1TWFK

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twfK00
4A3IK 4A3BC 3S17K 4A3EC 3S2DC 2E2HC 2NVQC 3S1QC 4XSXA 2O5IA 4YG2A 3HKZD 5IYDK 4Y52C 2E2IC 3CQZC 1R9TC 1TWAK 2E2JC 3HOWC 1K83K 3H3VD 5D4DA 5C4JC 2WB1D 4ZH4A 1Y1WK 3HOYK 2NVTK 4MQ9A 3S1RC 2O5JA 3HOZK 2Y0SL 2JA7C 4KN7A 5IYDC 2JA5K 3S16C 1TWAC 1TWGC 2NVYK 2WAQL 4QJVB 4G7HA 1Y1WC 4YFNA 3HOYC 4A3MC 3GTMK 4OIQA 3S15K 4MEXA 1Y1VK 1WCMK 3HOZC 3S2HC 2A6HA 5IYCK 3HOVC 3GTGK 4XLPA 4LK0A 1TWCC 2YU9K 4QIWL 2NVYC 3GTKC 3GTJK 1YNNA 2PMZL 3GTMC 4BXXK 3GTQK 3S15C 4OIRA 1I6VA 5IYBK 3HOUC 5IYCC 4GZYA 3PO3C 3GTGC 1HQMA 2VUMK 4XLNA 3GTLK 1K83C 3GTJC 4BXXC 4JK1A 4A3IC 3I4NK 4A3JK 3M4OK 3S17C 5IYBC 2PA8L 4C3IK 3S14K 4MEYA 4OINA 3GTLC 4A3LK 4A93K 3PO2K 5M5YK 3I4NC 4Q5SA 3M4OC 4YFXA 1I6HK 3H0GK 1ZYRA 2NVTC 2R7ZK 3S14C 3RZDK 2Y0SD 2NVXK 4A3DK 4A3GK 4X6AK 1YNJA 2R93K 2JA5C 4A3LC 1I50K 3RZOK 5TMFA 4AYBD 2WAQD 1TWHK 3PO2C 4Y7NK 1I3QK 1I6HC 3H0GC 3HOXK 5C4XK 1Y1VC 1WCMC 3RZDC 2NVXC 4A3DC 4X6AC 3EQLA 2R93C 2YU9C 4C2MK 1TWFK 1XPPA 4LJZA 1TWHC 4XSZA 1SFOK 4QJVA 4A3FK 1I3QC 2PMZD 2BE5A 3GTQC 3HOXC 1SMYA 5IP9K 2B63K 5FLMK 4C3JK 3DXJA 2A68A 4Y52K 2VUMC 4A3BK 3K7AK 4BBSK 4LLGA 4OIOA 2E2HK 5M3MK 4A3FC 3HKZL 5C3EK 4A3KK 4BY1K 5IP9C 4A3JC 2E2IK 3CQZK 1R9TK 2PPBA 5C44K 2B63C 5FLMC 3GTOK 3HOWK 3H3VL 5C4JK 2WB1L 5M3FK 2JA6K 2R92K 3K7AC 4A93C 4A3CK 4BBSC 2CW0A 4NOIA 3S1RK 4KN4A 4Q4ZA 2JA7K 5C3EC 4A3KC 4BY1C 3FKIK 3GTOC 3S16K 5M5XK 5C44C 1TWGK 2R7ZC 3S1NK 3S1MK 4A3GC 2JA6C 2R92C 4G7OA 1IW7A 4A3MK 2A69A 4A3CC 1I50C 4QIWD 3RZOC 4LK1A 4BBRC 2JA8K 3S2HK 3HOVK 3WODA 4Y7NC 4BY7K 3I4MK 1TWCK 3FKIC 4YFKA 5FJ8K 3GTPK 5IP7K 4AYBL 5C4XC 3S1NC 4G7ZA 3GTKK 4BBRK 3M3YK 3S1MC 4KMUA 2A6EA 5M5WK 1TWFC 4A3EK 2JA8C 3HOUK 2NVQK 4OIPA 1SFOC 3S2DK 1BDFA 3PO3K 3S1QK 4BY7C 3I4MC 3GTPC 5IP7C 4C3HK 5TMCA 2PA8D 2E2JK 3M3YC
chains in the Genus database with same CATH superfamily
4A3IK 4ILDA 3S2DC 2NVQC 1TWFA 3S1QC 4KC6A 3HKZD 1R9TC 3N0CA 4KM8A 5C4JC 1Y1WK 3HOYK 2P8TA 4MQ9A 3TTGA 3S1RC 2O5JA 2Y0SL 4KN7A 3TFHA 2Y3PA 4P9SA 1BJTA 1TWGC 1R9TA 3GTOA 1J6VA 1Y1WC 3HOYC 1J6WA 4OIQA 4AH6A 4MEXA 1WCMK 3S2HC 2A6HA 3HOVC 4GTCA 3GTGK 3FKIA 3GTKC 1XZPA 1TWGA 1V5VA 4BXXK 1BGWA 1IL2A 1I6VA 5IYBK 3HOUC 3PO3C 3GTGC 2VUMK 1ZXOA 1VH2A 3GTLK 1F7UA 4G0WA 3GTKA 3A8JA 4JK1A 3SZYA 4BXXC 4A3JK 4KMHA 3S17C 1WQHA 5IYBC 2PA8L 3FOEA 3SZZA 3GTLC 3PO2K 3L4JA 1USMA 4GTBA 4Q5SA 3CAGA 2GSNA 2R7ZK 1O25A 3OEPA 1ZBSA 1YNJA 3PO2C 2WAQD 1TWHK 3G4CA 4GFQA 5CJ9A 1XZPB 2YU9C 1TWHC 4QJVA 4A3FK 1B4AA 3GTMA 5FLMK 3K7AK 2YU9A 2E2HK 4A3FC 3GTJA 3HKZL 4OIRA 5FLMC 5JFEA 4LQYA 3K7AC 1X31C 4A3CK 4KN4A 1UV7A 1XZQA 5M5XK 1JOEA 3S1NK 2GSOA 3S1MK 4A3MK 4A3CC 4Y7NC 2JH3A 3I4MK 3GTPK 3H0GA 4AYBL 3S1NC 3S1MC 5E68A 1J6XA 4A3EK 4OIPA 1SFOC 3LPXA 3I4MC 3GEEA 3GTPC 5L46A 4J3NA 4C3HK 5TMCA 2PA8D 1K83K 2V6TA 4LR2A 1EFWA 5CHPA 4A3EC 4LOWA 1DD5A 1SFOA 2O5IA 3T01A 1WQGA 4Y52C 4C3HC 2E2IC 1TWAK 3HOWC 1PJ5A 2RGRA 1DCPA 1VJEA 2NVTK 1VLOA 4KDDA 2JA5K 3S16C 5TJ3A 1TWAC 1YCLA 2E2IA 2NVYK 2WAQL 2D6FC 3L4KA 1C0AA 2R92A 2JA6A 1PJ6A 1Y1VK 4QIWL 2NVYC 1EK8A 3GDZA 3GTQK 1WORA 4GZYA 4XLNA 4A3IC 3JSTA 3M4OK 1RU0A 3TFIA 3AQOA 3S14K 3ERED 4A3LK 5M5YK 1ZVUA 3T00A 3M4OC 1I6HK 3S14C 3RZDK 2CFAB 4A3LC 3AQPA 4AYBD 4GTAA 3GEHA 1WQFA 1Y1WA 1I6HC 3FHZA 5C4XK 1WCMC 1AB4A 3RZDC 3EQLA 4DDQA 4C2MK 1XPPA 4KB4A 4XSZA 2PMZD 2BE5A 5EGEA 1WIHA 2B63K 1WCMA 2ZFZA 4C3JK 3GTGA 4C2MC 2VUMC 4A3BK 4LLGA 4A3KK 4BY1K 4A3JC 4KMAA 3CQZK 2B63C 5M3FK 4M1XA 5HL8A 2VUMA 3GTLA 2CW0A 3BP8C 2JA7K 3BP3A 1O2BA 4A3KC 4BY1C 4WJ3M 3T02A 2R7ZC 2FQOA 4G7OA 1IW7A 1IE0A 4QIWD 1JQWA 4BY7K 1TWCK 4YFKA 3A8IA 4BBRK 3M3YK 2R7ZA 1IBAA 4BLBA 1BDFA 1TWHA 3GIRA 4BY7C 1O24A 3N0BA 5IOSA 2E2JK 4BBRC 3M3YC 1WOPA 2XCQA 3NUHA 3N3YA 1YX2A 2E2HC 3OREA 4KATA 1HI9A 2E2JC 3S0XA 2E2HA 1O27A 1KQ4A 4O2DA 4QJVB 4PAAA 4YFNA 4A3MC 2GAGC 5IYCK 4LK0A 4PABA 1BS2A 2PMZL 4KM9A 2XCOA 5IYCC 4GTEA 4KB2A 3GTPA 1K83C 1O28A 1XZQB 3I4NK 4OINA 4A93K 1K83A 4GTDA 1IQ0A 3I4NC 3GEIA 1ZYRA 2NVTC 2NVXK 4A3GK 4X6AK 3A8KA 3Q3QA 1O29A 2JA5C 2R93K 1I50K 1JVIA 3RZOK 5TMFA 1TWAA 3TFJA 1I3QK 1F9NA 1Y1VC 1O26A 2NVXC 4KAWX 4X6AC 2R93C 1WOOA 2JA5A 1TWFK 5IOTA 2NVYA 1I3QC 3GTQC 1O2AA 1SMYA 3ADAC 1Y1VA 3AD9C 3LAJA 2GAHC 1XXCA 3LAPA 4BBSK 2V6UA 1EI6A 5C3EK 3GTQA 3GTOK 5JVOA 1R9TK 5C44K 1GE9A 5C4JK 1WOSA 4BBSC 3S1RK 2EBBA 5C3EC 3FKIK 3GTOC 5C44C 1TWGK 4BKWA 2A69A 2JA8K 3S2HK 3HOVK 2KWAA 4GT9A 3FKIC 1G51A 5IP7K 5C4XC 4G7ZA 3GTKK 2P5MA 1PJ7A 4KMUA 2FQTA 2XCRB 2JA8C 3HOUK 2RH6A 3PO3K 3V4GA 5IP7C 4RMFA 1VRQC 4C3JC 1INNA 3BUEA 4FM9A 4A3BC 1WSVA 3S17K 4GTFA 4XSXA 4YG2A 5IYDK 3CQZC 2B63A 3H3VD 5D4DA 2WB1D 4ZH4A 4WJ4A 3HOZK 2JA7C 5IYDC 4G0VA 3CQZA 4G7HA 3GTMK 1DCOA 3S15K 3HOZC 4XLPA 2JA7A 1TWCC 2YU9K 1DCHA 3GTJK 1YNNA 3GTMC 3HXAA 1ZQ1C 1USOA 3S15C 1EQRA 3AD7C 4XCHA 1HQMA 4WILA 1TWCA 4C45A 3GTJC 3OPFA 4C3IK 4MEYA 4G0UA 3AH5A 4YFXA 3H0GK 4KASA 4C3IC 2W7VA 1XXBA 2ZUEA 2Y0SD 4A3DK 3AD8C 1O2FB 4Y7NK 1B4BA 1ISEA 1IS1A 3H0GC 5EGHA 3HOXK 4BLAA 2GSUA 5IORA 4A3DC 4FZBA 1F7VA 4LJZA 1SFOK 3G4AA 1L0WA 3HOXC 5IP9K 4KMDA 3DXJA 2A68A 3FOFA 4OIOA 5M3MK 2V6SA 1J98A 2PHCB 5IP9C 3HOWK 2E2IK 4Y52K 2PPBA 1EH1A 3H3VL 2WB1L 2JA6K 4KARA 2R92K 4A93C 4NOIA 4P5BA 1XXAA 3VA7A 4Q4ZA 3S16K 4A3GC 2JA6C 2R92C 2ZUFA 1I50C 3RZOC 4LK1A 1WSRA 4GTLA 3WODA 4P5AA 3QX3A 5FJ8K 3GSIA 2NVXA 5IOQA 2A6EA 2CFAA 2R93A 1F93A 5M5WK 1TWFC 1I50A 3S2DK 2NVQK 3S1QK 3MMLB 1VGXA 1I3QA 3IPJA
chains in the Genus database with same CATH topology
4A3IK 4A3BC 3S17K 4A3EC 3S2DC 2E2HC 2NVQC 3S1QC 4XSXA 2O5IA 4YG2A 3HKZD 5IYDK 4Y52C 2E2IC 3CQZC 1R9TC 1TWAK 2E2JC 3HOWC 1K83K 3H3VD 5D4DA 5C4JC 2WB1D 4ZH4A 1Y1WK 3HOYK 2NVTK 4MQ9A 3S1RC 2O5JA 3HOZK 2Y0SL 2JA7C 4KN7A 5IYDC 2JA5K 3S16C 1TWAC 1TWGC 2NVYK 2WAQL 4QJVB 4G7HA 1Y1WC 4YFNA 3HOYC 4A3MC 3GTMK 4OIQA 3S15K 4MEXA 1Y1VK 1WCMK 3HOZC 3S2HC 2A6HA 5IYCK 3HOVC 3GTGK 4XLPA 4LK0A 1TWCC 2YU9K 4QIWL 2NVYC 3GTKC 3GTJK 1YNNA 2PMZL 3GTMC 4BXXK 3GTQK 3S15C 4OIRA 1I6VA 5IYBK 3HOUC 5IYCC 4GZYA 3PO3C 3GTGC 1HQMA 2VUMK 4XLNA 3GTLK 1K83C 3GTJC 4BXXC 4JK1A 4A3IC 3I4NK 4A3JK 3M4OK 3S17C 5IYBC 2PA8L 4C3IK 3S14K 4MEYA 4OINA 3GTLC 4A3LK 4A93K 3PO2K 5M5YK 3I4NC 4Q5SA 3M4OC 4YFXA 1I6HK 3H0GK 1ZYRA 2NVTC 2R7ZK 3S14C 3RZDK 2Y0SD 2NVXK 4A3DK 4A3GK 4X6AK 1YNJA 2R93K 2JA5C 4A3LC 1I50K 3RZOK 5TMFA 4AYBD 2WAQD 1TWHK 3PO2C 4Y7NK 1I3QK 1I6HC 3H0GC 3HOXK 5C4XK 1Y1VC 1WCMC 3RZDC 2NVXC 4A3DC 4X6AC 3EQLA 2R93C 2YU9C 4C2MK 1TWFK 1XPPA 4LJZA 1TWHC 4XSZA 1SFOK 4QJVA 4A3FK 1I3QC 2PMZD 2BE5A 3GTQC 3HOXC 1SMYA 5IP9K 2B63K 5FLMK 4C3JK 3DXJA 2A68A 4Y52K 2VUMC 4A3BK 3K7AK 4BBSK 4LLGA 4OIOA 2E2HK 5M3MK 4A3FC 3HKZL 5C3EK 4A3KK 4BY1K 5IP9C 4A3JC 2E2IK 3CQZK 1R9TK 2PPBA 5C44K 2B63C 5FLMC 3GTOK 3HOWK 3H3VL 5C4JK 2WB1L 5M3FK 2JA6K 2R92K 3K7AC 4A93C 4A3CK 4BBSC 2CW0A 4NOIA 3S1RK 4KN4A 4Q4ZA 2JA7K 5C3EC 4A3KC 4BY1C 3FKIK 3GTOC 3S16K 5M5XK 5C44C 1TWGK 2R7ZC 3S1NK 3S1MK 4A3GC 2JA6C 2R92C 4G7OA 1IW7A 4A3MK 2A69A 4A3CC 1I50C 4QIWD 3RZOC 4LK1A 4BBRC 2JA8K 3S2HK 3HOVK 3WODA 4Y7NC 4BY7K 3I4MK 1TWCK 3FKIC 4YFKA 5FJ8K 3GTPK 5IP7K 4AYBL 5C4XC 3S1NC 4G7ZA 3GTKK 4BBRK 3M3YK 3S1MC 4KMUA 2A6EA 5M5WK 1TWFC 4A3EK 2JA8C 3HOUK 2NVQK 4OIPA 1SFOC 3S2DK 1BDFA 3PO3K 3S1QK 4BY7C 3I4MC 3GTPC 5IP7C 4C3HK 5TMCA 2PA8D 2E2JK 3M3YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I K;  4A3B C;  3S17 K;  4A3E C;  3S2D C;  2E2H C;  2NVQ C;  3S1Q C;  4XSX A;  2O5I A;  4YG2 A;  3HKZ D;  5IYD K;  4Y52 C;  2E2I C;  3CQZ C;  1R9T C;  1TWA K;  2E2J C;  3HOW C;  1K83 K;  3H3V D;  5D4D A;  5C4J C;  2WB1 D;  4ZH4 A;  1Y1W K;  3HOY K;  2NVT K;  4MQ9 A;  3S1R C;  2O5J A;  3HOZ K;  2Y0S L;  2JA7 C;  4KN7 A;  5IYD C;  2JA5 K;  3S16 C;  1TWA C;  1TWG C;  2NVY K;  2WAQ L;  4QJV B;  4G7H A;  1Y1W C;  4YFN A;  3HOY C;  4A3M C;  3GTM K;  4OIQ A;  3S15 K;  4MEX A;  1Y1V K;  1WCM K;  3HOZ C;  3S2H C;  2A6H A;  5IYC K;  3HOV C;  3GTG K;  4XLP A;  4LK0 A;  1TWC C;  2YU9 K;  4QIW L;  2NVY C;  3GTK C;  3GTJ K;  1YNN A;  2PMZ L;  3GTM C;  4BXX K;  3GTQ K;  3S15 C;  4OIR A;  1I6V A;  5IYB K;  3HOU C;  5IYC C;  4GZY A;  3PO3 C;  3GTG C;  1HQM A;  2VUM K;  4XLN A;  3GTL K;  1K83 C;  3GTJ C;  4BXX C;  4JK1 A;  4A3I C;  3I4N K;  4A3J K;  3M4O K;  3S17 C;  5IYB C;  2PA8 L;  4C3I K;  3S14 K;  4MEY A;  4OIN A;  3GTL C;  4A3L K;  4A93 K;  3PO2 K;  5M5Y K;  3I4N C;  4Q5S A;  3M4O C;  4YFX A;  1I6H K;  3H0G K;  1ZYR A;  2NVT C;  2R7Z K;  3S14 C;  3RZD K;  2Y0S D;  2NVX K;  4A3D K;  4A3G K;  4X6A K;  1YNJ A;  2R93 K;  2JA5 C;  4A3L C;  1I50 K;  3RZO K;  5TMF A;  4AYB D;  2WAQ D;  1TWH K;  3PO2 C;  4Y7N K;  1I3Q K;  1I6H C;  3H0G C;  3HOX K;  5C4X K;  1Y1V C;  1WCM C;  3RZD C;  2NVX C;  4A3D C;  4X6A C;  3EQL A;  2R93 C;  2YU9 C;  4C2M K;  1TWF K;  1XPP A;  4LJZ A;  1TWH C;  4XSZ A;  1SFO K;  4QJV A;  4A3F K;  1I3Q C;  2PMZ D;  2BE5 A;  3GTQ C;  3HOX C;  1SMY A;  5IP9 K;  2B63 K;  5FLM K;  4C3J K;  3DXJ A;  2A68 A;  4Y52 K;  2VUM C;  4A3B K;  3K7A K;  4BBS K;  4LLG A;  4OIO A;  2E2H K;  5M3M K;  4A3F C;  3HKZ L;  5C3E K;  4A3K K;  4BY1 K;  5IP9 C;  4A3J C;  2E2I K;  3CQZ K;  1R9T K;  2PPB A;  5C44 K;  2B63 C;  5FLM C;  3GTO K;  3HOW K;  3H3V L;  5C4J K;  2WB1 L;  5M3F K;  2JA6 K;  2R92 K;  3K7A C;  4A93 C;  4A3C K;  4BBS C;  2CW0 A;  4NOI A;  3S1R K;  4KN4 A;  4Q4Z A;  2JA7 K;  5C3E C;  4A3K C;  4BY1 C;  3FKI K;  3GTO C;  3S16 K;  5M5X K;  5C44 C;  1TWG K;  2R7Z C;  3S1N K;  3S1M K;  4A3G C;  2JA6 C;  2R92 C;  4G7O A;  1IW7 A;  4A3M K;  2A69 A;  4A3C C;  1I50 C;  4QIW D;  3RZO C;  4LK1 A;  4BBR C;  2JA8 K;  3S2H K;  3HOV K;  3WOD A;  4Y7N C;  4BY7 K;  3I4M K;  1TWC K;  3FKI C;  4YFK A;  5FJ8 K;  3GTP K;  5IP7 K;  4AYB L;  5C4X C;  3S1N C;  4G7Z A;  3GTK K;  4BBR K;  3M3Y K;  3S1M C;  4KMU A;  2A6E A;  5M5W K;  1TWF C;  4A3E K;  2JA8 C;  3HOU K;  2NVQ K;  4OIP A;  1SFO C;  3S2D K;  1BDF A;  3PO3 K;  3S1Q K;  4BY7 C;  3I4M C;  3GTP C;  5IP7 C;  4C3H K;  5TMC A;  2PA8 D;  2E2J K;  3M3Y C; 
#chains in the Genus database with same CATH topology
 4A3I K;  4ILD A;  3S2D C;  2NVQ C;  1TWF A;  3S1Q C;  4KC6 A;  3HKZ D;  1R9T C;  3N0C A;  4KM8 A;  5C4J C;  1Y1W K;  3HOY K;  2P8T A;  4MQ9 A;  3TTG A;  3S1R C;  2O5J A;  2Y0S L;  4KN7 A;  3TFH A;  2Y3P A;  4P9S A;  1BJT A;  1TWG C;  1R9T A;  3GTO A;  1J6V A;  1Y1W C;  3HOY C;  1J6W A;  4OIQ A;  4AH6 A;  4MEX A;  1WCM K;  3S2H C;  2A6H A;  3HOV C;  4GTC A;  3GTG K;  3FKI A;  3GTK C;  1XZP A;  1TWG A;  1V5V A;  4BXX K;  1BGW A;  1IL2 A;  1I6V A;  5IYB K;  3HOU C;  3PO3 C;  3GTG C;  2VUM K;  1ZXO A;  1VH2 A;  3GTL K;  1F7U A;  4G0W A;  3GTK A;  3A8J A;  4JK1 A;  3SZY A;  4BXX C;  4A3J K;  4KMH A;  3S17 C;  1WQH A;  5IYB C;  2PA8 L;  3FOE A;  3SZZ A;  3GTL C;  3PO2 K;  3L4J A;  1USM A;  4GTB A;  4Q5S A;  3CAG A;  2GSN A;  2R7Z K;  1O25 A;  3OEP A;  1ZBS A;  1YNJ A;  3PO2 C;  2WAQ D;  1TWH K;  3G4C A;  4GFQ A;  5CJ9 A;  1XZP B;  2YU9 C;  1TWH C;  4QJV A;  4A3F K;  1B4A A;  3GTM A;  5FLM K;  3K7A K;  2YU9 A;  2E2H K;  4A3F C;  3GTJ A;  3HKZ L;  4OIR A;  5FLM C;  5JFE A;  4LQY A;  3K7A C;  1X31 C;  4A3C K;  4KN4 A;  1UV7 A;  1XZQ A;  5M5X K;  1JOE A;  3S1N K;  2GSO A;  3S1M K;  4A3M K;  4A3C C;  4Y7N C;  2JH3 A;  3I4M K;  3GTP K;  3H0G A;  4AYB L;  3S1N C;  3S1M C;  5E68 A;  1J6X A;  4A3E K;  4OIP A;  1SFO C;  3LPX A;  3I4M C;  3GEE A;  3GTP C;  5L46 A;  4J3N A;  4C3H K;  5TMC A;  2PA8 D;  1K83 K;  2V6T A;  4LR2 A;  1EFW A;  5CHP A;  4A3E C;  4LOW A;  1DD5 A;  1SFO A;  2O5I A;  3T01 A;  1WQG A;  4Y52 C;  4C3H C;  2E2I C;  1TWA K;  3HOW C;  1PJ5 A;  2RGR A;  1DCP A;  1VJE A;  2NVT K;  1VLO A;  4KDD A;  2JA5 K;  3S16 C;  5TJ3 A;  1TWA C;  1YCL A;  2E2I A;  2NVY K;  2WAQ L;  2D6F C;  3L4K A;  1C0A A;  2R92 A;  2JA6 A;  1PJ6 A;  1Y1V K;  4QIW L;  2NVY C;  1EK8 A;  3GDZ A;  3GTQ K;  1WOR A;  4GZY A;  4XLN A;  4A3I C;  3JST A;  3M4O K;  1RU0 A;  3TFI A;  3AQO A;  3S14 K;  3ERE D;  4A3L K;  5M5Y K;  1ZVU A;  3T00 A;  3M4O C;  1I6H K;  3S14 C;  3RZD K;  2CFA B;  4A3L C;  3AQP A;  4AYB D;  4GTA A;  3GEH A;  1WQF A;  1Y1W A;  1I6H C;  3FHZ A;  5C4X K;  1WCM C;  1AB4 A;  3RZD C;  3EQL A;  4DDQ A;  4C2M K;  1XPP A;  4KB4 A;  4XSZ A;  2PMZ D;  2BE5 A;  5EGE A;  1WIH A;  2B63 K;  1WCM A;  2ZFZ A;  4C3J K;  3GTG A;  4C2M C;  2VUM C;  4A3B K;  4LLG A;  4A3K K;  4BY1 K;  4A3J C;  4KMA A;  3CQZ K;  2B63 C;  5M3F K;  4M1X A;  5HL8 A;  2VUM A;  3GTL A;  2CW0 A;  3BP8 C;  2JA7 K;  3BP3 A;  1O2B A;  4A3K C;  4BY1 C;  4WJ3 M;  3T02 A;  2R7Z C;  2FQO A;  4G7O A;  1IW7 A;  1IE0 A;  4QIW D;  1JQW A;  4BY7 K;  1TWC K;  4YFK A;  3A8I A;  4BBR K;  3M3Y K;  2R7Z A;  1IBA A;  4BLB A;  1BDF A;  1TWH A;  3GIR A;  4BY7 C;  1O24 A;  3N0B A;  5IOS A;  2E2J K;  4BBR C;  3M3Y C;  1WOP A;  2XCQ A;  3NUH A;  3N3Y A;  1YX2 A;  2E2H C;  3ORE A;  4KAT A;  1HI9 A;  2E2J C;  3S0X A;  2E2H A;  1O27 A;  1KQ4 A;  4O2D A;  4QJV B;  4PAA A;  4YFN A;  4A3M C;  2GAG C;  5IYC K;  4LK0 A;  4PAB A;  1BS2 A;  2PMZ L;  4KM9 A;  2XCO A;  5IYC C;  4GTE A;  4KB2 A;  3GTP A;  1K83 C;  1O28 A;  1XZQ B;  3I4N K;  4OIN A;  4A93 K;  1K83 A;  4GTD A;  1IQ0 A;  3I4N C;  3GEI A;  1ZYR A;  2NVT C;  2NVX K;  4A3G K;  4X6A K;  3A8K A;  3Q3Q A;  1O29 A;  2JA5 C;  2R93 K;  1I50 K;  1JVI A;  3RZO K;  5TMF A;  1TWA A;  3TFJ A;  1I3Q K;  1F9N A;  1Y1V C;  1O26 A;  2NVX C;  4KAW X;  4X6A C;  2R93 C;  1WOO A;  2JA5 A;  1TWF K;  5IOT A;  2NVY A;  1I3Q C;  3GTQ C;  1O2A A;  1SMY A;  3ADA C;  1Y1V A;  3AD9 C;  3LAJ A;  2GAH C;  1XXC A;  3LAP A;  4BBS K;  2V6U A;  1EI6 A;  5C3E K;  3GTQ A;  3GTO K;  5JVO A;  1R9T K;  5C44 K;  1GE9 A;  5C4J K;  1WOS A;  4BBS C;  3S1R K;  2EBB A;  5C3E C;  3FKI K;  3GTO C;  5C44 C;  1TWG K;  4BKW A;  2A69 A;  2JA8 K;  3S2H K;  3HOV K;  2KWA A;  4GT9 A;  3FKI C;  1G51 A;  5IP7 K;  5C4X C;  4G7Z A;  3GTK K;  2P5M A;  1PJ7 A;  4KMU A;  2FQT A;  2XCR B;  2JA8 C;  3HOU K;  2RH6 A;  3PO3 K;  3V4G A;  5IP7 C;  4RMF A;  1VRQ C;  4C3J C;  1INN A;  3BUE A;  4FM9 A;  4A3B C;  1WSV A;  3S17 K;  4GTF A;  4XSX A;  4YG2 A;  5IYD K;  3CQZ C;  2B63 A;  3H3V D;  5D4D A;  2WB1 D;  4ZH4 A;  4WJ4 A;  3HOZ K;  2JA7 C;  5IYD C;  4G0V A;  3CQZ A;  4G7H A;  3GTM K;  1DCO A;  3S15 K;  3HOZ C;  4XLP A;  2JA7 A;  1TWC C;  2YU9 K;  1DCH A;  3GTJ K;  1YNN A;  3GTM C;  3HXA A;  1ZQ1 C;  1USO A;  3S15 C;  1EQR A;  3AD7 C;  4XCH A;  1HQM A;  4WIL A;  1TWC A;  4C45 A;  3GTJ C;  3OPF A;  4C3I K;  4MEY A;  4G0U A;  3AH5 A;  4YFX A;  3H0G K;  4KAS A;  4C3I C;  2W7V A;  1XXB A;  2ZUE A;  2Y0S D;  4A3D K;  3AD8 C;  1O2F B;  4Y7N K;  1B4B A;  1ISE A;  1IS1 A;  3H0G C;  5EGH A;  3HOX K;  4BLA A;  2GSU A;  5IOR A;  4A3D C;  4FZB A;  1F7V A;  4LJZ A;  1SFO K;  3G4A A;  1L0W A;  3HOX C;  5IP9 K;  4KMD A;  3DXJ A;  2A68 A;  3FOF A;  4OIO A;  5M3M K;  2V6S A;  1J98 A;  2PHC B;  5IP9 C;  3HOW K;  2E2I K;  4Y52 K;  2PPB A;  1EH1 A;  3H3V L;  2WB1 L;  2JA6 K;  4KAR A;  2R92 K;  4A93 C;  4NOI A;  4P5B A;  1XXA A;  3VA7 A;  4Q4Z A;  3S16 K;  4A3G C;  2JA6 C;  2R92 C;  2ZUF A;  1I50 C;  3RZO C;  4LK1 A;  1WSR A;  4GTL A;  3WOD A;  4P5A A;  3QX3 A;  5FJ8 K;  3GSI A;  2NVX A;  5IOQ A;  2A6E A;  2CFA A;  2R93 A;  1F93 A;  5M5W K;  1TWF C;  1I50 A;  3S2D K;  2NVQ K;  3S1Q K;  3MML B;  1VGX A;  1I3Q A;  3IPJ A; 
#chains in the Genus database with same CATH homology
 4A3I K;  4A3B C;  3S17 K;  4A3E C;  3S2D C;  2E2H C;  2NVQ C;  3S1Q C;  4XSX A;  2O5I A;  4YG2 A;  3HKZ D;  5IYD K;  4Y52 C;  2E2I C;  3CQZ C;  1R9T C;  1TWA K;  2E2J C;  3HOW C;  1K83 K;  3H3V D;  5D4D A;  5C4J C;  2WB1 D;  4ZH4 A;  1Y1W K;  3HOY K;  2NVT K;  4MQ9 A;  3S1R C;  2O5J A;  3HOZ K;  2Y0S L;  2JA7 C;  4KN7 A;  5IYD C;  2JA5 K;  3S16 C;  1TWA C;  1TWG C;  2NVY K;  2WAQ L;  4QJV B;  4G7H A;  1Y1W C;  4YFN A;  3HOY C;  4A3M C;  3GTM K;  4OIQ A;  3S15 K;  4MEX A;  1Y1V K;  1WCM K;  3HOZ C;  3S2H C;  2A6H A;  5IYC K;  3HOV C;  3GTG K;  4XLP A;  4LK0 A;  1TWC C;  2YU9 K;  4QIW L;  2NVY C;  3GTK C;  3GTJ K;  1YNN A;  2PMZ L;  3GTM C;  4BXX K;  3GTQ K;  3S15 C;  4OIR A;  1I6V A;  5IYB K;  3HOU C;  5IYC C;  4GZY A;  3PO3 C;  3GTG C;  1HQM A;  2VUM K;  4XLN A;  3GTL K;  1K83 C;  3GTJ C;  4BXX C;  4JK1 A;  4A3I C;  3I4N K;  4A3J K;  3M4O K;  3S17 C;  5IYB C;  2PA8 L;  4C3I K;  3S14 K;  4MEY A;  4OIN A;  3GTL C;  4A3L K;  4A93 K;  3PO2 K;  5M5Y K;  3I4N C;  4Q5S A;  3M4O C;  4YFX A;  1I6H K;  3H0G K;  1ZYR A;  2NVT C;  2R7Z K;  3S14 C;  3RZD K;  2Y0S D;  2NVX K;  4A3D K;  4A3G K;  4X6A K;  1YNJ A;  2R93 K;  2JA5 C;  4A3L C;  1I50 K;  3RZO K;  5TMF A;  4AYB D;  2WAQ D;  1TWH K;  3PO2 C;  4Y7N K;  1I3Q K;  1I6H C;  3H0G C;  3HOX K;  5C4X K;  1Y1V C;  1WCM C;  3RZD C;  2NVX C;  4A3D C;  4X6A C;  3EQL A;  2R93 C;  2YU9 C;  4C2M K;  1TWF K;  1XPP A;  4LJZ A;  1TWH C;  4XSZ A;  1SFO K;  4QJV A;  4A3F K;  1I3Q C;  2PMZ D;  2BE5 A;  3GTQ C;  3HOX C;  1SMY A;  5IP9 K;  2B63 K;  5FLM K;  4C3J K;  3DXJ A;  2A68 A;  4Y52 K;  2VUM C;  4A3B K;  3K7A K;  4BBS K;  4LLG A;  4OIO A;  2E2H K;  5M3M K;  4A3F C;  3HKZ L;  5C3E K;  4A3K K;  4BY1 K;  5IP9 C;  4A3J C;  2E2I K;  3CQZ K;  1R9T K;  2PPB A;  5C44 K;  2B63 C;  5FLM C;  3GTO K;  3HOW K;  3H3V L;  5C4J K;  2WB1 L;  5M3F K;  2JA6 K;  2R92 K;  3K7A C;  4A93 C;  4A3C K;  4BBS C;  2CW0 A;  4NOI A;  3S1R K;  4KN4 A;  4Q4Z A;  2JA7 K;  5C3E C;  4A3K C;  4BY1 C;  3FKI K;  3GTO C;  3S16 K;  5M5X K;  5C44 C;  1TWG K;  2R7Z C;  3S1N K;  3S1M K;  4A3G C;  2JA6 C;  2R92 C;  4G7O A;  1IW7 A;  4A3M K;  2A69 A;  4A3C C;  1I50 C;  4QIW D;  3RZO C;  4LK1 A;  4BBR C;  2JA8 K;  3S2H K;  3HOV K;  3WOD A;  4Y7N C;  4BY7 K;  3I4M K;  1TWC K;  3FKI C;  4YFK A;  5FJ8 K;  3GTP K;  5IP7 K;  4AYB L;  5C4X C;  3S1N C;  4G7Z A;  3GTK K;  4BBR K;  3M3Y K;  3S1M C;  4KMU A;  2A6E A;  5M5W K;  1TWF C;  4A3E K;  2JA8 C;  3HOU K;  2NVQ K;  4OIP A;  1SFO C;  3S2D K;  1BDF A;  3PO3 K;  3S1Q K;  4BY7 C;  3I4M C;  3GTP C;  5IP7 C;  4C3H K;  5TMC A;  2PA8 D;  2E2J K;  3M3Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...