 4A93C 5IP9K 5D4DA 3GTOK 3RZOC 3K7AC 3S15K 4A3LK 4A3IC 4MEYA 3RZDK 1IW7A 5M5WK 4Y52K 5C3EK 3M3YC 3CQZK 3H0GC 1BDFA 4A3FK 4Q4ZA 3S14K 5IYBK 2JA6K 4OIQA 5IP7K 1WCMC 1R9TC 3GTPC 2O5IA 2BE5A 1K83C 2JA7K 2R7ZC 1TWAC 1SMYA 2R92C 3GTGK 4A3EK 4OIOA 2NVTK 3FKIC 2O5JA 1TWHC 3DXJA 3HOZC 3HOVC 5C44C 3S1RC 2E2IK 5IYCC 5C4JC 4A3DK 2NVYK 4MEXA 1TWFK 3GTJC 2YU9K 4GZYA 3GTLC 2E2HK 3S1NK 4BBRC 4Y7NC 4BY1K 4MQ9A 1I6HC 3S17K 2R93K 3S2DK 5FJ8K 1TWCC 4XSXA 3GTMC 4BBSK 3HOWC 4QIWD 4A3MK 4QIWL 2Y0SL 3PO2K 1Y1VC 4XSZA 1XPPA 3S16C 5FLMC 4BY7C 5C4XK 2B63K 3HOYC 4X6AC 4QJVB 4OIPA 2JA8C 2NVQK 5IP9C 3GTOC 4G7HA 1TWGK 3S15C 4A3LC 4QJVA 3HOUK 3M4OK 4YFNA 3GTQK 3RZDC 4A3GK 4C2MK 4Y52C 5C3EC 2JA5K 3CQZC 3I4NK 1I50K 3WODA 4AYBL 4A3FC 3S14C 4XLPA 5IYBC 1SFOK 2JA6C 5TMFA 5IP7C 3H3VD 4A3CK 4YG2A 5M5YK 4G7ZA 2JA7C 1YNNA 3GTGC 3I4MK 3H3VL 3HOXK 4NOIA 4BY7K 4A3EC 4OIRA 2NVTC 2PA8L 3HKZL 2A68A 2WAQL 2A69A 4C3HK 4A3DC 2E2IC 2NVYC 4A3KK 4Q5SA 2Y0SD 1TWFC 2YU9C 2E2HC 3S1NC 4BY1C 1ZYRA 4BXXK 3S17C 3PO3K 4KN4A 1HQMA 4KN7A 3S2DC 1Y1WK 4BBSC 4A3MC
chains in the Genus database with same CATH superfamily
1I3QK 5IYDK 4LK0A 2E2JK 2CW0A 4AYBD 4C3JK 3CAGA 2VUMK 1TWGC 3K7AK 2P5MA 3M4OC 3GTQC 3MMLB 3M3YK 4PABA 3SZYA 4FZBA 3BP3A 3S0XA 3EQLA 2RH6A 1IL2A 3BP8C 4OINA 3Q3QA 4C3HC 3HOVK 5C44K 5IYCK 1VGXA 5C4JK 3AQPA 2A6HA 4WILA 4BBRK 1WQFA 2ZUFA 4LLGA 4KM9A 2PMZD 4G0WA 3A8JA 1EQRA 2PHCB 3N3YA 5FLMK 3S1QC 2NVXC 4A3JC 4A93C 5IP9K 4KAWX 3RZOC 3S15K 3A8KA 4GTFA 3RZDK 5JVOA 1O26A 4KMDA 1ZQ1C 2D6FC 3S14K 4C3IC 4Q4ZA 2GSOA 3N0BA 3GTPC 3BUEA 2BE5A 4P5AA 2R92C 1VRQC 1TWAC 1SMYA 2R7ZC 4G0UA 4C45A 3FKIC 1TWHC 3DXJA 2E2IK 1I6HC 4XSXA 1F9NA 4AH6A 2B63A 4KASA 1O24A 4KMHA 4A3MK 4QIWL 4BY7C 2B63K 3HOYC 1BS2A 2JA8C 2NVQK 4FM9A 3GTOC 4C2MK 4Y52C 3I4NK 2NVYA 2JA5K 4AYBL 5IOTA 4XLPA 3LAPA 5IYBC 2JA6C 3LPXA 5TMFA 1F93A 1IE0A 4YG2A 5M5YK 3I4MK 4A3CK 3GTGC 4NOIA 4OIRA 2NVTC 1PJ5A 4PAAA 1EI6A 1Y1WA 4A3KK 3V4GA 2Y0SD 1TWFC 2YU9C 1ZBSA 1J6VA 2E2HC 3S1NC 4BXXK 3OREA 3PO3K 4KN7A 1Y1WK 1C0AA 4BBSC 3FOEA 2FQTA 5CHPA 1PJ7A 3S1MK 4A3BK 5C4XC 5M3MK 3S2HK 1WOOA 4GTBA 3H0GA 1UV7A 3HOUC 1XXCA 4A3IK 1USMA 4A3GC 1R9TA 3TFJA 1K83A 1I50C 3H0GK 4LJZA 2WAQD 4M1XA 1V5VA 1R9TK 2Y3PA 1K83K 4YFKA 3GTJA 4XLNA 4KATA 1I3QA 2KWAA 5HL8A 3AD7C 3S1RK 3GTJK 3GTMA 4KMUA 3GTLK 1XXBA 4JK1A 4Y7NK 2WB1L 1Y1VA 1ISEA 1XZQA 1TWCK 4GTDA 3GTMK 3HOWK 3N0CA 2CFAB 4WJ3M 3GTKC 1Y1VK 1F7UA 4YFXA 3S16K 4X6AK 3NUHA 5E68A 4KB2A 2P8TA 4MEYA 5C3EK 3CQZK 1WOPA 4RMFA 1WCMC 2JA7K 4KDDA 1XZQB 3TFHA 1O2BA 3HOZC 1AB4A 4MEXA 3GEEA 1O2FB 2ZUEA 4MQ9A 3S17K 1O28A 3S2DK 5FJ8K 1DCPA 1HI9A 4GTLA 2GAHC 2Y0SL 1TWGA 1EK8A 4G7HA 1TWGK 4A3LC 3M4OK 4BKWA 3AD9C 4YFNA 3GTQK 2E2IA 1YX2A 3WODA 4A3FC 5EGHA 5IP7C 3H3VD 4G7ZA 4A3EC 2GSNA 1BJTA 2A68A 2WAQL 4C3HK 4A3DC 2NVYC 5JFEA 4BY1C 1ZYRA 1WORA 4KN4A 2GAGC 3AQOA 4ILDA 2NVXA 2JA5A 3PO2C 1XXAA 1KQ4A 3S1QK 2NVXK 4WJ4A 4A3JK 4A93K 3G4AA 3RZOK 1L0WA 4GTAA 2R7ZA 1TWAA 3HKZD 4C3IK 5TMCA 1SFOC 5L46A 3FKIA 1TWHA 3GTPK 2R92K 1YNJA 2R7ZK 1TWAK 3T02A 3HOXC 1WOSA 3FKIK 2R93C 1TWHK 4LK1A 1I6HK 2PMZL 1I3QC 5IYDC 1EFWA 2PPBA 3T01A 2E2JC 1ZVUA 4BY7K 4C3JC 2CFAA 3HOYK 2JA8K 2VUMC 1IQ0A 2EBBA 2JH3A 3GTOK 3K7AC 4GTCA 1VLOA 3ADAC 3QX3A 1B4BA 2JA6A 1IW7A 4P9SA 5M5WK 4Y52K 3M3YC 3GTGA 3GTLA 5IYBK 2JA6K 3GTGK 1TWCA 4KC6A 1ZXOA 3A8IA 1TWFA 2YU9A 2XCRB 4OIOA 2NVTK 2E2HA 3HOVC 5C44C 4XCHA 5IYCC 5C4JC 1TWFK 3GSIA 2V6UA 4LQYA 2YU9K 2E2HK 3S1NK 4BBRC 1JVIA 2V6TA 2R93K 4BBSK 1B4AA 4QIWD 1XZPB 3CQZA 4GFQA 4LOWA 5IOQA 5FLMC 5C4XK 2JA7A 4QJVB 2XCOA 4OIPA 3L4JA 3GDZA 5IP9C 3S15C 4J3NA 3HOUK 3RZDC 4A3GK 2ZFZA 1I50K 3S14C 1X31C 1WQHA 2W7VA 3HKZL 1WSRA 1O2AA 2E2IC 4DDQA 4Q5SA 1BGWA 1USOA 3GTKA 3GTQA 3GIRA 2GSUA 1INNA 1J6XA 4A3MC 3GTKK 3AD8C 4G7OA 3IPJA 2B63C 4ZH4A 2NVQC 3AH5A 1JQWA 1WCMA 4C2MC 3I4NC 2JA5C 3FOFA 2PA8D 1DCHA 1J6WA 1WCMK 3I4MC 4G0VA 4A3CC 3SZZA 1IS1A 3GEHA 3HOZK 5M3FK 3OEPA 4A3KC 2A6EA 1O25A 2WB1D 4BXXC 3PO3C 1DCOA 1Y1WC 5M5XK 3TFIA 1YCLA 4O2DA 1I6VA 1J98A 4A3BC 3S1MC 3GTPA 3S2HC 1PJ6A 2R92A 4BLAA 5D4DA 4A3LK 1VJEA 4A3IC 1WSVA 4GT9A 1GE9A 1IBAA 3H0GC 1BDFA 4A3FK 5EGEA 4OIQA 2FQOA 5IP7K 1R9TC 1DD5A 2O5IA 1K83C 1WIHA 3FHZA 4A3EK 2O5JA 3L4KA 4KM8A 1F7VA 3S1RC 4A3DK 3G4CA 2XCQA 2NVYK 3GTJC 4LR2A 4GZYA 1RU0A 3ERED 3GTLC 4BY1K 4Y7NC 3GTOA 3JSTA 4GTEA 3TTGA 1TWCC 3GTMC 3HOWC 1WQGA 3PO2K 1Y1VC 4XSZA 1XPPA 3S16C 1XZPA 5TJ3A 4X6AC 3GEIA 4BLBA 1VH2A 1JOEA 4QJVA 1SFOA 2RGRA 5C3EC 3CQZC 1O29A 4KB4A 1EH1A 1SFOK 4P5BA 2R93A 2JA7C 1YNNA 3LAJA 3H3VL 3HOXK 5IOSA 2PA8L 2A69A 1O27A 3HXAA 4KARA 3T00A 3VA7A 3S17C 5IORA 1HQMA 3OPFA 3S2DC 4KMAA 5CJ9A 1G51A 2V6SA 1I50A 2VUMA
chains in the Genus database with same CATH topology
1I3QK 3PO2C 5IYDK 3GTKK 4LK0A 2E2JK 3S1MK 4A3BK 4G7OA 5C4XC 2CW0A 4AYBD 4C3JK 5M3MK 2B63C 2NVXK 4ZH4A 2NVQC 3S2HK 4A3JK 3S1QK 2VUMK 4A93K 1TWGC 3RZOK 3K7AK 3M4OC 3HOUC 3GTQC 4A3IK 4A3GC 3I4NC 2JA5C 3M3YK 1I50C 3H0GK 2PA8D 3HKZD 4LJZA 2WAQD 4C3IK 5TMCA 1SFOC 1WCMK 1R9TK 3GTPK 3I4MC 4A3CC 1K83K 2R92K 1YNJA 2R7ZK 1TWAK 4YFKA 3HOXC 3EQLA 4XLNA 3FKIK 2R93C 1TWHK 4LK1A 4OINA 3HOZK 3HOVK 5M3FK 5C44K 3S1RK 5IYCK 5C4JK 4A3KC 2A6HA 3GTJK 2A6EA 2WB1D 4KMUA 4JK1A 3GTLK 4BBRK 4Y7NK 4BXXC 1I6HK 3PO3C 2WB1L 4LLGA 1Y1WC 2PMZD 1TWCK 3GTMK 3HOWK 2PMZL 5M5XK 1I3QC 5IYDC 2PPBA 3GTKC 1Y1VK 1I6VA 4YFXA 5FLMK 2E2JC 3S16K 4A3BC 3S2HC 3S1MC 3HOYK 3S1QC 2NVXC 4X6AK 2JA8K 4A3JC 2VUMC 4A93C 5IP9K 5D4DA 3GTOK 3RZOC 3K7AC 3S15K 4A3LK 4A3IC 4MEYA 3RZDK 1IW7A 5M5WK 4Y52K 5C3EK 3M3YC 3CQZK 3H0GC 1BDFA 4A3FK 4Q4ZA 3S14K 5IYBK 2JA6K 4OIQA 5IP7K 1WCMC 1R9TC 3GTPC 2O5IA 2BE5A 1K83C 2JA7K 2R7ZC 1TWAC 1SMYA 2R92C 3GTGK 4A3EK 4OIOA 2NVTK 3FKIC 2O5JA 1TWHC 3DXJA 3HOZC 3HOVC 5C44C 3S1RC 2E2IK 5IYCC 5C4JC 4A3DK 2NVYK 4MEXA 1TWFK 3GTJC 2YU9K 4GZYA 3GTLC 2E2HK 3S1NK 4BBRC 4Y7NC 4BY1K 4MQ9A 1I6HC 3S17K 2R93K 3S2DK 5FJ8K 1TWCC 4XSXA 3GTMC 4BBSK 3HOWC 4QIWD 4A3MK 4QIWL 2Y0SL 3PO2K 1Y1VC 4XSZA 1XPPA 3S16C 5FLMC 4BY7C 5C4XK 2B63K 3HOYC 4X6AC 4QJVB 4OIPA 2JA8C 2NVQK 5IP9C 3GTOC 4G7HA 1TWGK 3S15C 4A3LC 4QJVA 3HOUK 3M4OK 4YFNA 3GTQK 3RZDC 4A3GK 4C2MK 4Y52C 5C3EC 2JA5K 3CQZC 3I4NK 1I50K 3WODA 4AYBL 4A3FC 3S14C 4XLPA 5IYBC 1SFOK 2JA6C 5TMFA 5IP7C 3H3VD 4A3CK 4YG2A 5M5YK 4G7ZA 2JA7C 1YNNA 3GTGC 3I4MK 3H3VL 3HOXK 4NOIA 4BY7K 4A3EC 4OIRA 2NVTC 2PA8L 3HKZL 2A68A 2WAQL 2A69A 4C3HK 4A3DC 2E2IC 2NVYC 4A3KK 4Q5SA 2Y0SD 1TWFC 2YU9C 2E2HC 3S1NC 4BY1C 1ZYRA 4BXXK 3S17C 3PO3K 4KN4A 1HQMA 4KN7A 3S2DC 1Y1WK 4BBSC 4A3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q K;  3PO2 C;  5IYD K;  3GTK K;  4LK0 A;  2E2J K;  3S1M K;  4A3B K;  4G7O A;  5C4X C;  2CW0 A;  4AYB D;  4C3J K;  5M3M K;  2B63 C;  2NVX K;  4ZH4 A;  2NVQ C;  3S2H K;  4A3J K;  3S1Q K;  2VUM K;  4A93 K;  1TWG C;  3RZO K;  3K7A K;  3M4O C;  3HOU C;  3GTQ C;  4A3I K;  4A3G C;  3I4N C;  2JA5 C;  3M3Y K;  1I50 C;  3H0G K;  2PA8 D;  3HKZ D;  4LJZ A;  2WAQ D;  4C3I K;  5TMC A;  1SFO C;  1WCM K;  1R9T K;  3GTP K;  3I4M C;  4A3C C;  1K83 K;  2R92 K;  1YNJ A;  2R7Z K;  1TWA K;  4YFK A;  3HOX C;  3EQL A;  4XLN A;  3FKI K;  2R93 C;  1TWH K;  4LK1 A;  4OIN A;  3HOZ K;  3HOV K;  5M3F K;  5C44 K;  3S1R K;  5IYC K;  5C4J K;  4A3K C;  2A6H A;  3GTJ K;  2A6E A;  2WB1 D;  4KMU A;  4JK1 A;  3GTL K;  4BBR K;  4Y7N K;  4BXX C;  1I6H K;  3PO3 C;  2WB1 L;  4LLG A;  1Y1W C;  2PMZ D;  1TWC K;  3GTM K;  3HOW K;  2PMZ L;  5M5X K;  1I3Q C;  5IYD C;  2PPB A;  3GTK C;  1Y1V K;  1I6V A;  4YFX A;  5FLM K;  2E2J C;  3S16 K;  4A3B C;  3S2H C;  3S1M C;  3HOY K;  3S1Q C;  2NVX C;  4X6A K;  2JA8 K;  4A3J C;  2VUM C;  4A93 C;  5IP9 K;  5D4D A;  3GTO K;  3RZO C;  3K7A C;  3S15 K;  4A3L K;  4A3I C;  4MEY A;  3RZD K;  1IW7 A;  5M5W K;  4Y52 K;  5C3E K;  3M3Y C;  3CQZ K;  3H0G C;  1BDF A;  4A3F K;  4Q4Z A;  3S14 K;  5IYB K;  2JA6 K;  4OIQ A;  5IP7 K;  1WCM C;  1R9T C;  3GTP C;  2O5I A;  2BE5 A;  1K83 C;  2JA7 K;  2R7Z C;  1TWA C;  1SMY A;  2R92 C;  3GTG K;  4A3E K;  4OIO A;  2NVT K;  3FKI C;  2O5J A;  1TWH C;  3DXJ A;  3HOZ C;  3HOV C;  5C44 C;  3S1R C;  2E2I K;  5IYC C;  5C4J C;  4A3D K;  2NVY K;  4MEX A;  1TWF K;  3GTJ C;  2YU9 K;  4GZY A;  3GTL C;  2E2H K;  3S1N K;  4BBR C;  4Y7N C;  4BY1 K;  4MQ9 A;  1I6H C;  3S17 K;  2R93 K;  3S2D K;  5FJ8 K;  1TWC C;  4XSX A;  3GTM C;  4BBS K;  3HOW C;  4QIW D;  4A3M K;  4QIW L;  2Y0S L;  3PO2 K;  1Y1V C;  4XSZ A;  1XPP A;  3S16 C;  5FLM C;  4BY7 C;  5C4X K;  2B63 K;  3HOY C;  4X6A C;  4QJV B;  4OIP A;  2JA8 C;  2NVQ K;  5IP9 C;  3GTO C;  4G7H A;  1TWG K;  3S15 C;  4A3L C;  4QJV A;  3HOU K;  3M4O K;  4YFN A;  3GTQ K;  3RZD C;  4A3G K;  4C2M K;  4Y52 C;  5C3E C;  2JA5 K;  3CQZ C;  3I4N K;  1I50 K;  3WOD A;  4AYB L;  4A3F C;  3S14 C;  4XLP A;  5IYB C;  1SFO K;  2JA6 C;  5TMF A;  5IP7 C;  3H3V D;  4A3C K;  4YG2 A;  5M5Y K;  4G7Z A;  2JA7 C;  1YNN A;  3GTG C;  3I4M K;  3H3V L;  3HOX K;  4NOI A;  4BY7 K;  4A3E C;  4OIR A;  2NVT C;  2PA8 L;  3HKZ L;  2A68 A;  2WAQ L;  2A69 A;  4C3H K;  4A3D C;  2E2I C;  2NVY C;  4A3K K;  4Q5S A;  2Y0S D;  1TWF C;  2YU9 C;  2E2H C;  3S1N C;  4BY1 C;  1ZYR A;  4BXX K;  3S17 C;  3PO3 K;  4KN4 A;  1HQM A;  4KN7 A;  3S2D C;  1Y1W K;  4BBS C;  4A3M C; 
#chains in the Genus database with same CATH topology
 1I3Q K;  5IYD K;  4LK0 A;  2E2J K;  2CW0 A;  4AYB D;  4C3J K;  3CAG A;  2VUM K;  1TWG C;  3K7A K;  2P5M A;  3M4O C;  3GTQ C;  3MML B;  3M3Y K;  4PAB A;  3SZY A;  4FZB A;  3BP3 A;  3S0X A;  3EQL A;  2RH6 A;  1IL2 A;  3BP8 C;  4OIN A;  3Q3Q A;  4C3H C;  3HOV K;  5C44 K;  5IYC K;  1VGX A;  5C4J K;  3AQP A;  2A6H A;  4WIL A;  4BBR K;  1WQF A;  2ZUF A;  4LLG A;  4KM9 A;  2PMZ D;  4G0W A;  3A8J A;  1EQR A;  2PHC B;  3N3Y A;  5FLM K;  3S1Q C;  2NVX C;  4A3J C;  4A93 C;  5IP9 K;  4KAW X;  3RZO C;  3S15 K;  3A8K A;  4GTF A;  3RZD K;  5JVO A;  1O26 A;  4KMD A;  1ZQ1 C;  2D6F C;  3S14 K;  4C3I C;  4Q4Z A;  2GSO A;  3N0B A;  3GTP C;  3BUE A;  2BE5 A;  4P5A A;  2R92 C;  1VRQ C;  1TWA C;  1SMY A;  2R7Z C;  4G0U A;  4C45 A;  3FKI C;  1TWH C;  3DXJ A;  2E2I K;  1I6H C;  4XSX A;  1F9N A;  4AH6 A;  2B63 A;  4KAS A;  1O24 A;  4KMH A;  4A3M K;  4QIW L;  4BY7 C;  2B63 K;  3HOY C;  1BS2 A;  2JA8 C;  2NVQ K;  4FM9 A;  3GTO C;  4C2M K;  4Y52 C;  3I4N K;  2NVY A;  2JA5 K;  4AYB L;  5IOT A;  4XLP A;  3LAP A;  5IYB C;  2JA6 C;  3LPX A;  5TMF A;  1F93 A;  1IE0 A;  4YG2 A;  5M5Y K;  3I4M K;  4A3C K;  3GTG C;  4NOI A;  4OIR A;  2NVT C;  1PJ5 A;  4PAA A;  1EI6 A;  1Y1W A;  4A3K K;  3V4G A;  2Y0S D;  1TWF C;  2YU9 C;  1ZBS A;  1J6V A;  2E2H C;  3S1N C;  4BXX K;  3ORE A;  3PO3 K;  4KN7 A;  1Y1W K;  1C0A A;  4BBS C;  3FOE A;  2FQT A;  5CHP A;  1PJ7 A;  3S1M K;  4A3B K;  5C4X C;  5M3M K;  3S2H K;  1WOO A;  4GTB A;  3H0G A;  1UV7 A;  3HOU C;  1XXC A;  4A3I K;  1USM A;  4A3G C;  1R9T A;  3TFJ A;  1K83 A;  1I50 C;  3H0G K;  4LJZ A;  2WAQ D;  4M1X A;  1V5V A;  1R9T K;  2Y3P A;  1K83 K;  4YFK A;  3GTJ A;  4XLN A;  4KAT A;  1I3Q A;  2KWA A;  5HL8 A;  3AD7 C;  3S1R K;  3GTJ K;  3GTM A;  4KMU A;  3GTL K;  1XXB A;  4JK1 A;  4Y7N K;  2WB1 L;  1Y1V A;  1ISE A;  1XZQ A;  1TWC K;  4GTD A;  3GTM K;  3HOW K;  3N0C A;  2CFA B;  4WJ3 M;  3GTK C;  1Y1V K;  1F7U A;  4YFX A;  3S16 K;  4X6A K;  3NUH A;  5E68 A;  4KB2 A;  2P8T A;  4MEY A;  5C3E K;  3CQZ K;  1WOP A;  4RMF A;  1WCM C;  2JA7 K;  4KDD A;  1XZQ B;  3TFH A;  1O2B A;  3HOZ C;  1AB4 A;  4MEX A;  3GEE A;  1O2F B;  2ZUE A;  4MQ9 A;  3S17 K;  1O28 A;  3S2D K;  5FJ8 K;  1DCP A;  1HI9 A;  4GTL A;  2GAH C;  2Y0S L;  1TWG A;  1EK8 A;  4G7H A;  1TWG K;  4A3L C;  3M4O K;  4BKW A;  3AD9 C;  4YFN A;  3GTQ K;  2E2I A;  1YX2 A;  3WOD A;  4A3F C;  5EGH A;  5IP7 C;  3H3V D;  4G7Z A;  4A3E C;  2GSN A;  1BJT A;  2A68 A;  2WAQ L;  4C3H K;  4A3D C;  2NVY C;  5JFE A;  4BY1 C;  1ZYR A;  1WOR A;  4KN4 A;  2GAG C;  3AQO A;  4ILD A;  2NVX A;  2JA5 A;  3PO2 C;  1XXA A;  1KQ4 A;  3S1Q K;  2NVX K;  4WJ4 A;  4A3J K;  4A93 K;  3G4A A;  3RZO K;  1L0W A;  4GTA A;  2R7Z A;  1TWA A;  3HKZ D;  4C3I K;  5TMC A;  1SFO C;  5L46 A;  3FKI A;  1TWH A;  3GTP K;  2R92 K;  1YNJ A;  2R7Z K;  1TWA K;  3T02 A;  3HOX C;  1WOS A;  3FKI K;  2R93 C;  1TWH K;  4LK1 A;  1I6H K;  2PMZ L;  1I3Q C;  5IYD C;  1EFW A;  2PPB A;  3T01 A;  2E2J C;  1ZVU A;  4BY7 K;  4C3J C;  2CFA A;  3HOY K;  2JA8 K;  2VUM C;  1IQ0 A;  2EBB A;  2JH3 A;  3GTO K;  3K7A C;  4GTC A;  1VLO A;  3ADA C;  3QX3 A;  1B4B A;  2JA6 A;  1IW7 A;  4P9S A;  5M5W K;  4Y52 K;  3M3Y C;  3GTG A;  3GTL A;  5IYB K;  2JA6 K;  3GTG K;  1TWC A;  4KC6 A;  1ZXO A;  3A8I A;  1TWF A;  2YU9 A;  2XCR B;  4OIO A;  2NVT K;  2E2H A;  3HOV C;  5C44 C;  4XCH A;  5IYC C;  5C4J C;  1TWF K;  3GSI A;  2V6U A;  4LQY A;  2YU9 K;  2E2H K;  3S1N K;  4BBR C;  1JVI A;  2V6T A;  2R93 K;  4BBS K;  1B4A A;  4QIW D;  1XZP B;  3CQZ A;  4GFQ A;  4LOW A;  5IOQ A;  5FLM C;  5C4X K;  2JA7 A;  4QJV B;  2XCO A;  4OIP A;  3L4J A;  3GDZ A;  5IP9 C;  3S15 C;  4J3N A;  3HOU K;  3RZD C;  4A3G K;  2ZFZ A;  1I50 K;  3S14 C;  1X31 C;  1WQH A;  2W7V A;  3HKZ L;  1WSR A;  1O2A A;  2E2I C;  4DDQ A;  4Q5S A;  1BGW A;  1USO A;  3GTK A;  3GTQ A;  3GIR A;  2GSU A;  1INN A;  1J6X A;  4A3M C;  3GTK K;  3AD8 C;  4G7O A;  3IPJ A;  2B63 C;  4ZH4 A;  2NVQ C;  3AH5 A;  1JQW A;  1WCM A;  4C2M C;  3I4N C;  2JA5 C;  3FOF A;  2PA8 D;  1DCH A;  1J6W A;  1WCM K;  3I4M C;  4G0V A;  4A3C C;  3SZZ A;  1IS1 A;  3GEH A;  3HOZ K;  5M3F K;  3OEP A;  4A3K C;  2A6E A;  1O25 A;  2WB1 D;  4BXX C;  3PO3 C;  1DCO A;  1Y1W C;  5M5X K;  3TFI A;  1YCL A;  4O2D A;  1I6V A;  1J98 A;  4A3B C;  3S1M C;  3GTP A;  3S2H C;  1PJ6 A;  2R92 A;  4BLA A;  5D4D A;  4A3L K;  1VJE A;  4A3I C;  1WSV A;  4GT9 A;  1GE9 A;  1IBA A;  3H0G C;  1BDF A;  4A3F K;  5EGE A;  4OIQ A;  2FQO A;  5IP7 K;  1R9T C;  1DD5 A;  2O5I A;  1K83 C;  1WIH A;  3FHZ A;  4A3E K;  2O5J A;  3L4K A;  4KM8 A;  1F7V A;  3S1R C;  4A3D K;  3G4C A;  2XCQ A;  2NVY K;  3GTJ C;  4LR2 A;  4GZY A;  1RU0 A;  3ERE D;  3GTL C;  4BY1 K;  4Y7N C;  3GTO A;  3JST A;  4GTE A;  3TTG A;  1TWC C;  3GTM C;  3HOW C;  1WQG A;  3PO2 K;  1Y1V C;  4XSZ A;  1XPP A;  3S16 C;  1XZP A;  5TJ3 A;  4X6A C;  3GEI A;  4BLB A;  1VH2 A;  1JOE A;  4QJV A;  1SFO A;  2RGR A;  5C3E C;  3CQZ C;  1O29 A;  4KB4 A;  1EH1 A;  1SFO K;  4P5B A;  2R93 A;  2JA7 C;  1YNN A;  3LAJ A;  3H3V L;  3HOX K;  5IOS A;  2PA8 L;  2A69 A;  1O27 A;  3HXA A;  4KAR A;  3T00 A;  3VA7 A;  3S17 C;  5IOR A;  1HQM A;  3OPF A;  3S2D C;  4KMA A;  5CJ9 A;  1G51 A;  2V6S A;  1I50 A;  2VUM A; 
#chains in the Genus database with same CATH homology
 1I3Q K;  3PO2 C;  5IYD K;  3GTK K;  4LK0 A;  2E2J K;  3S1M K;  4A3B K;  4G7O A;  5C4X C;  2CW0 A;  4AYB D;  4C3J K;  5M3M K;  2B63 C;  2NVX K;  4ZH4 A;  2NVQ C;  3S2H K;  4A3J K;  3S1Q K;  2VUM K;  4A93 K;  1TWG C;  3RZO K;  3K7A K;  3M4O C;  3HOU C;  3GTQ C;  4A3I K;  4A3G C;  3I4N C;  2JA5 C;  3M3Y K;  1I50 C;  3H0G K;  2PA8 D;  3HKZ D;  4LJZ A;  2WAQ D;  4C3I K;  5TMC A;  1SFO C;  1WCM K;  1R9T K;  3GTP K;  3I4M C;  4A3C C;  1K83 K;  2R92 K;  1YNJ A;  2R7Z K;  1TWA K;  4YFK A;  3HOX C;  3EQL A;  4XLN A;  3FKI K;  2R93 C;  1TWH K;  4LK1 A;  4OIN A;  3HOZ K;  3HOV K;  5M3F K;  5C44 K;  3S1R K;  5IYC K;  5C4J K;  4A3K C;  2A6H A;  3GTJ K;  2A6E A;  2WB1 D;  4KMU A;  4JK1 A;  3GTL K;  4BBR K;  4Y7N K;  4BXX C;  1I6H K;  3PO3 C;  2WB1 L;  4LLG A;  1Y1W C;  2PMZ D;  1TWC K;  3GTM K;  3HOW K;  2PMZ L;  5M5X K;  1I3Q C;  5IYD C;  2PPB A;  3GTK C;  1Y1V K;  1I6V A;  4YFX A;  5FLM K;  2E2J C;  3S16 K;  4A3B C;  3S2H C;  3S1M C;  3HOY K;  3S1Q C;  2NVX C;  4X6A K;  2JA8 K;  4A3J C;  2VUM C;  4A93 C;  5IP9 K;  5D4D A;  3GTO K;  3RZO C;  3K7A C;  3S15 K;  4A3L K;  4A3I C;  4MEY A;  3RZD K;  1IW7 A;  5M5W K;  4Y52 K;  5C3E K;  3M3Y C;  3CQZ K;  3H0G C;  1BDF A;  4A3F K;  4Q4Z A;  3S14 K;  5IYB K;  2JA6 K;  4OIQ A;  5IP7 K;  1WCM C;  1R9T C;  3GTP C;  2O5I A;  2BE5 A;  1K83 C;  2JA7 K;  2R7Z C;  1TWA C;  1SMY A;  2R92 C;  3GTG K;  4A3E K;  4OIO A;  2NVT K;  3FKI C;  2O5J A;  1TWH C;  3DXJ A;  3HOZ C;  3HOV C;  5C44 C;  3S1R C;  2E2I K;  5IYC C;  5C4J C;  4A3D K;  2NVY K;  4MEX A;  1TWF K;  3GTJ C;  2YU9 K;  4GZY A;  3GTL C;  2E2H K;  3S1N K;  4BBR C;  4Y7N C;  4BY1 K;  4MQ9 A;  1I6H C;  3S17 K;  2R93 K;  3S2D K;  5FJ8 K;  1TWC C;  4XSX A;  3GTM C;  4BBS K;  3HOW C;  4QIW D;  4A3M K;  4QIW L;  2Y0S L;  3PO2 K;  1Y1V C;  4XSZ A;  1XPP A;  3S16 C;  5FLM C;  4BY7 C;  5C4X K;  2B63 K;  3HOY C;  4X6A C;  4QJV B;  4OIP A;  2JA8 C;  2NVQ K;  5IP9 C;  3GTO C;  4G7H A;  1TWG K;  3S15 C;  4A3L C;  4QJV A;  3HOU K;  3M4O K;  4YFN A;  3GTQ K;  3RZD C;  4A3G K;  4C2M K;  4Y52 C;  5C3E C;  2JA5 K;  3CQZ C;  3I4N K;  1I50 K;  3WOD A;  4AYB L;  4A3F C;  3S14 C;  4XLP A;  5IYB C;  1SFO K;  2JA6 C;  5TMF A;  5IP7 C;  3H3V D;  4A3C K;  4YG2 A;  5M5Y K;  4G7Z A;  2JA7 C;  1YNN A;  3GTG C;  3I4M K;  3H3V L;  3HOX K;  4NOI A;  4BY7 K;  4A3E C;  4OIR A;  2NVT C;  2PA8 L;  3HKZ L;  2A68 A;  2WAQ L;  2A69 A;  4C3H K;  4A3D C;  2E2I C;  2NVY C;  4A3K K;  4Q5S A;  2Y0S D;  1TWF C;  2YU9 C;  2E2H C;  3S1N C;  4BY1 C;  1ZYR A;  4BXX K;  3S17 C;  3PO3 K;  4KN4 A;  1HQM A;  4KN7 A;  3S2D C;  1Y1W K;  4BBS C;  4A3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...