2Y0SL

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 20
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2y0sL00
4A3LK 2JA5C 5TMCA 1I3QK 3M3YK 4MEYA 3S17K 2A6EA 4A3KC 4BY1C 2JA5K 3WODA 3K7AC 2NVTC 1WCMC 4A3KK 4BY1K 4YFXA 3HOUC 3K7AK 2NVTK 4A3CC 4C2MK 1WCMK 4BBSC 3HOUK 1I6HC 4A3CK 2PPBA 4BBSK 4YFKA 1I6HK 3S16C 4YG2A 2NVYC 2E2JC 5IYCC 5IP7C 1R9TC 3S16K 4A3DC 2NVYK 5M5XK 2E2JK 3GTGC 3CQZK 5IYCK 3M3YC 5IP7K 3S1MC 3S15C 4G7OA 4A3DK 2WAQL 1K83C 3GTGK 1TWCC 2E2HC 4JK1A 3S15K 3HOWC 4A3JC 3PO3C 3S1MK 1K83K 3GTPC 3GTOC 1TWCK 3I4NC 2E2HK 3HOWK 3HOXC 4A3JK 3I4NK 3PO3K 3GTPK 3GTOK 4A93C 3HOZC 1TWHC 3HOXK 3M4OC 3RZOC 4KN7A 2A69A 4A93K 1SFOC 4MEXA 3HOZK 1TWHK 5M5YK 3M4OK 5M3MK 3RZOK 1SFOK 4NOIA 1YNNA 2A6HA 4OIOA 4A3GC 3H3VD 3GTKC 4A3GK 4G7ZA 3PO2C 4BXXC 3HKZD 1SMYA 4KMUA 4QJVB 3GTKK 3H3VL 3HOYC 1HQMA 2YU9C 3CQZC 4QJVA 3PO2K 4BXXK 3HOYK 4X6AC 4A3FC 3RZDC 3GTQC 2YU9K 2R7ZC 4X6AK 3HKZL 5M3FK 4A3MC 3S1NC 4A3FK 3RZDK 3GTQK 2R7ZK 4LLGA 5FJ8K 4A3MK 5M5WK 5IYDC 3S1NK 3FKIK 1Y1VC 4OIPA 4BY7C 4ZH4A 4LK1A 1TWAC 2PMZD 5IYDK 1Y1VK 4BY7K 2JA7K 1TWAK 5TMFA 2E2IC 2PMZL 4Y7NC 3S1RK 4OIQA 3HOVC 5C44C 2E2IK 4Y7NK 3HOVK 3I4MC 4KN4A 5C44K 1I50C 4A3IC 3EQLA 3I4MK 1BDFA 4LJZA 4C3IK 1I50K 4A3IK 4OINA 2NVXC 4Q5SA 1I6VA 5IP9C 5D4DA 4XLPA 2JA6C 2A68A 4Y52C 4OIRA 2R92C 2NVXK 2CW0A 5IP9K 2Y0SD 2JA8C 3GTJC 2JA6K 2WB1D 2R92K 4AYBD 1Y1WC 2O5IA 4Y52K 2JA8K 3GTJK 1Y1WK 4G7HA 3S2HC 1TWFC 3FKIC 2Y0SL 3S2DC 2R93C 2WB1L 2VUMC 4AYBL 1TWGK 3S2HK 5C3EC 1TWFK 2NVQC 3S2DK 2R93K 3S1QC 2VUMK 2JA7C 4C3JK 5C3EK 2B63C 2NVQK 5IYBC 3S1QK 3S1RC 3GTLC 2B63K 5IYBK 4MQ9A 4QIWD 3GTLK 1XPPA 5C4JC 2O5JA 5FLMC 4Q4ZA 1ZYRA 3H0GC 5C4JK 2PA8D 5FLMK 1YNJA 2BE5A 4QIWL 3H0GK 4XSZA 4A3EC 4LK0A 4A3BC 4GZYA 2WAQD 4A3EK 2PA8L 4A3BK 1IW7A 4XSXA 4BBRC 3DXJA 1R9TK 5C4XC 3S14C 4BBRK 3GTMC 5C4XK 3S14K 4YFNA 4XLNA 3GTMK 4A3LC 4C3HK 1TWGC 1I3QC 3S17C
chains in the Genus database with same CATH superfamily
1INNA 5TMCA 3S17K 4MEYA 2A6EA 3WODA 4XCHA 3K7AC 2NVTC 4C2MC 1WCMC 3AD8C 3K7AK 2NVTK 4A3CC 1F9NA 1WCMK 4C2MK 1UV7A 2FQTA 1I6HC 4A3CK 2PPBA 1I6HK 3GTJA 2ZUFA 5IYCC 4A3DC 5M5XK 1TWGA 1VH2A 3GTGC 5IYCK 1I3QA 3S1MC 4A3DK 2VUMA 3GTGK 1ISEA 1C0AA 3S1MK 4JK1A 3HOWC 5EGEA 3HOWK 2XCRB 1J6XA 3M4OC 4GTDA 3M4OK 4KB2A 3CAGA 1R9TA 4BXXC 4KMUA 2GSNA 3ERED 1XZQA 2E2HA 2YU9C 4BXXK 3RZDC 2YU9K 5M3FK 3RZDK 3AD9C 2JA5A 4LLGA 4KMAA 3Q3QA 4BY7C 1DCOA 1EK8A 1TWAC 2PMZD 1J6VA 2P5MA 4BY7K 3MMLB 1TWAK 2E2IC 1DCHA 2PMZL 3TFIA 1XZPA 3V4GA 2E2IK 4G0UA 1VLOA 3GEHA 2NVYA 1WQFA 3GDZA 5D4DA 4XLPA 1K83A 2V6SA 2GSOA 5TJ3A 2JA8C 3BP3A 3AH5A 4AYBD 2O5IA 2JA8K 3TFJA 3S2HC 4G7HA 1TWFC 3OREA 1TWHA 4AYBL 3S2HK 5C3EC 1TWFK 5L46A 3S1QC 1VJEA 5C3EK 3S1QK 3TTGA 4BLAA 4FM9A 2KWAA 5FLMC 2NVXA 1ZYRA 3H0GC 4O2DA 5FLMK 1WSRA 3H0GK 4A3EC 4LK0A 1EFWA 1EQRA 4P5AA 2RGRA 2D6FC 4A3BC 4GZYA 1O2BA 3GTQA 4A3EK 2R7ZA 4A3BK 4BLBA 2V6UA 4KB4A 3FKIA 1Y1VA 2JA7A 4GTCA 1BJTA 5JFEA 4KAWX 3HOUC 2CFAA 3HOUK 1ZVUA 3A8KA 4YFKA 5IOTA 3QX3A 2V6TA 3S16C 4YG2A 1BS2A 3S16K 3L4JA 3CQZK 4G7OA 2WAQL 4A3JC 3GTPC 1WCMA 5IOSA 4A3JK 3GTLA 3GTPK 4A93C 1B4AA 3RZOC 4A93K 2A69A 1SFOC 3GEEA 1WORA 5M5YK 5M3MK 3RZOK 1SFOK 4FZBA 4ILDA 4NOIA 3N0CA 2A6HA 4G7ZA 3HOYC 1SMYA 4QJVB 4J3NA 4QJVA 1O24A 3HOYK 1GE9A 4A3FC 4M1XA 4A3MC 4A3FK 4A3MK 3IPJA 4ZH4A 2GAHC 3OPFA 3TFHA 3HOVC 4KASA 3HOVK 4KN4A 1I50C 3EQLA 3AD7C 4LJZA 2YU9A 1I50K 2ZUEA 3N3YA 4Q5SA 1I6VA 3VA7A 1KQ4A 1TWCA 2CW0A 2Y0SD 3GTJC 2WB1D 1J98A 3GTJK 4KATA 3S2DC 2Y0SL 3T00A 4LQYA 4GFQA 2WB1L 2VUMC 2E2IA 1TWGK 4C3JC 4PABA 3S2DK 2VUMK 4C3JK 5IYBC 5IYBK 4MQ9A 4GTLA 1XXCA 5C4JC 4Q4ZA 5C4JK 2PA8D 1DCPA 2BE5A 3A8IA 2W7VA 3S0XA 2PHCB 2PA8L 4XSXA 1R9TK 5C4XC 3GTMC 5C4XK 4C3HC 4WILA 4YFNA 3GTMK 4A3LC 4C3HK 4AH6A 4A3LK 4GTEA 2JA5C 2JA5K 1O2FB 3OEPA 2JH3A 4YFXA 3SZYA 2EBBA 4C45A 4BBSC 5HL8A 4BBSK 3AQPA 1JQWA 2NVYC 3JSTA 1Y1WA 3FOEA 5IP7C 2NVYK 3LAPA 1USMA 5IP7K 3S15C 1K83C 3BUEA 4KDDA 1O29A 3PO3C 3S15K 1K83K 3GTOC 2B63A 3PO3K 3GTOK 4LOWA 3HOZC 1TWHC 4KN7A 4KMDA 3HOZK 1TWHK 1XXAA 4KMHA 1YNNA 4A3GC 3H3VD 3GTKC 4A3GK 3HKZD 3GTKK 3H3VL 1WIHA 4X6AC 3CQZC 3GTQC 2R7ZC 4X6AK 3ADAC 3HKZL 1BGWA 3GTQK 2R7ZK 1VRQC 4DDQA 5M5WK 1SFOA 3FKIK 1Y1VC 1Y1VK 4RMFA 2JA7K 4Y7NC 3S1RK 5C44C 4Y7NK 3I4MC 3FHZA 4C3IC 3GSIA 5C44K 4A3IC 3I4MK 1BDFA 4C3IK 4A3IK 3T02A 4P5BA 4OINA 3GTGA 1PJ7A 5IP9C 2JA6C 2R92C 5IP9K 2JA6K 2R92K 1WOSA 4PAAA 4KM9A 2R93C 4P9SA 2NVQC 2R93K 1ZXOA 1USOA 2NVQK 1I50A 3GTLC 2ZFZA 1O27A 3GTLK 1PJ6A 4GTBA 1O28A 3L4KA 3FOFA 1J6WA 1EI6A 4BBRC 1DD5A 1WQGA 4BBRK 1ZBSA 1TWAA 4XLNA 1TWGC 1I3QC 3M3YC 4WJ3M 1I3QK 3M3YK 4A3KC 4BY1C 3LAJA 3NUHA 1V5VA 4KM8A 1WOOA 5IORA 1F7VA 4G0WA 4A3KK 4BY1K 1HI9A 4BKWA 3N0BA 4WJ4A 1IE0A 3HXAA 1XZQB 3GTMA 2E2JC 1R9TC 2E2JK 1TWFA 5E68A 1TWCC 2E2HC 1G51A 3I4NC 1TWCK 2E2HK 1IL2A 3HOXC 3I4NK 1IBAA 4KARA 3SZZA 1O26A 3HOXK 1AB4A 1XZPB 4MEXA 1YX2A 3H0GA 2RH6A 5CJ9A 1WQHA 2FQOA 4OIOA 5JVOA 1L0WA 3PO2C 3G4AA 3PO2K 1HQMA 1EH1A 1F93A 3GTOA 2XCOA 3T01A 3S1NC 2XCQA 5FJ8K 5IYDC 3AQOA 1WOPA 3S1NK 4OIPA 1XXBA 4LK1A 4LR2A 5IYDK 5EGHA 5TMFA 4OIQA 1O2AA 2GSUA 3GTKA 1IS1A 1JOEA 5CHPA 4GTAA 3CQZA 1RU0A 2NVXC 2A68A 4Y52C 1ZQ1C 4OIRA 1X31C 2NVXK 1O25A 4G0VA 4Y52K 3GTPA 1Y1WC 4GT9A 1WSVA 1Y1WK 3FKIC 2GAGC 3G4CA 5IOQA 4GTFA 3A8JA 2JA7C 3GEIA 2B63C 3S1RC 2CFAB 2B63K 1JVIA 1VGXA 4QIWD 1PJ5A 1XPPA 2O5JA 1YCLA 1IQ0A 1F7UA 2JA6A 2R92A 1YNJA 4QIWL 4XSZA 2WAQD 3LPXA 4KC6A 2Y3PA 1IW7A 3DXJA 1B4BA 2R93A 3GIRA 3S14C 2P8TA 3S14K 3S17C 3BP8C
chains in the Genus database with same CATH topology
4A3LK 2JA5C 5TMCA 1I3QK 3M3YK 4MEYA 3S17K 2A6EA 4A3KC 4BY1C 2JA5K 3WODA 3K7AC 2NVTC 1WCMC 4A3KK 4BY1K 4YFXA 3HOUC 3K7AK 2NVTK 4A3CC 4C2MK 1WCMK 4BBSC 3HOUK 1I6HC 4A3CK 2PPBA 4BBSK 4YFKA 1I6HK 3S16C 4YG2A 2NVYC 2E2JC 5IYCC 5IP7C 1R9TC 3S16K 4A3DC 2NVYK 5M5XK 2E2JK 3GTGC 3CQZK 5IYCK 3M3YC 5IP7K 3S1MC 3S15C 4G7OA 4A3DK 2WAQL 1K83C 3GTGK 1TWCC 2E2HC 4JK1A 3S15K 3HOWC 4A3JC 3PO3C 3S1MK 1K83K 3GTPC 3GTOC 1TWCK 3I4NC 2E2HK 3HOWK 3HOXC 4A3JK 3I4NK 3PO3K 3GTPK 3GTOK 4A93C 3HOZC 1TWHC 3HOXK 3M4OC 3RZOC 4KN7A 2A69A 4A93K 1SFOC 4MEXA 3HOZK 1TWHK 5M5YK 3M4OK 5M3MK 3RZOK 1SFOK 4NOIA 1YNNA 2A6HA 4OIOA 4A3GC 3H3VD 3GTKC 4A3GK 4G7ZA 3PO2C 4BXXC 3HKZD 1SMYA 4KMUA 4QJVB 3GTKK 3H3VL 3HOYC 1HQMA 2YU9C 3CQZC 4QJVA 3PO2K 4BXXK 3HOYK 4X6AC 4A3FC 3RZDC 3GTQC 2YU9K 2R7ZC 4X6AK 3HKZL 5M3FK 4A3MC 3S1NC 4A3FK 3RZDK 3GTQK 2R7ZK 4LLGA 5FJ8K 4A3MK 5M5WK 5IYDC 3S1NK 3FKIK 1Y1VC 4OIPA 4BY7C 4ZH4A 4LK1A 1TWAC 2PMZD 5IYDK 1Y1VK 4BY7K 2JA7K 1TWAK 5TMFA 2E2IC 2PMZL 4Y7NC 3S1RK 4OIQA 3HOVC 5C44C 2E2IK 4Y7NK 3HOVK 3I4MC 4KN4A 5C44K 1I50C 4A3IC 3EQLA 3I4MK 1BDFA 4LJZA 4C3IK 1I50K 4A3IK 4OINA 2NVXC 4Q5SA 1I6VA 5IP9C 5D4DA 4XLPA 2JA6C 2A68A 4Y52C 4OIRA 2R92C 2NVXK 2CW0A 5IP9K 2Y0SD 2JA8C 3GTJC 2JA6K 2WB1D 2R92K 4AYBD 1Y1WC 2O5IA 4Y52K 2JA8K 3GTJK 1Y1WK 4G7HA 3S2HC 1TWFC 3FKIC 2Y0SL 3S2DC 2R93C 2WB1L 2VUMC 4AYBL 1TWGK 3S2HK 5C3EC 1TWFK 2NVQC 3S2DK 2R93K 3S1QC 2VUMK 2JA7C 4C3JK 5C3EK 2B63C 2NVQK 5IYBC 3S1QK 3S1RC 3GTLC 2B63K 5IYBK 4MQ9A 4QIWD 3GTLK 1XPPA 5C4JC 2O5JA 5FLMC 4Q4ZA 1ZYRA 3H0GC 5C4JK 2PA8D 5FLMK 1YNJA 2BE5A 4QIWL 3H0GK 4XSZA 4A3EC 4LK0A 4A3BC 4GZYA 2WAQD 4A3EK 2PA8L 4A3BK 1IW7A 4XSXA 4BBRC 3DXJA 1R9TK 5C4XC 3S14C 4BBRK 3GTMC 5C4XK 3S14K 4YFNA 4XLNA 3GTMK 4A3LC 4C3HK 1TWGC 1I3QC 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L K;  2JA5 C;  5TMC A;  1I3Q K;  3M3Y K;  4MEY A;  3S17 K;  2A6E A;  4A3K C;  4BY1 C;  2JA5 K;  3WOD A;  3K7A C;  2NVT C;  1WCM C;  4A3K K;  4BY1 K;  4YFX A;  3HOU C;  3K7A K;  2NVT K;  4A3C C;  4C2M K;  1WCM K;  4BBS C;  3HOU K;  1I6H C;  4A3C K;  2PPB A;  4BBS K;  4YFK A;  1I6H K;  3S16 C;  4YG2 A;  2NVY C;  2E2J C;  5IYC C;  5IP7 C;  1R9T C;  3S16 K;  4A3D C;  2NVY K;  5M5X K;  2E2J K;  3GTG C;  3CQZ K;  5IYC K;  3M3Y C;  5IP7 K;  3S1M C;  3S15 C;  4G7O A;  4A3D K;  2WAQ L;  1K83 C;  3GTG K;  1TWC C;  2E2H C;  4JK1 A;  3S15 K;  3HOW C;  4A3J C;  3PO3 C;  3S1M K;  1K83 K;  3GTP C;  3GTO C;  1TWC K;  3I4N C;  2E2H K;  3HOW K;  3HOX C;  4A3J K;  3I4N K;  3PO3 K;  3GTP K;  3GTO K;  4A93 C;  3HOZ C;  1TWH C;  3HOX K;  3M4O C;  3RZO C;  4KN7 A;  2A69 A;  4A93 K;  1SFO C;  4MEX A;  3HOZ K;  1TWH K;  5M5Y K;  3M4O K;  5M3M K;  3RZO K;  1SFO K;  4NOI A;  1YNN A;  2A6H A;  4OIO A;  4A3G C;  3H3V D;  3GTK C;  4A3G K;  4G7Z A;  3PO2 C;  4BXX C;  3HKZ D;  1SMY A;  4KMU A;  4QJV B;  3GTK K;  3H3V L;  3HOY C;  1HQM A;  2YU9 C;  3CQZ C;  4QJV A;  3PO2 K;  4BXX K;  3HOY K;  4X6A C;  4A3F C;  3RZD C;  3GTQ C;  2YU9 K;  2R7Z C;  4X6A K;  3HKZ L;  5M3F K;  4A3M C;  3S1N C;  4A3F K;  3RZD K;  3GTQ K;  2R7Z K;  4LLG A;  5FJ8 K;  4A3M K;  5M5W K;  5IYD C;  3S1N K;  3FKI K;  1Y1V C;  4OIP A;  4BY7 C;  4ZH4 A;  4LK1 A;  1TWA C;  2PMZ D;  5IYD K;  1Y1V K;  4BY7 K;  2JA7 K;  1TWA K;  5TMF A;  2E2I C;  2PMZ L;  4Y7N C;  3S1R K;  4OIQ A;  3HOV C;  5C44 C;  2E2I K;  4Y7N K;  3HOV K;  3I4M C;  4KN4 A;  5C44 K;  1I50 C;  4A3I C;  3EQL A;  3I4M K;  1BDF A;  4LJZ A;  4C3I K;  1I50 K;  4A3I K;  4OIN A;  2NVX C;  4Q5S A;  1I6V A;  5IP9 C;  5D4D A;  4XLP A;  2JA6 C;  2A68 A;  4Y52 C;  4OIR A;  2R92 C;  2NVX K;  2CW0 A;  5IP9 K;  2Y0S D;  2JA8 C;  3GTJ C;  2JA6 K;  2WB1 D;  2R92 K;  4AYB D;  1Y1W C;  2O5I A;  4Y52 K;  2JA8 K;  3GTJ K;  1Y1W K;  4G7H A;  3S2H C;  1TWF C;  3FKI C;  2Y0S L;  3S2D C;  2R93 C;  2WB1 L;  2VUM C;  4AYB L;  1TWG K;  3S2H K;  5C3E C;  1TWF K;  2NVQ C;  3S2D K;  2R93 K;  3S1Q C;  2VUM K;  2JA7 C;  4C3J K;  5C3E K;  2B63 C;  2NVQ K;  5IYB C;  3S1Q K;  3S1R C;  3GTL C;  2B63 K;  5IYB K;  4MQ9 A;  4QIW D;  3GTL K;  1XPP A;  5C4J C;  2O5J A;  5FLM C;  4Q4Z A;  1ZYR A;  3H0G C;  5C4J K;  2PA8 D;  5FLM K;  1YNJ A;  2BE5 A;  4QIW L;  3H0G K;  4XSZ A;  4A3E C;  4LK0 A;  4A3B C;  4GZY A;  2WAQ D;  4A3E K;  2PA8 L;  4A3B K;  1IW7 A;  4XSX A;  4BBR C;  3DXJ A;  1R9T K;  5C4X C;  3S14 C;  4BBR K;  3GTM C;  5C4X K;  3S14 K;  4YFN A;  4XLN A;  3GTM K;  4A3L C;  4C3H K;  1TWG C;  1I3Q C;  3S17 C; 
#chains in the Genus database with same CATH topology
 1INN A;  5TMC A;  3S17 K;  4MEY A;  2A6E A;  3WOD A;  4XCH A;  3K7A C;  2NVT C;  4C2M C;  1WCM C;  3AD8 C;  3K7A K;  2NVT K;  4A3C C;  1F9N A;  1WCM K;  4C2M K;  1UV7 A;  2FQT A;  1I6H C;  4A3C K;  2PPB A;  1I6H K;  3GTJ A;  2ZUF A;  5IYC C;  4A3D C;  5M5X K;  1TWG A;  1VH2 A;  3GTG C;  5IYC K;  1I3Q A;  3S1M C;  4A3D K;  2VUM A;  3GTG K;  1ISE A;  1C0A A;  3S1M K;  4JK1 A;  3HOW C;  5EGE A;  3HOW K;  2XCR B;  1J6X A;  3M4O C;  4GTD A;  3M4O K;  4KB2 A;  3CAG A;  1R9T A;  4BXX C;  4KMU A;  2GSN A;  3ERE D;  1XZQ A;  2E2H A;  2YU9 C;  4BXX K;  3RZD C;  2YU9 K;  5M3F K;  3RZD K;  3AD9 C;  2JA5 A;  4LLG A;  4KMA A;  3Q3Q A;  4BY7 C;  1DCO A;  1EK8 A;  1TWA C;  2PMZ D;  1J6V A;  2P5M A;  4BY7 K;  3MML B;  1TWA K;  2E2I C;  1DCH A;  2PMZ L;  3TFI A;  1XZP A;  3V4G A;  2E2I K;  4G0U A;  1VLO A;  3GEH A;  2NVY A;  1WQF A;  3GDZ A;  5D4D A;  4XLP A;  1K83 A;  2V6S A;  2GSO A;  5TJ3 A;  2JA8 C;  3BP3 A;  3AH5 A;  4AYB D;  2O5I A;  2JA8 K;  3TFJ A;  3S2H C;  4G7H A;  1TWF C;  3ORE A;  1TWH A;  4AYB L;  3S2H K;  5C3E C;  1TWF K;  5L46 A;  3S1Q C;  1VJE A;  5C3E K;  3S1Q K;  3TTG A;  4BLA A;  4FM9 A;  2KWA A;  5FLM C;  2NVX A;  1ZYR A;  3H0G C;  4O2D A;  5FLM K;  1WSR A;  3H0G K;  4A3E C;  4LK0 A;  1EFW A;  1EQR A;  4P5A A;  2RGR A;  2D6F C;  4A3B C;  4GZY A;  1O2B A;  3GTQ A;  4A3E K;  2R7Z A;  4A3B K;  4BLB A;  2V6U A;  4KB4 A;  3FKI A;  1Y1V A;  2JA7 A;  4GTC A;  1BJT A;  5JFE A;  4KAW X;  3HOU C;  2CFA A;  3HOU K;  1ZVU A;  3A8K A;  4YFK A;  5IOT A;  3QX3 A;  2V6T A;  3S16 C;  4YG2 A;  1BS2 A;  3S16 K;  3L4J A;  3CQZ K;  4G7O A;  2WAQ L;  4A3J C;  3GTP C;  1WCM A;  5IOS A;  4A3J K;  3GTL A;  3GTP K;  4A93 C;  1B4A A;  3RZO C;  4A93 K;  2A69 A;  1SFO C;  3GEE A;  1WOR A;  5M5Y K;  5M3M K;  3RZO K;  1SFO K;  4FZB A;  4ILD A;  4NOI A;  3N0C A;  2A6H A;  4G7Z A;  3HOY C;  1SMY A;  4QJV B;  4J3N A;  4QJV A;  1O24 A;  3HOY K;  1GE9 A;  4A3F C;  4M1X A;  4A3M C;  4A3F K;  4A3M K;  3IPJ A;  4ZH4 A;  2GAH C;  3OPF A;  3TFH A;  3HOV C;  4KAS A;  3HOV K;  4KN4 A;  1I50 C;  3EQL A;  3AD7 C;  4LJZ A;  2YU9 A;  1I50 K;  2ZUE A;  3N3Y A;  4Q5S A;  1I6V A;  3VA7 A;  1KQ4 A;  1TWC A;  2CW0 A;  2Y0S D;  3GTJ C;  2WB1 D;  1J98 A;  3GTJ K;  4KAT A;  3S2D C;  2Y0S L;  3T00 A;  4LQY A;  4GFQ A;  2WB1 L;  2VUM C;  2E2I A;  1TWG K;  4C3J C;  4PAB A;  3S2D K;  2VUM K;  4C3J K;  5IYB C;  5IYB K;  4MQ9 A;  4GTL A;  1XXC A;  5C4J C;  4Q4Z A;  5C4J K;  2PA8 D;  1DCP A;  2BE5 A;  3A8I A;  2W7V A;  3S0X A;  2PHC B;  2PA8 L;  4XSX A;  1R9T K;  5C4X C;  3GTM C;  5C4X K;  4C3H C;  4WIL A;  4YFN A;  3GTM K;  4A3L C;  4C3H K;  4AH6 A;  4A3L K;  4GTE A;  2JA5 C;  2JA5 K;  1O2F B;  3OEP A;  2JH3 A;  4YFX A;  3SZY A;  2EBB A;  4C45 A;  4BBS C;  5HL8 A;  4BBS K;  3AQP A;  1JQW A;  2NVY C;  3JST A;  1Y1W A;  3FOE A;  5IP7 C;  2NVY K;  3LAP A;  1USM A;  5IP7 K;  3S15 C;  1K83 C;  3BUE A;  4KDD A;  1O29 A;  3PO3 C;  3S15 K;  1K83 K;  3GTO C;  2B63 A;  3PO3 K;  3GTO K;  4LOW A;  3HOZ C;  1TWH C;  4KN7 A;  4KMD A;  3HOZ K;  1TWH K;  1XXA A;  4KMH A;  1YNN A;  4A3G C;  3H3V D;  3GTK C;  4A3G K;  3HKZ D;  3GTK K;  3H3V L;  1WIH A;  4X6A C;  3CQZ C;  3GTQ C;  2R7Z C;  4X6A K;  3ADA C;  3HKZ L;  1BGW A;  3GTQ K;  2R7Z K;  1VRQ C;  4DDQ A;  5M5W K;  1SFO A;  3FKI K;  1Y1V C;  1Y1V K;  4RMF A;  2JA7 K;  4Y7N C;  3S1R K;  5C44 C;  4Y7N K;  3I4M C;  3FHZ A;  4C3I C;  3GSI A;  5C44 K;  4A3I C;  3I4M K;  1BDF A;  4C3I K;  4A3I K;  3T02 A;  4P5B A;  4OIN A;  3GTG A;  1PJ7 A;  5IP9 C;  2JA6 C;  2R92 C;  5IP9 K;  2JA6 K;  2R92 K;  1WOS A;  4PAA A;  4KM9 A;  2R93 C;  4P9S A;  2NVQ C;  2R93 K;  1ZXO A;  1USO A;  2NVQ K;  1I50 A;  3GTL C;  2ZFZ A;  1O27 A;  3GTL K;  1PJ6 A;  4GTB A;  1O28 A;  3L4K A;  3FOF A;  1J6W A;  1EI6 A;  4BBR C;  1DD5 A;  1WQG A;  4BBR K;  1ZBS A;  1TWA A;  4XLN A;  1TWG C;  1I3Q C;  3M3Y C;  4WJ3 M;  1I3Q K;  3M3Y K;  4A3K C;  4BY1 C;  3LAJ A;  3NUH A;  1V5V A;  4KM8 A;  1WOO A;  5IOR A;  1F7V A;  4G0W A;  4A3K K;  4BY1 K;  1HI9 A;  4BKW A;  3N0B A;  4WJ4 A;  1IE0 A;  3HXA A;  1XZQ B;  3GTM A;  2E2J C;  1R9T C;  2E2J K;  1TWF A;  5E68 A;  1TWC C;  2E2H C;  1G51 A;  3I4N C;  1TWC K;  2E2H K;  1IL2 A;  3HOX C;  3I4N K;  1IBA A;  4KAR A;  3SZZ A;  1O26 A;  3HOX K;  1AB4 A;  1XZP B;  4MEX A;  1YX2 A;  3H0G A;  2RH6 A;  5CJ9 A;  1WQH A;  2FQO A;  4OIO A;  5JVO A;  1L0W A;  3PO2 C;  3G4A A;  3PO2 K;  1HQM A;  1EH1 A;  1F93 A;  3GTO A;  2XCO A;  3T01 A;  3S1N C;  2XCQ A;  5FJ8 K;  5IYD C;  3AQO A;  1WOP A;  3S1N K;  4OIP A;  1XXB A;  4LK1 A;  4LR2 A;  5IYD K;  5EGH A;  5TMF A;  4OIQ A;  1O2A A;  2GSU A;  3GTK A;  1IS1 A;  1JOE A;  5CHP A;  4GTA A;  3CQZ A;  1RU0 A;  2NVX C;  2A68 A;  4Y52 C;  1ZQ1 C;  4OIR A;  1X31 C;  2NVX K;  1O25 A;  4G0V A;  4Y52 K;  3GTP A;  1Y1W C;  4GT9 A;  1WSV A;  1Y1W K;  3FKI C;  2GAG C;  3G4C A;  5IOQ A;  4GTF A;  3A8J A;  2JA7 C;  3GEI A;  2B63 C;  3S1R C;  2CFA B;  2B63 K;  1JVI A;  1VGX A;  4QIW D;  1PJ5 A;  1XPP A;  2O5J A;  1YCL A;  1IQ0 A;  1F7U A;  2JA6 A;  2R92 A;  1YNJ A;  4QIW L;  4XSZ A;  2WAQ D;  3LPX A;  4KC6 A;  2Y3P A;  1IW7 A;  3DXJ A;  1B4B A;  2R93 A;  3GIR A;  3S14 C;  2P8T A;  3S14 K;  3S17 C;  3BP8 C; 
#chains in the Genus database with same CATH homology
 4A3L K;  2JA5 C;  5TMC A;  1I3Q K;  3M3Y K;  4MEY A;  3S17 K;  2A6E A;  4A3K C;  4BY1 C;  2JA5 K;  3WOD A;  3K7A C;  2NVT C;  1WCM C;  4A3K K;  4BY1 K;  4YFX A;  3HOU C;  3K7A K;  2NVT K;  4A3C C;  4C2M K;  1WCM K;  4BBS C;  3HOU K;  1I6H C;  4A3C K;  2PPB A;  4BBS K;  4YFK A;  1I6H K;  3S16 C;  4YG2 A;  2NVY C;  2E2J C;  5IYC C;  5IP7 C;  1R9T C;  3S16 K;  4A3D C;  2NVY K;  5M5X K;  2E2J K;  3GTG C;  3CQZ K;  5IYC K;  3M3Y C;  5IP7 K;  3S1M C;  3S15 C;  4G7O A;  4A3D K;  2WAQ L;  1K83 C;  3GTG K;  1TWC C;  2E2H C;  4JK1 A;  3S15 K;  3HOW C;  4A3J C;  3PO3 C;  3S1M K;  1K83 K;  3GTP C;  3GTO C;  1TWC K;  3I4N C;  2E2H K;  3HOW K;  3HOX C;  4A3J K;  3I4N K;  3PO3 K;  3GTP K;  3GTO K;  4A93 C;  3HOZ C;  1TWH C;  3HOX K;  3M4O C;  3RZO C;  4KN7 A;  2A69 A;  4A93 K;  1SFO C;  4MEX A;  3HOZ K;  1TWH K;  5M5Y K;  3M4O K;  5M3M K;  3RZO K;  1SFO K;  4NOI A;  1YNN A;  2A6H A;  4OIO A;  4A3G C;  3H3V D;  3GTK C;  4A3G K;  4G7Z A;  3PO2 C;  4BXX C;  3HKZ D;  1SMY A;  4KMU A;  4QJV B;  3GTK K;  3H3V L;  3HOY C;  1HQM A;  2YU9 C;  3CQZ C;  4QJV A;  3PO2 K;  4BXX K;  3HOY K;  4X6A C;  4A3F C;  3RZD C;  3GTQ C;  2YU9 K;  2R7Z C;  4X6A K;  3HKZ L;  5M3F K;  4A3M C;  3S1N C;  4A3F K;  3RZD K;  3GTQ K;  2R7Z K;  4LLG A;  5FJ8 K;  4A3M K;  5M5W K;  5IYD C;  3S1N K;  3FKI K;  1Y1V C;  4OIP A;  4BY7 C;  4ZH4 A;  4LK1 A;  1TWA C;  2PMZ D;  5IYD K;  1Y1V K;  4BY7 K;  2JA7 K;  1TWA K;  5TMF A;  2E2I C;  2PMZ L;  4Y7N C;  3S1R K;  4OIQ A;  3HOV C;  5C44 C;  2E2I K;  4Y7N K;  3HOV K;  3I4M C;  4KN4 A;  5C44 K;  1I50 C;  4A3I C;  3EQL A;  3I4M K;  1BDF A;  4LJZ A;  4C3I K;  1I50 K;  4A3I K;  4OIN A;  2NVX C;  4Q5S A;  1I6V A;  5IP9 C;  5D4D A;  4XLP A;  2JA6 C;  2A68 A;  4Y52 C;  4OIR A;  2R92 C;  2NVX K;  2CW0 A;  5IP9 K;  2Y0S D;  2JA8 C;  3GTJ C;  2JA6 K;  2WB1 D;  2R92 K;  4AYB D;  1Y1W C;  2O5I A;  4Y52 K;  2JA8 K;  3GTJ K;  1Y1W K;  4G7H A;  3S2H C;  1TWF C;  3FKI C;  2Y0S L;  3S2D C;  2R93 C;  2WB1 L;  2VUM C;  4AYB L;  1TWG K;  3S2H K;  5C3E C;  1TWF K;  2NVQ C;  3S2D K;  2R93 K;  3S1Q C;  2VUM K;  2JA7 C;  4C3J K;  5C3E K;  2B63 C;  2NVQ K;  5IYB C;  3S1Q K;  3S1R C;  3GTL C;  2B63 K;  5IYB K;  4MQ9 A;  4QIW D;  3GTL K;  1XPP A;  5C4J C;  2O5J A;  5FLM C;  4Q4Z A;  1ZYR A;  3H0G C;  5C4J K;  2PA8 D;  5FLM K;  1YNJ A;  2BE5 A;  4QIW L;  3H0G K;  4XSZ A;  4A3E C;  4LK0 A;  4A3B C;  4GZY A;  2WAQ D;  4A3E K;  2PA8 L;  4A3B K;  1IW7 A;  4XSX A;  4BBR C;  3DXJ A;  1R9T K;  5C4X C;  3S14 C;  4BBR K;  3GTM C;  5C4X K;  3S14 K;  4YFN A;  4XLN A;  3GTM K;  4A3L C;  4C3H K;  1TWG C;  1I3Q C;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...