2Y0SL

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 20
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2y0sL00
3S16C 3S1RC 2YU9K 4BBRC 4A3FK 2NVTC 3GTLK 4BY1C 1K83K 2NVQC 5FLMC 4XLNA 3HOWC 4Y52C 3GTJC 2B63K 4A3GC 4X6AK 3FKIC 4YFNA 5IYCK 4G7HA 2WB1L 5TMFA 3EQLA 2R92C 3GTPK 3S17C 3S15C 2WAQL 4G7OA 2WB1D 2E2IK 3S1QC 4BXXK 2WAQD 3S2DK 5C44C 4AYBL 4A3LK 1TWGK 4MQ9A 3RZDC 3GTKC 5IP9K 3M3YC 5M5YK 4AYBD 4A3KC 2R93C 2BE5A 4XLPA 4JK1A 1I6HC 3S14C 3CQZC 2JA8C 3HOVK 2E2JK 4OIOA 5C3EK 3HOZC 4Q4ZA 2YU9C 3PO3K 1I6VA 3I4NC 4A93K 4BY7K 4QJVA 3GTLC 4MEXA 3DXJA 3S1NC 4A3CC 1K83C 4LK0A 4Y7NK 4BBSK 5IP7C 4Q5SA 2B63C 1WCMK 5IYCC 3GTPC 3GTMK 1TWCC 3RZOK 3HKZL 3GTQK 4ZH4A 3WODA 4OINA 2E2IC 4BXXC 3H3VL 3HKZD 5M3FK 3HOYK 4KN7A 4LLGA 4LK1A 4C3HK 3I4MK 4YFXA 1SFOK 4YFKA 1TWGC 4A3MK 1R9TK 2E2HK 3H3VD 4A3LC 1TWFC 4A3IC 4A3DC 5TMCA 1Y1WK 3S1MK 5M3MK 1Y1VK 3GTOK 3HOVC 2O5JA 2E2JC 4QJVB 3PO3C 4A3JK 5C4XC 4A93C 4LJZA 3GTGK 2VUMK 4KMUA 2NVYK 4C3JK 2CW0A 1TWAK 4NOIA 4Y7NC 4BBSC 3S16K 3S1RK 2NVXK 2Y0SL 3K7AK 4A3FC 1WCMC 4XSXA 2PMZL 3GTMC 3M4OK 3RZOC 3GTQC 1BDFA 2A69A 2Y0SD 3HOWK 4A3DK 4X6AC 2PMZD 5C4JK 5IYDK 4OIPA 3S17K 2R92K 2PPBA 1TWHK 3HOXK 3I4MC 4A3MC 2A68A 3S2DC 1I3QK 4G7ZA 3H0GK 5C44K 4QIWL 1Y1WC 3S1MC 2PA8L 5IP9C 1YNNA 2A6EA 1I50K 1Y1VC 3GTOC 2JA5K 2PA8D 4A3JC 4OIQA 2JA6K 2JA7K 4A3BK 4A3EK 2VUMC 3HOUK 2R7ZK 3S2HK 2NVYC 3S14K 3CQZK 5C3EC 1TWAC 4XSZA 1XPPA 3HOZK 4BY7C 5FJ8K 5IYBK 2NVXC 3K7AC 3I4NK 3PO2K 3S1NK 1HQMA 4A3CK 5M5WK 3M4OC 1SMYA 4BBRK 5IP7K 2NVTK 4BY1K 5M5XK 5IYDC 5C4JC 2NVQK 1TWCK 5FLMK 4MEYA 1TWHC 4Y52K 3GTJK 4A3GK 3FKIK 3HOXC 3S15K 4OIRA 2O5IA 4C3IK 3HOYC 2A6HA 1I3QC 3H0GC 4GZYA 1SFOC 4YG2A 2E2HC 1R9TC 3S1QK 1TWFK 4A3IK 1I50C 1YNJA 4KN4A 2JA5C 3RZDK 2JA6C 4C2MK 3GTKK 2JA7C 3M3YK 5D4DA 4A3EC 4A3BC 3HOUC 2R7ZC 1IW7A 4QIWD 4A3KK 3S2HC 2R93K 5C4XK 5IYBC 3GTGC 3PO2C 1I6HK 2JA8K 1ZYRA
chains in the Genus database with same CATH superfamily
1AB4A 2XCQA 2R93A 2NVTC 3GTLK 5E68A 4XLNA 1GE9A 4A3GC 5IYCK 1BJTA 2WB1L 3N0BA 2ZUFA 2E2IK 1IE0A 1X31C 4BXXK 4DDQA 1O24A 3SZZA 4AYBL 3BP3A 1F93A 3AD8C 4C2MC 3M3YC 4AH6A 5IOTA 1JOEA 1I6VA 3LPXA 3GTLC 1ISEA 4Y7NK 5IYCC 1EQRA 3RZOK 5CJ9A 4ZH4A 1VGXA 2E2IC 4BXXC 2W7VA 4C3IC 3H3VL 4KN7A 4C3HK 4LK1A 3I4MK 4A3MK 1VRQC 4BLAA 5EGHA 5JFEA 2XCRB 1XXBA 3GEHA 4C45A 4A3DC 3S0XA 5M3MK 1SFOA 1WIHA 4G0VA 5C4XC 3NUHA 3GEEA 4QJVB 1I50A 4KM8A 1BGWA 1WORA 2NVYK 3G4CA 4C3JK 2FQOA 4Y7NC 1B4AA 3S16K 3GTOA 2Y0SL 3K7AK 2PMZL 3GTGA 3RZOC 4X6AC 4ILDA 1TWHK 4C3HC 3I4MC 4A3MC 1WQGA 2FQTA 2ZFZA 5C44K 2R92A 4QIWL 3GEIA 2A6EA 1F7VA 1O26A 2P5MA 5IORA 4A3BK 1DCPA 3H0GA 3AD7C 2NVYC 4C3JC 3S14K 4GZYA 1INNA 1WOOA 3K7AC 4GTFA 3CQZA 3T01A 4BBRK 4BY1K 2NVQK 4MEYA 1TWHC 3GTJK 2A6HA 2XCOA 1WQHA 2E2HC 1TWCA 2D6FC 1R9TC 4A3BC 1YCLA 3AH5A 3LAJA 1J98A 2R93K 1TWFA 4FM9A 3GTKA 3TFJA 3S1RC 4BBRC 2V6SA 4BY1C 2NVQC 3GTJC 1B4BA 3TFIA 2YU9A 3GTPK 3A8IA 4G7OA 1WCMA 2CFAB 2WB1D 3GTQA 2GSUA 3S2DK 1TWGK 3A8KA 5M5YK 4AYBD 2R93C 1VLOA 1IQ0A 3MMLB 4OIOA 5C3EK 3PO3K 1Y1VA 1XZPB 1DCOA 3TTGA 4LK0A 1O2AA 3FHZA 5IP7C 3GTPC 3HKZL 4J3NA 1EK8A 3AQPA 4LLGA 3GTMA 1SFOK 1TWGC 3H3VD 1PJ6A 1RU0A 3GSIA 5IOSA 4O2DA 3GTOK 2O5JA 1J6XA 3PO3C 2GSOA 4A3JK 2PHCB 4KC6A 4LJZA 3GTGK 1Y1WA 4PAAA 4KMUA 4NOIA 1ZXOA 2R7ZA 1EH1A 1F7UA 3M4OK 4KB2A 2VUMA 2Y0SD 1WQFA 3HOWK 1J6VA 2PMZD 3S17K 2R92K 2PPBA 3HXAA 3A8JA 4G7ZA 3H0GK 2PA8L 2V6UA 4GTDA 1YNNA 4M1XA 3GTOC 4BLBA 1I3QA 3V4GA 4A3JC 1KQ4A 3CQZK 1XPPA 3HOZK 4GFQA 5FJ8K 3I4NK 3AQOA 2JA6A 3S1NK 4A3CK 3M4OC 1IS1A 1UV7A 1J6WA 1TWCK 3GTLA 3QX3A 1BS2A 3S15K 3H0GC 3S1QK 1XZQB 3TFHA 3FKIA 3N0CA 1TWFK 2P8TA 4A3IK 3BP8C 1XXAA 3RZDK 3GTKK 5D4DA 2V6TA 1ZYRA 3S16C 2YU9K 4KMAA 4A3FK 1PJ7A 4KB4A 2ZUEA 4YFNA 4G7HA 3S15C 5TMFA 3EQLA 3JSTA 2Y3PA 2WAQL 1K83A 1WOPA 3FOFA 3S1QC 2B63A 1C0AA 1HI9A 5C44C 3RZDC 3GTKC 2GAGC 5IP9K 1EI6A 3SZYA 3L4JA 3T00A 4JK1A 3LAPA 3S14C 3HOVK 2E2JK 4BY7K 3CAGA 4Q4ZA 2YU9C 4QJVA 5IOQA 4MEXA 1O25A 3Q3QA 3GTMK 4LOWA 3WODA 4OINA 4PABA 3HKZD 1O2BA 1YX2A 3ERED 3HOYK 4YFXA 4YFKA 1TWHA 1WOSA 3GDZA 1PJ5A 1Y1WK 1O27A 3S1MK 2E2HA 1R9TA 1DCHA 3HOVC 2E2JC 3T02A 2RH6A 2KWAA 1WSVA 2VUMK 4GTEA 1VH2A 2CW0A 1DD5A 4GT9A 4KASA 4XSXA 3GTMC 1BDFA 2A69A 1TWAA 2NVXA 5C4JK 5IYDK 4OIPA 4KDDA 4KM9A 3HOXK 1XXCA 2A68A 3ADAC 3S2DC 1I3QK 4KMDA 1Y1WC 3S1MC 1V5VA 2GSNA 1I50K 3FOEA 1JVIA 2PA8D 2JA6K 4OIQA 4P5AA 5TJ3A 4A3EK 3OPFA 1G51A 4RMFA 2VUMC 3S2HK 5C3EC 4GTLA 5JVOA 2JA5A 3PO2K 5HL8A 2JA7A 4GTBA 5M5XK 5IYDC 5C4JC 5FLMK 4Y52K 3FKIK 3HOXC 4LR2A 4KARA 4C3IK 3VA7A 1I3QC 3GTPA 1SFOC 4YG2A 2CFAA 1I50C 2GAHC 4KN4A 4A3DK 2JA6C 4FZBA 1ZVUA 4A3EC 3S2HC 4QIWD 1TWGA 4A3KK 1O28A 5C4XK 3GTGC 3PO2C 1I6HK 2JA8K 3N3YA 3L4KA 1JQWA 1K83K 1XZPA 5FLMC 5CHPA 3HOWC 4Y52C 4P9SA 2B63K 4X6AK 3FKIC 3S17C 2R92C 1ZQ1C 2WAQD 1F9NA 1WSRA 4A3LK 4MQ9A 2E2IA 4A3KC 2BE5A 2JH3A 1IBAA 4XLPA 1I6HC 3CQZC 2JA8C 3HOZC 3I4NC 4A93K 3S1NC 3DXJA 4A3CC 1K83C 3G4AA 4BBSK 4WJ4A 4Q5SA 2B63C 1WCMK 4GTAA 4KAWX 1TWCC 3GTQK 5M3FK 2E2HK 4A3LC 2EBBA 1R9TK 3OREA 1TWFC 4A3IC 4WILA 1L0WA 5TMCA 1Y1VK 3AD9C 4A93C 1TWAK 4BBSC 4XCHA 3S1RK 2NVXK 4A3FC 1WCMC 4LQYA 4BKWA 5L46A 1O2FB 3GTQC 2NVYA 1VJEA 3OEPA 2RGRA 4GTCA 5IP9C 1ZBSA 5EGEA 1XZQA 1Y1VC 2JA5K 2JA7K 4G0WA 3HOUK 2R7ZK 4KMHA 4BY7C 1TWAC 4XSZA 5IYBK 2NVXC 1IL2A 1HQMA 5M5WK 1SMYA 2NVTK 5IP7K 4KATA 4WJ3M 4A3GK 1USMA 3BUEA 4OIRA 2O5IA 3HOYC 3GTJA 1EFWA 1YNJA 2JA5C 4C2MK 4G0UA 2JA7C 3M3YK 3HOUC 2R7ZC 1IW7A 1O29A 3IPJA 1USOA 4P5BA 5IYBC 3GIRA
chains in the Genus database with same CATH topology
3S16C 3S1RC 2YU9K 4BBRC 4A3FK 2NVTC 3GTLK 4BY1C 1K83K 2NVQC 5FLMC 4XLNA 3HOWC 4Y52C 3GTJC 2B63K 4A3GC 4X6AK 3FKIC 4YFNA 5IYCK 4G7HA 2WB1L 5TMFA 3EQLA 2R92C 3GTPK 3S17C 3S15C 2WAQL 4G7OA 2WB1D 2E2IK 3S1QC 4BXXK 2WAQD 3S2DK 5C44C 4AYBL 4A3LK 1TWGK 4MQ9A 3RZDC 3GTKC 5IP9K 3M3YC 5M5YK 4AYBD 4A3KC 2R93C 2BE5A 4XLPA 4JK1A 1I6HC 3S14C 3CQZC 2JA8C 3HOVK 2E2JK 4OIOA 5C3EK 3HOZC 4Q4ZA 2YU9C 3PO3K 1I6VA 3I4NC 4A93K 4BY7K 4QJVA 3GTLC 4MEXA 3DXJA 3S1NC 4A3CC 1K83C 4LK0A 4Y7NK 4BBSK 5IP7C 4Q5SA 2B63C 1WCMK 5IYCC 3GTPC 3GTMK 1TWCC 3RZOK 3HKZL 3GTQK 4ZH4A 3WODA 4OINA 2E2IC 4BXXC 3H3VL 3HKZD 5M3FK 3HOYK 4KN7A 4LLGA 4LK1A 4C3HK 3I4MK 4YFXA 1SFOK 4YFKA 1TWGC 4A3MK 1R9TK 2E2HK 3H3VD 4A3LC 1TWFC 4A3IC 4A3DC 5TMCA 1Y1WK 3S1MK 5M3MK 1Y1VK 3GTOK 3HOVC 2O5JA 2E2JC 4QJVB 3PO3C 4A3JK 5C4XC 4A93C 4LJZA 3GTGK 2VUMK 4KMUA 2NVYK 4C3JK 2CW0A 1TWAK 4NOIA 4Y7NC 4BBSC 3S16K 3S1RK 2NVXK 2Y0SL 3K7AK 4A3FC 1WCMC 4XSXA 2PMZL 3GTMC 3M4OK 3RZOC 3GTQC 1BDFA 2A69A 2Y0SD 3HOWK 4A3DK 4X6AC 2PMZD 5C4JK 5IYDK 4OIPA 3S17K 2R92K 2PPBA 1TWHK 3HOXK 3I4MC 4A3MC 2A68A 3S2DC 1I3QK 4G7ZA 3H0GK 5C44K 4QIWL 1Y1WC 3S1MC 2PA8L 5IP9C 1YNNA 2A6EA 1I50K 1Y1VC 3GTOC 2JA5K 2PA8D 4A3JC 4OIQA 2JA6K 2JA7K 4A3BK 4A3EK 2VUMC 3HOUK 2R7ZK 3S2HK 2NVYC 3S14K 3CQZK 5C3EC 1TWAC 4XSZA 1XPPA 3HOZK 4BY7C 5FJ8K 5IYBK 2NVXC 3K7AC 3I4NK 3PO2K 3S1NK 1HQMA 4A3CK 5M5WK 3M4OC 1SMYA 4BBRK 5IP7K 2NVTK 4BY1K 5M5XK 5IYDC 5C4JC 2NVQK 1TWCK 5FLMK 4MEYA 1TWHC 4Y52K 3GTJK 4A3GK 3FKIK 3HOXC 3S15K 4OIRA 2O5IA 4C3IK 3HOYC 2A6HA 1I3QC 3H0GC 4GZYA 1SFOC 4YG2A 2E2HC 1R9TC 3S1QK 1TWFK 4A3IK 1I50C 1YNJA 4KN4A 2JA5C 3RZDK 2JA6C 4C2MK 3GTKK 2JA7C 3M3YK 5D4DA 4A3EC 4A3BC 3HOUC 2R7ZC 1IW7A 4QIWD 4A3KK 3S2HC 2R93K 5C4XK 5IYBC 3GTGC 3PO2C 1I6HK 2JA8K 1ZYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 C;  3S1R C;  2YU9 K;  4BBR C;  4A3F K;  2NVT C;  3GTL K;  4BY1 C;  1K83 K;  2NVQ C;  5FLM C;  4XLN A;  3HOW C;  4Y52 C;  3GTJ C;  2B63 K;  4A3G C;  4X6A K;  3FKI C;  4YFN A;  5IYC K;  4G7H A;  2WB1 L;  5TMF A;  3EQL A;  2R92 C;  3GTP K;  3S17 C;  3S15 C;  2WAQ L;  4G7O A;  2WB1 D;  2E2I K;  3S1Q C;  4BXX K;  2WAQ D;  3S2D K;  5C44 C;  4AYB L;  4A3L K;  1TWG K;  4MQ9 A;  3RZD C;  3GTK C;  5IP9 K;  3M3Y C;  5M5Y K;  4AYB D;  4A3K C;  2R93 C;  2BE5 A;  4XLP A;  4JK1 A;  1I6H C;  3S14 C;  3CQZ C;  2JA8 C;  3HOV K;  2E2J K;  4OIO A;  5C3E K;  3HOZ C;  4Q4Z A;  2YU9 C;  3PO3 K;  1I6V A;  3I4N C;  4A93 K;  4BY7 K;  4QJV A;  3GTL C;  4MEX A;  3DXJ A;  3S1N C;  4A3C C;  1K83 C;  4LK0 A;  4Y7N K;  4BBS K;  5IP7 C;  4Q5S A;  2B63 C;  1WCM K;  5IYC C;  3GTP C;  3GTM K;  1TWC C;  3RZO K;  3HKZ L;  3GTQ K;  4ZH4 A;  3WOD A;  4OIN A;  2E2I C;  4BXX C;  3H3V L;  3HKZ D;  5M3F K;  3HOY K;  4KN7 A;  4LLG A;  4LK1 A;  4C3H K;  3I4M K;  4YFX A;  1SFO K;  4YFK A;  1TWG C;  4A3M K;  1R9T K;  2E2H K;  3H3V D;  4A3L C;  1TWF C;  4A3I C;  4A3D C;  5TMC A;  1Y1W K;  3S1M K;  5M3M K;  1Y1V K;  3GTO K;  3HOV C;  2O5J A;  2E2J C;  4QJV B;  3PO3 C;  4A3J K;  5C4X C;  4A93 C;  4LJZ A;  3GTG K;  2VUM K;  4KMU A;  2NVY K;  4C3J K;  2CW0 A;  1TWA K;  4NOI A;  4Y7N C;  4BBS C;  3S16 K;  3S1R K;  2NVX K;  2Y0S L;  3K7A K;  4A3F C;  1WCM C;  4XSX A;  2PMZ L;  3GTM C;  3M4O K;  3RZO C;  3GTQ C;  1BDF A;  2A69 A;  2Y0S D;  3HOW K;  4A3D K;  4X6A C;  2PMZ D;  5C4J K;  5IYD K;  4OIP A;  3S17 K;  2R92 K;  2PPB A;  1TWH K;  3HOX K;  3I4M C;  4A3M C;  2A68 A;  3S2D C;  1I3Q K;  4G7Z A;  3H0G K;  5C44 K;  4QIW L;  1Y1W C;  3S1M C;  2PA8 L;  5IP9 C;  1YNN A;  2A6E A;  1I50 K;  1Y1V C;  3GTO C;  2JA5 K;  2PA8 D;  4A3J C;  4OIQ A;  2JA6 K;  2JA7 K;  4A3B K;  4A3E K;  2VUM C;  3HOU K;  2R7Z K;  3S2H K;  2NVY C;  3S14 K;  3CQZ K;  5C3E C;  1TWA C;  4XSZ A;  1XPP A;  3HOZ K;  4BY7 C;  5FJ8 K;  5IYB K;  2NVX C;  3K7A C;  3I4N K;  3PO2 K;  3S1N K;  1HQM A;  4A3C K;  5M5W K;  3M4O C;  1SMY A;  4BBR K;  5IP7 K;  2NVT K;  4BY1 K;  5M5X K;  5IYD C;  5C4J C;  2NVQ K;  1TWC K;  5FLM K;  4MEY A;  1TWH C;  4Y52 K;  3GTJ K;  4A3G K;  3FKI K;  3HOX C;  3S15 K;  4OIR A;  2O5I A;  4C3I K;  3HOY C;  2A6H A;  1I3Q C;  3H0G C;  4GZY A;  1SFO C;  4YG2 A;  2E2H C;  1R9T C;  3S1Q K;  1TWF K;  4A3I K;  1I50 C;  1YNJ A;  4KN4 A;  2JA5 C;  3RZD K;  2JA6 C;  4C2M K;  3GTK K;  2JA7 C;  3M3Y K;  5D4D A;  4A3E C;  4A3B C;  3HOU C;  2R7Z C;  1IW7 A;  4QIW D;  4A3K K;  3S2H C;  2R93 K;  5C4X K;  5IYB C;  3GTG C;  3PO2 C;  1I6H K;  2JA8 K;  1ZYR A; 
#chains in the Genus database with same CATH topology
 1AB4 A;  2XCQ A;  2R93 A;  2NVT C;  3GTL K;  5E68 A;  4XLN A;  1GE9 A;  4A3G C;  5IYC K;  1BJT A;  2WB1 L;  3N0B A;  2ZUF A;  2E2I K;  1IE0 A;  1X31 C;  4BXX K;  4DDQ A;  1O24 A;  3SZZ A;  4AYB L;  3BP3 A;  1F93 A;  3AD8 C;  4C2M C;  3M3Y C;  4AH6 A;  5IOT A;  1JOE A;  1I6V A;  3LPX A;  3GTL C;  1ISE A;  4Y7N K;  5IYC C;  1EQR A;  3RZO K;  5CJ9 A;  4ZH4 A;  1VGX A;  2E2I C;  4BXX C;  2W7V A;  4C3I C;  3H3V L;  4KN7 A;  4C3H K;  4LK1 A;  3I4M K;  4A3M K;  1VRQ C;  4BLA A;  5EGH A;  5JFE A;  2XCR B;  1XXB A;  3GEH A;  4C45 A;  4A3D C;  3S0X A;  5M3M K;  1SFO A;  1WIH A;  4G0V A;  5C4X C;  3NUH A;  3GEE A;  4QJV B;  1I50 A;  4KM8 A;  1BGW A;  1WOR A;  2NVY K;  3G4C A;  4C3J K;  2FQO A;  4Y7N C;  1B4A A;  3S16 K;  3GTO A;  2Y0S L;  3K7A K;  2PMZ L;  3GTG A;  3RZO C;  4X6A C;  4ILD A;  1TWH K;  4C3H C;  3I4M C;  4A3M C;  1WQG A;  2FQT A;  2ZFZ A;  5C44 K;  2R92 A;  4QIW L;  3GEI A;  2A6E A;  1F7V A;  1O26 A;  2P5M A;  5IOR A;  4A3B K;  1DCP A;  3H0G A;  3AD7 C;  2NVY C;  4C3J C;  3S14 K;  4GZY A;  1INN A;  1WOO A;  3K7A C;  4GTF A;  3CQZ A;  3T01 A;  4BBR K;  4BY1 K;  2NVQ K;  4MEY A;  1TWH C;  3GTJ K;  2A6H A;  2XCO A;  1WQH A;  2E2H C;  1TWC A;  2D6F C;  1R9T C;  4A3B C;  1YCL A;  3AH5 A;  3LAJ A;  1J98 A;  2R93 K;  1TWF A;  4FM9 A;  3GTK A;  3TFJ A;  3S1R C;  4BBR C;  2V6S A;  4BY1 C;  2NVQ C;  3GTJ C;  1B4B A;  3TFI A;  2YU9 A;  3GTP K;  3A8I A;  4G7O A;  1WCM A;  2CFA B;  2WB1 D;  3GTQ A;  2GSU A;  3S2D K;  1TWG K;  3A8K A;  5M5Y K;  4AYB D;  2R93 C;  1VLO A;  1IQ0 A;  3MML B;  4OIO A;  5C3E K;  3PO3 K;  1Y1V A;  1XZP B;  1DCO A;  3TTG A;  4LK0 A;  1O2A A;  3FHZ A;  5IP7 C;  3GTP C;  3HKZ L;  4J3N A;  1EK8 A;  3AQP A;  4LLG A;  3GTM A;  1SFO K;  1TWG C;  3H3V D;  1PJ6 A;  1RU0 A;  3GSI A;  5IOS A;  4O2D A;  3GTO K;  2O5J A;  1J6X A;  3PO3 C;  2GSO A;  4A3J K;  2PHC B;  4KC6 A;  4LJZ A;  3GTG K;  1Y1W A;  4PAA A;  4KMU A;  4NOI A;  1ZXO A;  2R7Z A;  1EH1 A;  1F7U A;  3M4O K;  4KB2 A;  2VUM A;  2Y0S D;  1WQF A;  3HOW K;  1J6V A;  2PMZ D;  3S17 K;  2R92 K;  2PPB A;  3HXA A;  3A8J A;  4G7Z A;  3H0G K;  2PA8 L;  2V6U A;  4GTD A;  1YNN A;  4M1X A;  3GTO C;  4BLB A;  1I3Q A;  3V4G A;  4A3J C;  1KQ4 A;  3CQZ K;  1XPP A;  3HOZ K;  4GFQ A;  5FJ8 K;  3I4N K;  3AQO A;  2JA6 A;  3S1N K;  4A3C K;  3M4O C;  1IS1 A;  1UV7 A;  1J6W A;  1TWC K;  3GTL A;  3QX3 A;  1BS2 A;  3S15 K;  3H0G C;  3S1Q K;  1XZQ B;  3TFH A;  3FKI A;  3N0C A;  1TWF K;  2P8T A;  4A3I K;  3BP8 C;  1XXA A;  3RZD K;  3GTK K;  5D4D A;  2V6T A;  1ZYR A;  3S16 C;  2YU9 K;  4KMA A;  4A3F K;  1PJ7 A;  4KB4 A;  2ZUE A;  4YFN A;  4G7H A;  3S15 C;  5TMF A;  3EQL A;  3JST A;  2Y3P A;  2WAQ L;  1K83 A;  1WOP A;  3FOF A;  3S1Q C;  2B63 A;  1C0A A;  1HI9 A;  5C44 C;  3RZD C;  3GTK C;  2GAG C;  5IP9 K;  1EI6 A;  3SZY A;  3L4J A;  3T00 A;  4JK1 A;  3LAP A;  3S14 C;  3HOV K;  2E2J K;  4BY7 K;  3CAG A;  4Q4Z A;  2YU9 C;  4QJV A;  5IOQ A;  4MEX A;  1O25 A;  3Q3Q A;  3GTM K;  4LOW A;  3WOD A;  4OIN A;  4PAB A;  3HKZ D;  1O2B A;  1YX2 A;  3ERE D;  3HOY K;  4YFX A;  4YFK A;  1TWH A;  1WOS A;  3GDZ A;  1PJ5 A;  1Y1W K;  1O27 A;  3S1M K;  2E2H A;  1R9T A;  1DCH A;  3HOV C;  2E2J C;  3T02 A;  2RH6 A;  2KWA A;  1WSV A;  2VUM K;  4GTE A;  1VH2 A;  2CW0 A;  1DD5 A;  4GT9 A;  4KAS A;  4XSX A;  3GTM C;  1BDF A;  2A69 A;  1TWA A;  2NVX A;  5C4J K;  5IYD K;  4OIP A;  4KDD A;  4KM9 A;  3HOX K;  1XXC A;  2A68 A;  3ADA C;  3S2D C;  1I3Q K;  4KMD A;  1Y1W C;  3S1M C;  1V5V A;  2GSN A;  1I50 K;  3FOE A;  1JVI A;  2PA8 D;  2JA6 K;  4OIQ A;  4P5A A;  5TJ3 A;  4A3E K;  3OPF A;  1G51 A;  4RMF A;  2VUM C;  3S2H K;  5C3E C;  4GTL A;  5JVO A;  2JA5 A;  3PO2 K;  5HL8 A;  2JA7 A;  4GTB A;  5M5X K;  5IYD C;  5C4J C;  5FLM K;  4Y52 K;  3FKI K;  3HOX C;  4LR2 A;  4KAR A;  4C3I K;  3VA7 A;  1I3Q C;  3GTP A;  1SFO C;  4YG2 A;  2CFA A;  1I50 C;  2GAH C;  4KN4 A;  4A3D K;  2JA6 C;  4FZB A;  1ZVU A;  4A3E C;  3S2H C;  4QIW D;  1TWG A;  4A3K K;  1O28 A;  5C4X K;  3GTG C;  3PO2 C;  1I6H K;  2JA8 K;  3N3Y A;  3L4K A;  1JQW A;  1K83 K;  1XZP A;  5FLM C;  5CHP A;  3HOW C;  4Y52 C;  4P9S A;  2B63 K;  4X6A K;  3FKI C;  3S17 C;  2R92 C;  1ZQ1 C;  2WAQ D;  1F9N A;  1WSR A;  4A3L K;  4MQ9 A;  2E2I A;  4A3K C;  2BE5 A;  2JH3 A;  1IBA A;  4XLP A;  1I6H C;  3CQZ C;  2JA8 C;  3HOZ C;  3I4N C;  4A93 K;  3S1N C;  3DXJ A;  4A3C C;  1K83 C;  3G4A A;  4BBS K;  4WJ4 A;  4Q5S A;  2B63 C;  1WCM K;  4GTA A;  4KAW X;  1TWC C;  3GTQ K;  5M3F K;  2E2H K;  4A3L C;  2EBB A;  1R9T K;  3ORE A;  1TWF C;  4A3I C;  4WIL A;  1L0W A;  5TMC A;  1Y1V K;  3AD9 C;  4A93 C;  1TWA K;  4BBS C;  4XCH A;  3S1R K;  2NVX K;  4A3F C;  1WCM C;  4LQY A;  4BKW A;  5L46 A;  1O2F B;  3GTQ C;  2NVY A;  1VJE A;  3OEP A;  2RGR A;  4GTC A;  5IP9 C;  1ZBS A;  5EGE A;  1XZQ A;  1Y1V C;  2JA5 K;  2JA7 K;  4G0W A;  3HOU K;  2R7Z K;  4KMH A;  4BY7 C;  1TWA C;  4XSZ A;  5IYB K;  2NVX C;  1IL2 A;  1HQM A;  5M5W K;  1SMY A;  2NVT K;  5IP7 K;  4KAT A;  4WJ3 M;  4A3G K;  1USM A;  3BUE A;  4OIR A;  2O5I A;  3HOY C;  3GTJ A;  1EFW A;  1YNJ A;  2JA5 C;  4C2M K;  4G0U A;  2JA7 C;  3M3Y K;  3HOU C;  2R7Z C;  1IW7 A;  1O29 A;  3IPJ A;  1USO A;  4P5B A;  5IYB C;  3GIR A; 
#chains in the Genus database with same CATH homology
 3S16 C;  3S1R C;  2YU9 K;  4BBR C;  4A3F K;  2NVT C;  3GTL K;  4BY1 C;  1K83 K;  2NVQ C;  5FLM C;  4XLN A;  3HOW C;  4Y52 C;  3GTJ C;  2B63 K;  4A3G C;  4X6A K;  3FKI C;  4YFN A;  5IYC K;  4G7H A;  2WB1 L;  5TMF A;  3EQL A;  2R92 C;  3GTP K;  3S17 C;  3S15 C;  2WAQ L;  4G7O A;  2WB1 D;  2E2I K;  3S1Q C;  4BXX K;  2WAQ D;  3S2D K;  5C44 C;  4AYB L;  4A3L K;  1TWG K;  4MQ9 A;  3RZD C;  3GTK C;  5IP9 K;  3M3Y C;  5M5Y K;  4AYB D;  4A3K C;  2R93 C;  2BE5 A;  4XLP A;  4JK1 A;  1I6H C;  3S14 C;  3CQZ C;  2JA8 C;  3HOV K;  2E2J K;  4OIO A;  5C3E K;  3HOZ C;  4Q4Z A;  2YU9 C;  3PO3 K;  1I6V A;  3I4N C;  4A93 K;  4BY7 K;  4QJV A;  3GTL C;  4MEX A;  3DXJ A;  3S1N C;  4A3C C;  1K83 C;  4LK0 A;  4Y7N K;  4BBS K;  5IP7 C;  4Q5S A;  2B63 C;  1WCM K;  5IYC C;  3GTP C;  3GTM K;  1TWC C;  3RZO K;  3HKZ L;  3GTQ K;  4ZH4 A;  3WOD A;  4OIN A;  2E2I C;  4BXX C;  3H3V L;  3HKZ D;  5M3F K;  3HOY K;  4KN7 A;  4LLG A;  4LK1 A;  4C3H K;  3I4M K;  4YFX A;  1SFO K;  4YFK A;  1TWG C;  4A3M K;  1R9T K;  2E2H K;  3H3V D;  4A3L C;  1TWF C;  4A3I C;  4A3D C;  5TMC A;  1Y1W K;  3S1M K;  5M3M K;  1Y1V K;  3GTO K;  3HOV C;  2O5J A;  2E2J C;  4QJV B;  3PO3 C;  4A3J K;  5C4X C;  4A93 C;  4LJZ A;  3GTG K;  2VUM K;  4KMU A;  2NVY K;  4C3J K;  2CW0 A;  1TWA K;  4NOI A;  4Y7N C;  4BBS C;  3S16 K;  3S1R K;  2NVX K;  2Y0S L;  3K7A K;  4A3F C;  1WCM C;  4XSX A;  2PMZ L;  3GTM C;  3M4O K;  3RZO C;  3GTQ C;  1BDF A;  2A69 A;  2Y0S D;  3HOW K;  4A3D K;  4X6A C;  2PMZ D;  5C4J K;  5IYD K;  4OIP A;  3S17 K;  2R92 K;  2PPB A;  1TWH K;  3HOX K;  3I4M C;  4A3M C;  2A68 A;  3S2D C;  1I3Q K;  4G7Z A;  3H0G K;  5C44 K;  4QIW L;  1Y1W C;  3S1M C;  2PA8 L;  5IP9 C;  1YNN A;  2A6E A;  1I50 K;  1Y1V C;  3GTO C;  2JA5 K;  2PA8 D;  4A3J C;  4OIQ A;  2JA6 K;  2JA7 K;  4A3B K;  4A3E K;  2VUM C;  3HOU K;  2R7Z K;  3S2H K;  2NVY C;  3S14 K;  3CQZ K;  5C3E C;  1TWA C;  4XSZ A;  1XPP A;  3HOZ K;  4BY7 C;  5FJ8 K;  5IYB K;  2NVX C;  3K7A C;  3I4N K;  3PO2 K;  3S1N K;  1HQM A;  4A3C K;  5M5W K;  3M4O C;  1SMY A;  4BBR K;  5IP7 K;  2NVT K;  4BY1 K;  5M5X K;  5IYD C;  5C4J C;  2NVQ K;  1TWC K;  5FLM K;  4MEY A;  1TWH C;  4Y52 K;  3GTJ K;  4A3G K;  3FKI K;  3HOX C;  3S15 K;  4OIR A;  2O5I A;  4C3I K;  3HOY C;  2A6H A;  1I3Q C;  3H0G C;  4GZY A;  1SFO C;  4YG2 A;  2E2H C;  1R9T C;  3S1Q K;  1TWF K;  4A3I K;  1I50 C;  1YNJ A;  4KN4 A;  2JA5 C;  3RZD K;  2JA6 C;  4C2M K;  3GTK K;  2JA7 C;  3M3Y K;  5D4D A;  4A3E C;  4A3B C;  3HOU C;  2R7Z C;  1IW7 A;  4QIW D;  4A3K K;  3S2H C;  2R93 K;  5C4X K;  5IYB C;  3GTG C;  3PO2 C;  1I6H K;  2JA8 K;  1ZYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...