2Y0SL

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 20
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2y0sL00
2PMZL 2JA6K 2R93K 3GTPK 5C44K 1XPPA 4YFKA 1R9TK 2PA8D 3S2HK 3FKIC 4C3JK 2NVYC 2NVQC 1WCMC 3HOZC 3S15K 4A3LK 4G7ZA 4BBSK 4Y52C 1YNJA 3S2DK 1TWFC 4GZYA 4A3BC 5IP7K 5C3EK 4Y7NK 2PMZD 5IP9C 3GTJK 2E2HK 5IP7C 2JA5C 3PO2K 3S14C 3S2DC 5TMFA 1SMYA 3GTKC 2PA8L 4LJZA 2E2IC 4Y7NC 5C3EC 3S1RK 1TWFK 1TWCK 3HOYK 4A3MK 4A3CK 4A3DK 5TMCA 2E2JK 5M5XK 3S1MK 5IYDC 1ZYRA 3FKIK 4XLPA 3HOUK 3S2HC 3S1QK 4AYBL 2R92C 4C2MK 3HOVK 5FLMK 4ZH4A 5M5YK 3K7AK 4NOIA 2JA8C 1TWAC 3GTGC 4A3FK 3HOWK 2JA6C 4A93K 2NVTC 5M5WK 4A3FC 3HOXC 3HOWC 2JA8K 3PO3K 2YU9K 4X6AK 1HQMA 3H0GC 1I6HK 4OINA 1I50C 5IYCK 3M4OC 3S16K 3DXJA 2WAQD 1TWGK 4BY1K 3GTMC 3GTLC 2NVXK 2JA7K 1I50K 5IYCC 5C4XC 4A3CC 3RZDK 3H0GK 4LK1A 4QJVB 4MEYA 2CW0A 4G7HA 4A3DC 1TWGC 4QIWL 3GTJC 4YFNA 4A3IK 1SFOK 2JA5K 4BY1C 3GTOK 3S16C 4BY7C 2PPBA 2B63C 4Q4ZA 4A3BK 2A6EA 3WODA 4BBRC 3K7AC 2E2HC 2WAQL 5IP9K 4KN4A 2R7ZK 3S15C 2A6HA 3HOZK 5IYBK 2Y0SL 5C4JC 4OIPA 4BBSC 3EQLA 4KN7A 1TWHC 2A69A 3HOVC 1YNNA 4LLGA 4OIOA 2R92K 5C4JK 3S17K 3S1NK 5IYBC 3H3VD 4Q5SA 4XSXA 2E2JC 3S1MC 5IYDK 2VUMK 3CQZC 4A3EK 1TWHK 3GTKK 5C44C 3GTPC 4KMUA 1I3QK 3RZOK 3I4NC 2E2IK 5M3FK 3GTOC 4BY7K 2Y0SD 4A3IC 1SFOC 2WB1L 4A3KK 3M3YK 4A3GC 4BBRK 4C3HK 1I3QC 4Y52K 5D4DA 3H3VL 1BDFA 5M3MK 4A3LC 3CQZK 4A3EC 2NVXC 2O5IA 4LK0A 3GTLK 3M4OK 1I6VA 4G7OA 4MEXA 4C3IK 5C4XK 2JA7C 2R93C 2NVYK 2NVQK 3PO3C 3S17C 3S1NC 1Y1WK 1R9TC 4YFXA 2R7ZC 4X6AC 4MQ9A 4A3JK 1Y1VC 3I4MC 1K83K 3GTQC 4QIWD 2BE5A 2B63K 4QJVA 3S1QC 4XLNA 3HKZL 3HOUC 1K83C 3GTQK 1Y1VK 3I4MK 5FLMC 1IW7A 3RZDC 1Y1WC 4A3MC 1TWCC 4AYBD 4BXXC 4YG2A 2A68A 1I6HC 4BXXK 3S1RC 2YU9C 3HOYC 4A3KC 4JK1A 4A3GK 3GTMK 3HKZD 4OIRA 3I4NK 3RZOC 5FJ8K 3PO2C 1TWAK 3GTGK 3M3YC 2WB1D 4A3JC 3S14K 3HOXK 2O5JA 2NVTK 4OIQA 4A93C 2VUMC 4XSZA 1WCMK
chains in the Genus database with same CATH superfamily
5CHPA 1WORA 4YFKA 5TJ3A 1O26A 1XXAA 3S15K 4A3LK 1JOEA 4Y52C 4G0VA 3TFHA 4LR2A 2PMZD 1B4BA 5IP9C 3S14C 2JA5A 5TMFA 1SMYA 2PA8L 3IPJA 5C3EC 2CFAB 4PABA 1TWFK 3T01A 4A3CK 3S0XA 5M5XK 3S1MK 5IYDC 2GSNA 3FKIK 3VA7A 3OPFA 4C2MK 3HOVK 3BUEA 5M5YK 4NOIA 2JA8C 4M1XA 4A3FK 2R7ZA 4WJ3M 4A3FC 1HQMA 1ZXOA 1I50C 5IYCK 3M4OC 3H0GA 1RU0A 3Q3QA 1TWCA 1I50K 5IYCC 4LK1A 1WQGA 2GAGC 2JA5K 4WJ4A 4A3IK 2YU9A 2B63C 1DCPA 4Q4ZA 4A3BK 5IP9K 3AD7C 1O24A 2A6HA 2XCQA 4C45A 1TWHC 4J3NA 1XZQB 4LLGA 3S1NK 5C4JK 5IYBC 5L46A 1BJTA 2E2IK 4BY7K 4A3KK 4C3HK 4Y52K 5D4DA 1BDFA 4A3LC 2GSUA 3CQZK 2XCOA 4KMAA 4MEXA 4GTBA 5C4XK 1USOA 1XXCA 1BGWA 4ILDA 1WOSA 2GAHC 3LPXA 5EGEA 3GTQA 1EK8A 1L0WA 3A8IA 4DDQA 4XCHA 1K83A 2BE5A 2B63K 5HL8A 4XLNA 1Y1VK 1WIHA 3RZDC 4A3MC 1TWCC 4O2DA 4GTFA 4AYBD 1F7VA 3GTLA 1PJ6A 1EQRA 3S1RC 4BXXK 4A3GK 4JK1A 2V6UA 4KB2A 4OIRA 1O29A 2XCRB 3GTGK 5IOTA 1ZVUA 3GEIA 4BLAA 1C0AA 1WCMK 1O27A 2JA6K 2KWAA 2R93K 1XPPA 1R9TK 4KM8A 4C3JK 5IOQA 2NVQC 1VGXA 4G7ZA 3S2DK 1TWFC 5IP7K 5C3EK 5EGHA 4KATA 5IP7C 1IL2A 3GTOA 3S2DC 1ZBSA 2V6SA 3G4AA 3TFJA 3GTKA 4GTDA 1VH2A 3JSTA 2R92A 1ZYRA 3S1QK 4AYBL 5E68A 5FLMK 3GTGC 3MMLB 2JA6C 4BKWA 1XXBA 2NVTC 3HOWC 2JA8K 1KQ4A 1PJ5A 4X6AK 5IOSA 1B4AA 3L4KA 3CAGA 3H0GC 1ISEA 1WOPA 3S16K 3DXJA 1TWGK 2NVXK 2JA7K 1TWGA 4A3CC 3RZDK 2P8TA 4QJVB 4G7HA 3AD9C 1TWGC 1SFOK 3GTOK 2PPBA 3GTJA 3WODA 4BBRC 3K7AC 3AD8C 1J6XA 2Y0SL 4OIPA 4BBSC 4LOWA 3EQLA 3FHZA 1O2AA 4C3IC 1YNNA 4OIOA 4Q5SA 2RGRA 2E2JC 3CQZC 3GTKK 5C44C 1WCMA 1I3QK 1V5VA 3RZOK 3I4NC 3AQOA 5M3FK 3GTOC 1F93A 3GDZA 4FM9A 4A3GC 4BBRK 3HXAA 4KB4A 2NVXC 2O5IA 2ZUEA 2FQOA 2D6FC 3SZYA 1R9TA 2NVYK 3PO3C 3S17C 2Y3PA 3S1NC 1R9TC 1Y1VA 2JA6A 4A3JK 1WSVA 4KDDA 1TWAA 3S1QC 3HKZL 3HOUC 1K83C 1XZPB 1XZPA 3GTQK 3I4MK 4G0WA 1Y1WC 1VRQC 1G51A 1IE0A 4BLBA 2A68A 4YG2A 1I6HC 4GTCA 1EFWA 4A3KC 1INNA 4KASA 5FJ8K 3PO2C 4A3JC 2V6TA 4XSZA 1TWHA 1F7UA 3GTPK 1J6WA 3OREA 3FKIC 2NVYC 1WCMC 1VLOA 3CQZA 3TTGA 4A3BC 4Y7NK 2JA5C 2E2HK 3PO2K 2PHCB 2E2IA 3GTKC 3S1RK 1TWCK 1AB4A 3V4GA 2E2JK 4GTAA 4XLPA 3HOUK 3S2HC 1O2FB 5JFEA 1USMA 4GFQA 1IBAA 5CJ9A 1PJ7A 4GT9A 5M5WK 4PAAA 3PO3K 2YU9K 4KAWX 3GTMC 4RMFA 1I50A 3L4JA 1BS2A 4A3DC 3H0GK 3S16C 4BY7C 3A8JA 2E2HA 4C3HC 3A8KA 1ZQ1C 2R7ZK 3S15C 3HOZK 5IYBK 1IS1A 3ERED 3FKIA 2A69A 1O28A 2ZUFA 4P9SA 5IYDK 1X31C 3GTPA 1TWFA 4A3EK 1JQWA 1TWHK 3FOFA 2Y0SD 1DCHA 1SFOC 2WB1L 2W7VA 3M3YK 4FZBA 4G0UA 2JA7C 2NVQK 1Y1WK 3GSIA 2R7ZC 4X6AC 4MQ9A 3I4MC 1WSRA 5FLMC 1IW7A 1O25A 2GSOA 1UV7A 3TFIA 4BXXC 4GTLA 2YU9C 3GTMK 4KMDA 2P5MA 3HKZD 1TWAK 3M3YC 3SZZA 3T02A 3HOXK 2FQTA 4A93C 1XZQA 2VUMC 4KC6A 2PMZL 4C3JC 4LQYA 2VUMA 3AH5A 5C44K 2NVYA 2PA8D 3S2HK 3BP3A 2RH6A 1F9NA 3N0CA 3HOZC 4BBSK 1YNJA 4GZYA 1WOOA 4P5AA 3GTJK 1YX2A 3AQPA 1SFOA 3QX3A 4LJZA 1I3QA 2E2IC 4Y7NC 3HOYK 3GEHA 2NVXA 2JA7A 4A3MK 4A3DK 4WILA 4P5BA 1EH1A 5TMCA 2R92C 1WQFA 4ZH4A 1YCLA 3K7AK 1TWAC 3HOWK 5IORA 4A93K 3HOXC 3ADAC 3GIRA 3N3YA 2CFAA 1I6HK 4OINA 2WAQD 4BY1K 3GTLC 5C4XC 4MEYA 3N0BA 2CW0A 4QIWL 3GTJC 4BY1C 4YFNA 2A6EA 2EBBA 2E2HC 2WAQL 4KN4A 3GEEA 3FOEA 5C4JC 4KN7A 1GE9A 4C2MC 3HOVC 2R92K 2ZFZA 3S17K 1J98A 3H3VD 4XSXA 3S1MC 2VUMK 3GTPC 4KMUA 4KARA 1O2BA 4GTEA 4A3IC 1I3QC 1EI6A 3H3VL 5M3MK 4A3EC 4LK0A 3GTLK 3M4OK 1I6VA 4G7OA 4C3IK 1IQ0A 2R93C 1JVIA 1DD5A 3G4CA 2R93A 4YFXA 3LAPA 3OEPA 1Y1VC 1K83K 3GTQC 4QIWD 1WQHA 3NUHA 4QJVA 1VJEA 3GTGA 4KM9A 1Y1WA 3GTMA 4AH6A 4KMHA 1HI9A 3HOYC 1J6VA 3LAJA 3I4NK 3RZOC 1DCOA 3S14K 2O5JA 2WB1D 3T00A 2B63A 2NVTK 4OIQA 2JH3A 3BP8C 5JVOA
chains in the Genus database with same CATH topology
2PMZL 2JA6K 2R93K 3GTPK 5C44K 1XPPA 4YFKA 1R9TK 2PA8D 3S2HK 3FKIC 4C3JK 2NVYC 2NVQC 1WCMC 3HOZC 3S15K 4A3LK 4G7ZA 4BBSK 4Y52C 1YNJA 3S2DK 1TWFC 4GZYA 4A3BC 5IP7K 5C3EK 4Y7NK 2PMZD 5IP9C 3GTJK 2E2HK 5IP7C 2JA5C 3PO2K 3S14C 3S2DC 5TMFA 1SMYA 3GTKC 2PA8L 4LJZA 2E2IC 4Y7NC 5C3EC 3S1RK 1TWFK 1TWCK 3HOYK 4A3MK 4A3CK 4A3DK 5TMCA 2E2JK 5M5XK 3S1MK 5IYDC 1ZYRA 3FKIK 4XLPA 3HOUK 3S2HC 3S1QK 4AYBL 2R92C 4C2MK 3HOVK 5FLMK 4ZH4A 5M5YK 3K7AK 4NOIA 2JA8C 1TWAC 3GTGC 4A3FK 3HOWK 2JA6C 4A93K 2NVTC 5M5WK 4A3FC 3HOXC 3HOWC 2JA8K 3PO3K 2YU9K 4X6AK 1HQMA 3H0GC 1I6HK 4OINA 1I50C 5IYCK 3M4OC 3S16K 3DXJA 2WAQD 1TWGK 4BY1K 3GTMC 3GTLC 2NVXK 2JA7K 1I50K 5IYCC 5C4XC 4A3CC 3RZDK 3H0GK 4LK1A 4QJVB 4MEYA 2CW0A 4G7HA 4A3DC 1TWGC 4QIWL 3GTJC 4YFNA 4A3IK 1SFOK 2JA5K 4BY1C 3GTOK 3S16C 4BY7C 2PPBA 2B63C 4Q4ZA 4A3BK 2A6EA 3WODA 4BBRC 3K7AC 2E2HC 2WAQL 5IP9K 4KN4A 2R7ZK 3S15C 2A6HA 3HOZK 5IYBK 2Y0SL 5C4JC 4OIPA 4BBSC 3EQLA 4KN7A 1TWHC 2A69A 3HOVC 1YNNA 4LLGA 4OIOA 2R92K 5C4JK 3S17K 3S1NK 5IYBC 3H3VD 4Q5SA 4XSXA 2E2JC 3S1MC 5IYDK 2VUMK 3CQZC 4A3EK 1TWHK 3GTKK 5C44C 3GTPC 4KMUA 1I3QK 3RZOK 3I4NC 2E2IK 5M3FK 3GTOC 4BY7K 2Y0SD 4A3IC 1SFOC 2WB1L 4A3KK 3M3YK 4A3GC 4BBRK 4C3HK 1I3QC 4Y52K 5D4DA 3H3VL 1BDFA 5M3MK 4A3LC 3CQZK 4A3EC 2NVXC 2O5IA 4LK0A 3GTLK 3M4OK 1I6VA 4G7OA 4MEXA 4C3IK 5C4XK 2JA7C 2R93C 2NVYK 2NVQK 3PO3C 3S17C 3S1NC 1Y1WK 1R9TC 4YFXA 2R7ZC 4X6AC 4MQ9A 4A3JK 1Y1VC 3I4MC 1K83K 3GTQC 4QIWD 2BE5A 2B63K 4QJVA 3S1QC 4XLNA 3HKZL 3HOUC 1K83C 3GTQK 1Y1VK 3I4MK 5FLMC 1IW7A 3RZDC 1Y1WC 4A3MC 1TWCC 4AYBD 4BXXC 4YG2A 2A68A 1I6HC 4BXXK 3S1RC 2YU9C 3HOYC 4A3KC 4JK1A 4A3GK 3GTMK 3HKZD 4OIRA 3I4NK 3RZOC 5FJ8K 3PO2C 1TWAK 3GTGK 3M3YC 2WB1D 4A3JC 3S14K 3HOXK 2O5JA 2NVTK 4OIQA 4A93C 2VUMC 4XSZA 1WCMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ L;  2JA6 K;  2R93 K;  3GTP K;  5C44 K;  1XPP A;  4YFK A;  1R9T K;  2PA8 D;  3S2H K;  3FKI C;  4C3J K;  2NVY C;  2NVQ C;  1WCM C;  3HOZ C;  3S15 K;  4A3L K;  4G7Z A;  4BBS K;  4Y52 C;  1YNJ A;  3S2D K;  1TWF C;  4GZY A;  4A3B C;  5IP7 K;  5C3E K;  4Y7N K;  2PMZ D;  5IP9 C;  3GTJ K;  2E2H K;  5IP7 C;  2JA5 C;  3PO2 K;  3S14 C;  3S2D C;  5TMF A;  1SMY A;  3GTK C;  2PA8 L;  4LJZ A;  2E2I C;  4Y7N C;  5C3E C;  3S1R K;  1TWF K;  1TWC K;  3HOY K;  4A3M K;  4A3C K;  4A3D K;  5TMC A;  2E2J K;  5M5X K;  3S1M K;  5IYD C;  1ZYR A;  3FKI K;  4XLP A;  3HOU K;  3S2H C;  3S1Q K;  4AYB L;  2R92 C;  4C2M K;  3HOV K;  5FLM K;  4ZH4 A;  5M5Y K;  3K7A K;  4NOI A;  2JA8 C;  1TWA C;  3GTG C;  4A3F K;  3HOW K;  2JA6 C;  4A93 K;  2NVT C;  5M5W K;  4A3F C;  3HOX C;  3HOW C;  2JA8 K;  3PO3 K;  2YU9 K;  4X6A K;  1HQM A;  3H0G C;  1I6H K;  4OIN A;  1I50 C;  5IYC K;  3M4O C;  3S16 K;  3DXJ A;  2WAQ D;  1TWG K;  4BY1 K;  3GTM C;  3GTL C;  2NVX K;  2JA7 K;  1I50 K;  5IYC C;  5C4X C;  4A3C C;  3RZD K;  3H0G K;  4LK1 A;  4QJV B;  4MEY A;  2CW0 A;  4G7H A;  4A3D C;  1TWG C;  4QIW L;  3GTJ C;  4YFN A;  4A3I K;  1SFO K;  2JA5 K;  4BY1 C;  3GTO K;  3S16 C;  4BY7 C;  2PPB A;  2B63 C;  4Q4Z A;  4A3B K;  2A6E A;  3WOD A;  4BBR C;  3K7A C;  2E2H C;  2WAQ L;  5IP9 K;  4KN4 A;  2R7Z K;  3S15 C;  2A6H A;  3HOZ K;  5IYB K;  2Y0S L;  5C4J C;  4OIP A;  4BBS C;  3EQL A;  4KN7 A;  1TWH C;  2A69 A;  3HOV C;  1YNN A;  4LLG A;  4OIO A;  2R92 K;  5C4J K;  3S17 K;  3S1N K;  5IYB C;  3H3V D;  4Q5S A;  4XSX A;  2E2J C;  3S1M C;  5IYD K;  2VUM K;  3CQZ C;  4A3E K;  1TWH K;  3GTK K;  5C44 C;  3GTP C;  4KMU A;  1I3Q K;  3RZO K;  3I4N C;  2E2I K;  5M3F K;  3GTO C;  4BY7 K;  2Y0S D;  4A3I C;  1SFO C;  2WB1 L;  4A3K K;  3M3Y K;  4A3G C;  4BBR K;  4C3H K;  1I3Q C;  4Y52 K;  5D4D A;  3H3V L;  1BDF A;  5M3M K;  4A3L C;  3CQZ K;  4A3E C;  2NVX C;  2O5I A;  4LK0 A;  3GTL K;  3M4O K;  1I6V A;  4G7O A;  4MEX A;  4C3I K;  5C4X K;  2JA7 C;  2R93 C;  2NVY K;  2NVQ K;  3PO3 C;  3S17 C;  3S1N C;  1Y1W K;  1R9T C;  4YFX A;  2R7Z C;  4X6A C;  4MQ9 A;  4A3J K;  1Y1V C;  3I4M C;  1K83 K;  3GTQ C;  4QIW D;  2BE5 A;  2B63 K;  4QJV A;  3S1Q C;  4XLN A;  3HKZ L;  3HOU C;  1K83 C;  3GTQ K;  1Y1V K;  3I4M K;  5FLM C;  1IW7 A;  3RZD C;  1Y1W C;  4A3M C;  1TWC C;  4AYB D;  4BXX C;  4YG2 A;  2A68 A;  1I6H C;  4BXX K;  3S1R C;  2YU9 C;  3HOY C;  4A3K C;  4JK1 A;  4A3G K;  3GTM K;  3HKZ D;  4OIR A;  3I4N K;  3RZO C;  5FJ8 K;  3PO2 C;  1TWA K;  3GTG K;  3M3Y C;  2WB1 D;  4A3J C;  3S14 K;  3HOX K;  2O5J A;  2NVT K;  4OIQ A;  4A93 C;  2VUM C;  4XSZ A;  1WCM K; 
#chains in the Genus database with same CATH topology
 5CHP A;  1WOR A;  4YFK A;  5TJ3 A;  1O26 A;  1XXA A;  3S15 K;  4A3L K;  1JOE A;  4Y52 C;  4G0V A;  3TFH A;  4LR2 A;  2PMZ D;  1B4B A;  5IP9 C;  3S14 C;  2JA5 A;  5TMF A;  1SMY A;  2PA8 L;  3IPJ A;  5C3E C;  2CFA B;  4PAB A;  1TWF K;  3T01 A;  4A3C K;  3S0X A;  5M5X K;  3S1M K;  5IYD C;  2GSN A;  3FKI K;  3VA7 A;  3OPF A;  4C2M K;  3HOV K;  3BUE A;  5M5Y K;  4NOI A;  2JA8 C;  4M1X A;  4A3F K;  2R7Z A;  4WJ3 M;  4A3F C;  1HQM A;  1ZXO A;  1I50 C;  5IYC K;  3M4O C;  3H0G A;  1RU0 A;  3Q3Q A;  1TWC A;  1I50 K;  5IYC C;  4LK1 A;  1WQG A;  2GAG C;  2JA5 K;  4WJ4 A;  4A3I K;  2YU9 A;  2B63 C;  1DCP A;  4Q4Z A;  4A3B K;  5IP9 K;  3AD7 C;  1O24 A;  2A6H A;  2XCQ A;  4C45 A;  1TWH C;  4J3N A;  1XZQ B;  4LLG A;  3S1N K;  5C4J K;  5IYB C;  5L46 A;  1BJT A;  2E2I K;  4BY7 K;  4A3K K;  4C3H K;  4Y52 K;  5D4D A;  1BDF A;  4A3L C;  2GSU A;  3CQZ K;  2XCO A;  4KMA A;  4MEX A;  4GTB A;  5C4X K;  1USO A;  1XXC A;  1BGW A;  4ILD A;  1WOS A;  2GAH C;  3LPX A;  5EGE A;  3GTQ A;  1EK8 A;  1L0W A;  3A8I A;  4DDQ A;  4XCH A;  1K83 A;  2BE5 A;  2B63 K;  5HL8 A;  4XLN A;  1Y1V K;  1WIH A;  3RZD C;  4A3M C;  1TWC C;  4O2D A;  4GTF A;  4AYB D;  1F7V A;  3GTL A;  1PJ6 A;  1EQR A;  3S1R C;  4BXX K;  4A3G K;  4JK1 A;  2V6U A;  4KB2 A;  4OIR A;  1O29 A;  2XCR B;  3GTG K;  5IOT A;  1ZVU A;  3GEI A;  4BLA A;  1C0A A;  1WCM K;  1O27 A;  2JA6 K;  2KWA A;  2R93 K;  1XPP A;  1R9T K;  4KM8 A;  4C3J K;  5IOQ A;  2NVQ C;  1VGX A;  4G7Z A;  3S2D K;  1TWF C;  5IP7 K;  5C3E K;  5EGH A;  4KAT A;  5IP7 C;  1IL2 A;  3GTO A;  3S2D C;  1ZBS A;  2V6S A;  3G4A A;  3TFJ A;  3GTK A;  4GTD A;  1VH2 A;  3JST A;  2R92 A;  1ZYR A;  3S1Q K;  4AYB L;  5E68 A;  5FLM K;  3GTG C;  3MML B;  2JA6 C;  4BKW A;  1XXB A;  2NVT C;  3HOW C;  2JA8 K;  1KQ4 A;  1PJ5 A;  4X6A K;  5IOS A;  1B4A A;  3L4K A;  3CAG A;  3H0G C;  1ISE A;  1WOP A;  3S16 K;  3DXJ A;  1TWG K;  2NVX K;  2JA7 K;  1TWG A;  4A3C C;  3RZD K;  2P8T A;  4QJV B;  4G7H A;  3AD9 C;  1TWG C;  1SFO K;  3GTO K;  2PPB A;  3GTJ A;  3WOD A;  4BBR C;  3K7A C;  3AD8 C;  1J6X A;  2Y0S L;  4OIP A;  4BBS C;  4LOW A;  3EQL A;  3FHZ A;  1O2A A;  4C3I C;  1YNN A;  4OIO A;  4Q5S A;  2RGR A;  2E2J C;  3CQZ C;  3GTK K;  5C44 C;  1WCM A;  1I3Q K;  1V5V A;  3RZO K;  3I4N C;  3AQO A;  5M3F K;  3GTO C;  1F93 A;  3GDZ A;  4FM9 A;  4A3G C;  4BBR K;  3HXA A;  4KB4 A;  2NVX C;  2O5I A;  2ZUE A;  2FQO A;  2D6F C;  3SZY A;  1R9T A;  2NVY K;  3PO3 C;  3S17 C;  2Y3P A;  3S1N C;  1R9T C;  1Y1V A;  2JA6 A;  4A3J K;  1WSV A;  4KDD A;  1TWA A;  3S1Q C;  3HKZ L;  3HOU C;  1K83 C;  1XZP B;  1XZP A;  3GTQ K;  3I4M K;  4G0W A;  1Y1W C;  1VRQ C;  1G51 A;  1IE0 A;  4BLB A;  2A68 A;  4YG2 A;  1I6H C;  4GTC A;  1EFW A;  4A3K C;  1INN A;  4KAS A;  5FJ8 K;  3PO2 C;  4A3J C;  2V6T A;  4XSZ A;  1TWH A;  1F7U A;  3GTP K;  1J6W A;  3ORE A;  3FKI C;  2NVY C;  1WCM C;  1VLO A;  3CQZ A;  3TTG A;  4A3B C;  4Y7N K;  2JA5 C;  2E2H K;  3PO2 K;  2PHC B;  2E2I A;  3GTK C;  3S1R K;  1TWC K;  1AB4 A;  3V4G A;  2E2J K;  4GTA A;  4XLP A;  3HOU K;  3S2H C;  1O2F B;  5JFE A;  1USM A;  4GFQ A;  1IBA A;  5CJ9 A;  1PJ7 A;  4GT9 A;  5M5W K;  4PAA A;  3PO3 K;  2YU9 K;  4KAW X;  3GTM C;  4RMF A;  1I50 A;  3L4J A;  1BS2 A;  4A3D C;  3H0G K;  3S16 C;  4BY7 C;  3A8J A;  2E2H A;  4C3H C;  3A8K A;  1ZQ1 C;  2R7Z K;  3S15 C;  3HOZ K;  5IYB K;  1IS1 A;  3ERE D;  3FKI A;  2A69 A;  1O28 A;  2ZUF A;  4P9S A;  5IYD K;  1X31 C;  3GTP A;  1TWF A;  4A3E K;  1JQW A;  1TWH K;  3FOF A;  2Y0S D;  1DCH A;  1SFO C;  2WB1 L;  2W7V A;  3M3Y K;  4FZB A;  4G0U A;  2JA7 C;  2NVQ K;  1Y1W K;  3GSI A;  2R7Z C;  4X6A C;  4MQ9 A;  3I4M C;  1WSR A;  5FLM C;  1IW7 A;  1O25 A;  2GSO A;  1UV7 A;  3TFI A;  4BXX C;  4GTL A;  2YU9 C;  3GTM K;  4KMD A;  2P5M A;  3HKZ D;  1TWA K;  3M3Y C;  3SZZ A;  3T02 A;  3HOX K;  2FQT A;  4A93 C;  1XZQ A;  2VUM C;  4KC6 A;  2PMZ L;  4C3J C;  4LQY A;  2VUM A;  3AH5 A;  5C44 K;  2NVY A;  2PA8 D;  3S2H K;  3BP3 A;  2RH6 A;  1F9N A;  3N0C A;  3HOZ C;  4BBS K;  1YNJ A;  4GZY A;  1WOO A;  4P5A A;  3GTJ K;  1YX2 A;  3AQP A;  1SFO A;  3QX3 A;  4LJZ A;  1I3Q A;  2E2I C;  4Y7N C;  3HOY K;  3GEH A;  2NVX A;  2JA7 A;  4A3M K;  4A3D K;  4WIL A;  4P5B A;  1EH1 A;  5TMC A;  2R92 C;  1WQF A;  4ZH4 A;  1YCL A;  3K7A K;  1TWA C;  3HOW K;  5IOR A;  4A93 K;  3HOX C;  3ADA C;  3GIR A;  3N3Y A;  2CFA A;  1I6H K;  4OIN A;  2WAQ D;  4BY1 K;  3GTL C;  5C4X C;  4MEY A;  3N0B A;  2CW0 A;  4QIW L;  3GTJ C;  4BY1 C;  4YFN A;  2A6E A;  2EBB A;  2E2H C;  2WAQ L;  4KN4 A;  3GEE A;  3FOE A;  5C4J C;  4KN7 A;  1GE9 A;  4C2M C;  3HOV C;  2R92 K;  2ZFZ A;  3S17 K;  1J98 A;  3H3V D;  4XSX A;  3S1M C;  2VUM K;  3GTP C;  4KMU A;  4KAR A;  1O2B A;  4GTE A;  4A3I C;  1I3Q C;  1EI6 A;  3H3V L;  5M3M K;  4A3E C;  4LK0 A;  3GTL K;  3M4O K;  1I6V A;  4G7O A;  4C3I K;  1IQ0 A;  2R93 C;  1JVI A;  1DD5 A;  3G4C A;  2R93 A;  4YFX A;  3LAP A;  3OEP A;  1Y1V C;  1K83 K;  3GTQ C;  4QIW D;  1WQH A;  3NUH A;  4QJV A;  1VJE A;  3GTG A;  4KM9 A;  1Y1W A;  3GTM A;  4AH6 A;  4KMH A;  1HI9 A;  3HOY C;  1J6V A;  3LAJ A;  3I4N K;  3RZO C;  1DCO A;  3S14 K;  2O5J A;  2WB1 D;  3T00 A;  2B63 A;  2NVT K;  4OIQ A;  2JH3 A;  3BP8 C;  5JVO A; 
#chains in the Genus database with same CATH homology
 2PMZ L;  2JA6 K;  2R93 K;  3GTP K;  5C44 K;  1XPP A;  4YFK A;  1R9T K;  2PA8 D;  3S2H K;  3FKI C;  4C3J K;  2NVY C;  2NVQ C;  1WCM C;  3HOZ C;  3S15 K;  4A3L K;  4G7Z A;  4BBS K;  4Y52 C;  1YNJ A;  3S2D K;  1TWF C;  4GZY A;  4A3B C;  5IP7 K;  5C3E K;  4Y7N K;  2PMZ D;  5IP9 C;  3GTJ K;  2E2H K;  5IP7 C;  2JA5 C;  3PO2 K;  3S14 C;  3S2D C;  5TMF A;  1SMY A;  3GTK C;  2PA8 L;  4LJZ A;  2E2I C;  4Y7N C;  5C3E C;  3S1R K;  1TWF K;  1TWC K;  3HOY K;  4A3M K;  4A3C K;  4A3D K;  5TMC A;  2E2J K;  5M5X K;  3S1M K;  5IYD C;  1ZYR A;  3FKI K;  4XLP A;  3HOU K;  3S2H C;  3S1Q K;  4AYB L;  2R92 C;  4C2M K;  3HOV K;  5FLM K;  4ZH4 A;  5M5Y K;  3K7A K;  4NOI A;  2JA8 C;  1TWA C;  3GTG C;  4A3F K;  3HOW K;  2JA6 C;  4A93 K;  2NVT C;  5M5W K;  4A3F C;  3HOX C;  3HOW C;  2JA8 K;  3PO3 K;  2YU9 K;  4X6A K;  1HQM A;  3H0G C;  1I6H K;  4OIN A;  1I50 C;  5IYC K;  3M4O C;  3S16 K;  3DXJ A;  2WAQ D;  1TWG K;  4BY1 K;  3GTM C;  3GTL C;  2NVX K;  2JA7 K;  1I50 K;  5IYC C;  5C4X C;  4A3C C;  3RZD K;  3H0G K;  4LK1 A;  4QJV B;  4MEY A;  2CW0 A;  4G7H A;  4A3D C;  1TWG C;  4QIW L;  3GTJ C;  4YFN A;  4A3I K;  1SFO K;  2JA5 K;  4BY1 C;  3GTO K;  3S16 C;  4BY7 C;  2PPB A;  2B63 C;  4Q4Z A;  4A3B K;  2A6E A;  3WOD A;  4BBR C;  3K7A C;  2E2H C;  2WAQ L;  5IP9 K;  4KN4 A;  2R7Z K;  3S15 C;  2A6H A;  3HOZ K;  5IYB K;  2Y0S L;  5C4J C;  4OIP A;  4BBS C;  3EQL A;  4KN7 A;  1TWH C;  2A69 A;  3HOV C;  1YNN A;  4LLG A;  4OIO A;  2R92 K;  5C4J K;  3S17 K;  3S1N K;  5IYB C;  3H3V D;  4Q5S A;  4XSX A;  2E2J C;  3S1M C;  5IYD K;  2VUM K;  3CQZ C;  4A3E K;  1TWH K;  3GTK K;  5C44 C;  3GTP C;  4KMU A;  1I3Q K;  3RZO K;  3I4N C;  2E2I K;  5M3F K;  3GTO C;  4BY7 K;  2Y0S D;  4A3I C;  1SFO C;  2WB1 L;  4A3K K;  3M3Y K;  4A3G C;  4BBR K;  4C3H K;  1I3Q C;  4Y52 K;  5D4D A;  3H3V L;  1BDF A;  5M3M K;  4A3L C;  3CQZ K;  4A3E C;  2NVX C;  2O5I A;  4LK0 A;  3GTL K;  3M4O K;  1I6V A;  4G7O A;  4MEX A;  4C3I K;  5C4X K;  2JA7 C;  2R93 C;  2NVY K;  2NVQ K;  3PO3 C;  3S17 C;  3S1N C;  1Y1W K;  1R9T C;  4YFX A;  2R7Z C;  4X6A C;  4MQ9 A;  4A3J K;  1Y1V C;  3I4M C;  1K83 K;  3GTQ C;  4QIW D;  2BE5 A;  2B63 K;  4QJV A;  3S1Q C;  4XLN A;  3HKZ L;  3HOU C;  1K83 C;  3GTQ K;  1Y1V K;  3I4M K;  5FLM C;  1IW7 A;  3RZD C;  1Y1W C;  4A3M C;  1TWC C;  4AYB D;  4BXX C;  4YG2 A;  2A68 A;  1I6H C;  4BXX K;  3S1R C;  2YU9 C;  3HOY C;  4A3K C;  4JK1 A;  4A3G K;  3GTM K;  3HKZ D;  4OIR A;  3I4N K;  3RZO C;  5FJ8 K;  3PO2 C;  1TWA K;  3GTG K;  3M3Y C;  2WB1 D;  4A3J C;  3S14 K;  3HOX K;  2O5J A;  2NVT K;  4OIQ A;  4A93 C;  2VUM C;  4XSZ A;  1WCM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...