2Y0SL

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
total genus 20
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2y0sL00
3S1RC 1I50K 2A68A 3I4MK 3S1QK 5IP9K 5FLMC 1TWGK 5IYCK 1Y1WK 2PA8L 3GTQK 3HOYK 4BY7C 1YNNA 3HOZK 4ZH4A 1TWCC 1I6HC 4AYBL 3GTJK 2R93K 3HOXK 4A3BK 2Y0SD 2NVTC 1HQMA 2NVYK 2E2JC 2VUMK 4A3EK 1ZYRA 3S2DK 4A3JK 4KN7A 3H0GK 5C4JC 2O5IA 2PA8D 3GTOK 2R92C 4A3FC 2YU9C 5C4XK 3M3YK 3PO2K 4AYBD 4C3JK 2JA8K 4Q5SA 4QJVB 2NVQK 4Y52K 3GTKC 5IYBK 3GTLK 2NVXC 5M5YK 4X6AK 4BXXC 3S14K 4BY1C 3S16K 3GTGK 3CQZK 3S1NK 1Y1VK 3FKIC 5C3EC 4Q4ZA 3RZOK 3S1MC 3HOVC 4BBRC 4A3DK 3K7AC 2PPBA 4QIWL 1XPPA 5IP7K 4A3MK 5C44K 1IW7A 2JA5K 1TWAC 1I50C 1I3QK 3I4MC 3S1QC 5IP9C 4XLNA 4A3IK 1TWGC 5IYCC 5M3FK 1Y1WC 2JA6K 3GTQC 3GTMK 4A3LK 3RZDK 3HOZC 3S15K 2E2IC 1K83K 1BDFA 2O5JA 4YG2A 4XSXA 4OIPA 3GTJC 3HOXC 4OIRA 4QIWD 4A3BC 2R93C 2NVYC 4C3HK 1SFOC 2VUMC 4YFNA 1YNJA 2A69A 5TMCA 2E2HK 4LLGA 4A3EC 3S2DC 5IYDK 5TMFA 4A3JC 3H3VL 3H0GC 5D4DA 3M4OK 3GTOC 3HKZL 2B63K 5C4XC 3M3YC 5FLMK 3PO2C 2JA8C 5M5XK 3S2HK 4Y52C 2NVQC 4BBSK 1TWFK 5IYBC 3HOWK 4OINA 3GTLC 4KN4A 4LK0A 3S17K 4X6AC 2WB1L 1WCMK 4GZYA 3S16C 2A6HA 3GTGC 3CQZC 3H3VD 3PO3K 1SMYA 1R9TK 1Y1VC 3S1NC 3HKZD 4Y7NC 3RZOC 4KMUA 3EQLA 2WAQL 4A3KK 2CW0A 4A3DC 5IP7C 4A3MC 5C44C 1TWHK 2JA5C 2WB1D 4G7ZA 1I3QC 4MQ9A 3HOYC 4A3GK 4A93K 3HOUK 4C3IK 4LJZA 4A3IC 4G7OA 2JA6C 4YFKA 3GTMC 4A3LC 3RZDC 2JA7K 4QJVA 1I6VA 3S15C 1K83C 2WAQD 4JK1A 3I4NK 3GTPK 4C2MK 4A3CK 2R7ZK 4LK1A 3S1RK 2E2HC 4YFXA 4G7HA 3M4OC 4MEXA 1TWAK 2B63C 1TWCK 4OIOA 1I6HK 3S14C 3S2HC 4BBSC 1TWFC 2BE5A 2NVTK 2E2IK 3HOWC 3S17C 2E2JK 4OIQA 3DXJA 2PMZL 1WCMC 4BY7K 2A6EA 1SFOK 5C4JK 1R9TC 3PO3C 5FJ8K 2R92K 4A3FK 2YU9K 5M3MK 4A3KC 3GTKK 5M5WK 1TWHC 2NVXK 2PMZD 4BXXK 4A3GC 4A93C 3WODA 4NOIA 4BY1K 3HOUC 2JA7C 3FKIK 5C3EK 3S1MK 3I4NC 3HOVK 4BBRK 4XSZA 4XLPA 3K7AK 3GTPC 5IYDC 4A3CC 2R7ZC 2Y0SL 4Y7NK 4MEYA
chains in the Genus database with same CATH superfamily
3S1RC 3SZZA 3CQZA 1B4BA 1I50K 2A68A 3GTQK 2PA8L 3AH5A 3BUEA 3OEPA 4GFQA 4LQYA 3GTJK 4A3BK 1O27A 3A8JA 1XZPA 1XXAA 1ZYRA 3S2DK 2P5MA 3TFHA 1ZQ1C 2R92C 4Q5SA 3GEEA 3GTKC 3GTLK 3CQZK 4J3NA 3G4AA 2B63A 4ILDA 4P5AA 1IS1A 1VJEA 4BBRC 1IL2A 2PPBA 3T00A 4QIWL 4A3MK 5C44K 1IW7A 1JQWA 1I50C 4GTEA 2ZUEA 3GTQC 1XZQA 1USOA 1ZBSA 1J98A 3RZDK 3LPXA 1BDFA 1DCHA 4YG2A 3GTJC 4OIPA 4A3BC 1TWHA 1SFOC 2A69A 4YFNA 1YCLA 3S2DC 5IYDK 5TMFA 3CAGA 3N3YA 4M1XA 4GTLA 2B63K 1DCPA 3TFIA 4BY7K 4OINA 3GTLC 1VGXA 4KN4A 2WB1L 2V6TA 1BS2A 3CQZC 4BLBA 3FOFA 4A3MC 5C44C 1TWHK 1XZQB 4G7ZA 3HOYC 1INNA 2W7VA 4C45A 1UV7A 4G7OA 2YU9A 3RZDC 3JSTA 3BP8C 3GIRA 1IBAA 5HL8A 4C2MK 1J6WA 2KWAA 1JVIA 3FKIA 2ZFZA 1TWAK 1B4AA 2B63C 1I6HK 1O28A 3ERED 3S14C 2BE5A 2NVTK 2PMZL 3OREA 1F7UA 2R93A 2YU9K 4P9SA 5M3MK 2V6SA 2NVYA 4KB4A 2VUMA 4KAWX 1TWHC 4KC6A 2Y3PA 3GEIA 4BY1K 3GTOA 1O2AA 3FKIK 5C3EK 4XLPA 4C2MC 2GSUA 4Y7NK 2GSOA 1WOPA 1ISEA 3GTGA 3I4MK 2FQOA 4ZH4A 3AD8C 1I6HC 2R93K 3AD7C 2NVTC 1HQMA 2NVYK 1I3QA 2VUMK 1C0AA 4A3EK 4A3JK 1XXBA 4WJ4A 4LR2A 3GTOK 2YU9C 3M3YK 3PO2K 4C3JK 4WILA 5IOSA 1EH1A 4BY1C 3GTGK 3FKIC 5C3EC 3RZOK 3QX3A 4KMDA 1XPPA 5IP7K 2V6UA 1I3QK 1R9TA 3I4MC 4XLNA 5M3FK 3S0XA 3S15K 3IPJA 2R93C 4OIRA 2NVYC 2VUMC 2E2HK 2XCQA 4A3EC 4A3JC 1VH2A 3GTOC 2R7ZA 3M3YC 5FLMK 3PO2C 4C3JC 1VRQC 5M5XK 3S2HK 3HOWK 4KASA 2JH3A 1WOOA 2A6HA 3GTGC 2XCOA 1SMYA 2GAGC 4BLAA 1R9TK 3Q3QA 3HKZD 3RZOC 2CW0A 5IP7C 1IE0A 1I3QC 4A93K 3T02A 1F7VA 1XZPB 1V5VA 3GSIA 4QJVA 3S15C 2WAQD 1X31C 3I4NK 2R7ZK 4LK1A 1WSVA 2E2HC 1DD5A 5E68A 1BJTA 3HXAA 3L4KA 3GEHA 3S2HC 4DDQA 3HOWC 1PJ6A 1TWAA 2E2IK 1TWGA 4KM8A 1R9TC 4KDDA 3FHZA 1WOSA 4XCHA 3H0GA 4A93C 4NOIA 5TJ3A 4FZBA 5IOQA 3S1MK 5JVOA 3I4NC 1VLOA 3OPFA 3HOVK 5IYDC 2R7ZC 4MEYA 3S1QK 1TWGK 5IYCK 4BY7C 1YNNA 3HOXK 1ZVUA 2Y0SD 1IQ0A 4O2DA 3H0GK 4AYBD 4KATA 4Y52K 4BKWA 5IYBK 1RU0A 4X6AK 3ADAC 3S1NK 2GSNA 3S1MC 3HOVC 4A3DK 1TWFA 1HI9A 4GT9A 1WCMA 4P5BA 1TWAC 3S1QC 4A3IK 1TWGC 5IYCC 1O2BA 2JA6K 1O24A 2D6FC 3VA7A 4XSXA 3HOXC 4LOWA 4C3HK 1YNJA 1BGWA 3A8IA 3H0GC 3T01A 1WSRA 3HKZL 1JOEA 3AQPA 2E2HA 1WIHA 3LAPA 5IOTA 4Y52C 1TWFK 5IYBC 3S17K 4LK0A 4X6AC 1WCMK 3G4CA 3H3VD 3S1NC 1WQHA 4Y7NC 2ZUFA 4G0UA 1G51A 2WAQL 4A3KK 4A3DC 5IORA 4A3GK 3HOUK 4C3IK 1F93A 4A3IC 2JA6C 4YFKA 3AD9C 2JA7K 1I6VA 1KQ4A 4JK1A 1EQRA 4C3HC 4AH6A 1O26A 4YFXA 3BP3A 2XCRB 4KB2A 1TWCK 5CHPA 4OIOA 4FM9A 1YX2A 1TWFC 3A8KA 4KMAA 2E2JK 4OIQA 3S17C 1J6XA 1WCMC 1Y1WA 2A6EA 1SFOK 5C4JK 2E2IA 3L4JA 4A3FK 4KARA 4A3KC 3V4GA 5M5WK 2NVXK 2RGRA 4BXXK 4A3GC 3WODA 4C3IC 3HOUC 3N0BA 2JA7C 3K7AK 1PJ7A 2Y0SL 4WJ3M 1Y1VA 5IP9K 5FLMC 1GE9A 1Y1WK 3GDZA 3HOYK 3HOZK 1TWCC 4PAAA 5CJ9A 3SZYA 4AYBL 2JA5A 2P8TA 2E2JC 4KN7A 4G0WA 3GTMA 5C4JC 5EGHA 2O5IA 2PA8D 1K83A 4A3FC 5C4XK 5EGEA 2JA8K 4QJVB 2NVQK 2NVXC 5M5YK 1J6VA 4BXXC 3S14K 3S16K 1L0WA 1Y1VK 4Q4ZA 1O29A 3TTGA 3K7AC 5JFEA 1XXCA 2JA5K 1F9NA 4PABA 5IP9C 3MMLB 1Y1WC 3GTMK 4RMFA 4A3LK 3LAJA 3HOZC 2E2IC 1K83K 2GAHC 1WQFA 4QIWD 2JA6A 5TMCA 4LLGA 3H3VL 5D4DA 2CFAA 3M4OK 4KMHA 3GTPA 5C4XC 2JA8C 1PJ5A 2NVQC 4BBSK 4GTDA 1EI6A 4GZYA 3S16C 3PO3K 1Y1VC 4KM9A 4KMUA 2PHCB 3EQLA 2RH6A 1EK8A 3NUHA 1O25A 1USMA 2JA5C 2WB1D 4MQ9A 4LJZA 2R92A 3GTMC 4A3LC 3AQOA 1O2FB 1K83C 1WORA 3GTKA 3GTPK 4A3CK 3FOEA 2JA7A 2CFAB 3S1RK 4GTAA 4G7HA 3M4OC 2FQTA 4MEXA 5L46A 4BBSC 3N0CA 1I50A 1TWCA 3DXJA 3GTQA 4GTCA 1EFWA 3PO3C 5FJ8K 2R92K 3GTJA 1SFOA 1ZXOA 3GTKK 2PMZD 1AB4A 1DCOA 4GTBA 4GTFA 2NVXA 2EBBA 4G0VA 4BBRK 4XSZA 1WQGA 3GTPC 4A3CC 3GTLA 3TFJA 2O5JA
chains in the Genus database with same CATH topology
3S1RC 1I50K 2A68A 3I4MK 3S1QK 5IP9K 5FLMC 1TWGK 5IYCK 1Y1WK 2PA8L 3GTQK 3HOYK 4BY7C 1YNNA 3HOZK 4ZH4A 1TWCC 1I6HC 4AYBL 3GTJK 2R93K 3HOXK 4A3BK 2Y0SD 2NVTC 1HQMA 2NVYK 2E2JC 2VUMK 4A3EK 1ZYRA 3S2DK 4A3JK 4KN7A 3H0GK 5C4JC 2O5IA 2PA8D 3GTOK 2R92C 4A3FC 2YU9C 5C4XK 3M3YK 3PO2K 4AYBD 4C3JK 2JA8K 4Q5SA 4QJVB 2NVQK 4Y52K 3GTKC 5IYBK 3GTLK 2NVXC 5M5YK 4X6AK 4BXXC 3S14K 4BY1C 3S16K 3GTGK 3CQZK 3S1NK 1Y1VK 3FKIC 5C3EC 4Q4ZA 3RZOK 3S1MC 3HOVC 4BBRC 4A3DK 3K7AC 2PPBA 4QIWL 1XPPA 5IP7K 4A3MK 5C44K 1IW7A 2JA5K 1TWAC 1I50C 1I3QK 3I4MC 3S1QC 5IP9C 4XLNA 4A3IK 1TWGC 5IYCC 5M3FK 1Y1WC 2JA6K 3GTQC 3GTMK 4A3LK 3RZDK 3HOZC 3S15K 2E2IC 1K83K 1BDFA 2O5JA 4YG2A 4XSXA 4OIPA 3GTJC 3HOXC 4OIRA 4QIWD 4A3BC 2R93C 2NVYC 4C3HK 1SFOC 2VUMC 4YFNA 1YNJA 2A69A 5TMCA 2E2HK 4LLGA 4A3EC 3S2DC 5IYDK 5TMFA 4A3JC 3H3VL 3H0GC 5D4DA 3M4OK 3GTOC 3HKZL 2B63K 5C4XC 3M3YC 5FLMK 3PO2C 2JA8C 5M5XK 3S2HK 4Y52C 2NVQC 4BBSK 1TWFK 5IYBC 3HOWK 4OINA 3GTLC 4KN4A 4LK0A 3S17K 4X6AC 2WB1L 1WCMK 4GZYA 3S16C 2A6HA 3GTGC 3CQZC 3H3VD 3PO3K 1SMYA 1R9TK 1Y1VC 3S1NC 3HKZD 4Y7NC 3RZOC 4KMUA 3EQLA 2WAQL 4A3KK 2CW0A 4A3DC 5IP7C 4A3MC 5C44C 1TWHK 2JA5C 2WB1D 4G7ZA 1I3QC 4MQ9A 3HOYC 4A3GK 4A93K 3HOUK 4C3IK 4LJZA 4A3IC 4G7OA 2JA6C 4YFKA 3GTMC 4A3LC 3RZDC 2JA7K 4QJVA 1I6VA 3S15C 1K83C 2WAQD 4JK1A 3I4NK 3GTPK 4C2MK 4A3CK 2R7ZK 4LK1A 3S1RK 2E2HC 4YFXA 4G7HA 3M4OC 4MEXA 1TWAK 2B63C 1TWCK 4OIOA 1I6HK 3S14C 3S2HC 4BBSC 1TWFC 2BE5A 2NVTK 2E2IK 3HOWC 3S17C 2E2JK 4OIQA 3DXJA 2PMZL 1WCMC 4BY7K 2A6EA 1SFOK 5C4JK 1R9TC 3PO3C 5FJ8K 2R92K 4A3FK 2YU9K 5M3MK 4A3KC 3GTKK 5M5WK 1TWHC 2NVXK 2PMZD 4BXXK 4A3GC 4A93C 3WODA 4NOIA 4BY1K 3HOUC 2JA7C 3FKIK 5C3EK 3S1MK 3I4NC 3HOVK 4BBRK 4XSZA 4XLPA 3K7AK 3GTPC 5IYDC 4A3CC 2R7ZC 2Y0SL 4Y7NK 4MEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R C;  1I50 K;  2A68 A;  3I4M K;  3S1Q K;  5IP9 K;  5FLM C;  1TWG K;  5IYC K;  1Y1W K;  2PA8 L;  3GTQ K;  3HOY K;  4BY7 C;  1YNN A;  3HOZ K;  4ZH4 A;  1TWC C;  1I6H C;  4AYB L;  3GTJ K;  2R93 K;  3HOX K;  4A3B K;  2Y0S D;  2NVT C;  1HQM A;  2NVY K;  2E2J C;  2VUM K;  4A3E K;  1ZYR A;  3S2D K;  4A3J K;  4KN7 A;  3H0G K;  5C4J C;  2O5I A;  2PA8 D;  3GTO K;  2R92 C;  4A3F C;  2YU9 C;  5C4X K;  3M3Y K;  3PO2 K;  4AYB D;  4C3J K;  2JA8 K;  4Q5S A;  4QJV B;  2NVQ K;  4Y52 K;  3GTK C;  5IYB K;  3GTL K;  2NVX C;  5M5Y K;  4X6A K;  4BXX C;  3S14 K;  4BY1 C;  3S16 K;  3GTG K;  3CQZ K;  3S1N K;  1Y1V K;  3FKI C;  5C3E C;  4Q4Z A;  3RZO K;  3S1M C;  3HOV C;  4BBR C;  4A3D K;  3K7A C;  2PPB A;  4QIW L;  1XPP A;  5IP7 K;  4A3M K;  5C44 K;  1IW7 A;  2JA5 K;  1TWA C;  1I50 C;  1I3Q K;  3I4M C;  3S1Q C;  5IP9 C;  4XLN A;  4A3I K;  1TWG C;  5IYC C;  5M3F K;  1Y1W C;  2JA6 K;  3GTQ C;  3GTM K;  4A3L K;  3RZD K;  3HOZ C;  3S15 K;  2E2I C;  1K83 K;  1BDF A;  2O5J A;  4YG2 A;  4XSX A;  4OIP A;  3GTJ C;  3HOX C;  4OIR A;  4QIW D;  4A3B C;  2R93 C;  2NVY C;  4C3H K;  1SFO C;  2VUM C;  4YFN A;  1YNJ A;  2A69 A;  5TMC A;  2E2H K;  4LLG A;  4A3E C;  3S2D C;  5IYD K;  5TMF A;  4A3J C;  3H3V L;  3H0G C;  5D4D A;  3M4O K;  3GTO C;  3HKZ L;  2B63 K;  5C4X C;  3M3Y C;  5FLM K;  3PO2 C;  2JA8 C;  5M5X K;  3S2H K;  4Y52 C;  2NVQ C;  4BBS K;  1TWF K;  5IYB C;  3HOW K;  4OIN A;  3GTL C;  4KN4 A;  4LK0 A;  3S17 K;  4X6A C;  2WB1 L;  1WCM K;  4GZY A;  3S16 C;  2A6H A;  3GTG C;  3CQZ C;  3H3V D;  3PO3 K;  1SMY A;  1R9T K;  1Y1V C;  3S1N C;  3HKZ D;  4Y7N C;  3RZO C;  4KMU A;  3EQL A;  2WAQ L;  4A3K K;  2CW0 A;  4A3D C;  5IP7 C;  4A3M C;  5C44 C;  1TWH K;  2JA5 C;  2WB1 D;  4G7Z A;  1I3Q C;  4MQ9 A;  3HOY C;  4A3G K;  4A93 K;  3HOU K;  4C3I K;  4LJZ A;  4A3I C;  4G7O A;  2JA6 C;  4YFK A;  3GTM C;  4A3L C;  3RZD C;  2JA7 K;  4QJV A;  1I6V A;  3S15 C;  1K83 C;  2WAQ D;  4JK1 A;  3I4N K;  3GTP K;  4C2M K;  4A3C K;  2R7Z K;  4LK1 A;  3S1R K;  2E2H C;  4YFX A;  4G7H A;  3M4O C;  4MEX A;  1TWA K;  2B63 C;  1TWC K;  4OIO A;  1I6H K;  3S14 C;  3S2H C;  4BBS C;  1TWF C;  2BE5 A;  2NVT K;  2E2I K;  3HOW C;  3S17 C;  2E2J K;  4OIQ A;  3DXJ A;  2PMZ L;  1WCM C;  4BY7 K;  2A6E A;  1SFO K;  5C4J K;  1R9T C;  3PO3 C;  5FJ8 K;  2R92 K;  4A3F K;  2YU9 K;  5M3M K;  4A3K C;  3GTK K;  5M5W K;  1TWH C;  2NVX K;  2PMZ D;  4BXX K;  4A3G C;  4A93 C;  3WOD A;  4NOI A;  4BY1 K;  3HOU C;  2JA7 C;  3FKI K;  5C3E K;  3S1M K;  3I4N C;  3HOV K;  4BBR K;  4XSZ A;  4XLP A;  3K7A K;  3GTP C;  5IYD C;  4A3C C;  2R7Z C;  2Y0S L;  4Y7N K;  4MEY A; 
#chains in the Genus database with same CATH topology
 3S1R C;  3SZZ A;  3CQZ A;  1B4B A;  1I50 K;  2A68 A;  3GTQ K;  2PA8 L;  3AH5 A;  3BUE A;  3OEP A;  4GFQ A;  4LQY A;  3GTJ K;  4A3B K;  1O27 A;  3A8J A;  1XZP A;  1XXA A;  1ZYR A;  3S2D K;  2P5M A;  3TFH A;  1ZQ1 C;  2R92 C;  4Q5S A;  3GEE A;  3GTK C;  3GTL K;  3CQZ K;  4J3N A;  3G4A A;  2B63 A;  4ILD A;  4P5A A;  1IS1 A;  1VJE A;  4BBR C;  1IL2 A;  2PPB A;  3T00 A;  4QIW L;  4A3M K;  5C44 K;  1IW7 A;  1JQW A;  1I50 C;  4GTE A;  2ZUE A;  3GTQ C;  1XZQ A;  1USO A;  1ZBS A;  1J98 A;  3RZD K;  3LPX A;  1BDF A;  1DCH A;  4YG2 A;  3GTJ C;  4OIP A;  4A3B C;  1TWH A;  1SFO C;  2A69 A;  4YFN A;  1YCL A;  3S2D C;  5IYD K;  5TMF A;  3CAG A;  3N3Y A;  4M1X A;  4GTL A;  2B63 K;  1DCP A;  3TFI A;  4BY7 K;  4OIN A;  3GTL C;  1VGX A;  4KN4 A;  2WB1 L;  2V6T A;  1BS2 A;  3CQZ C;  4BLB A;  3FOF A;  4A3M C;  5C44 C;  1TWH K;  1XZQ B;  4G7Z A;  3HOY C;  1INN A;  2W7V A;  4C45 A;  1UV7 A;  4G7O A;  2YU9 A;  3RZD C;  3JST A;  3BP8 C;  3GIR A;  1IBA A;  5HL8 A;  4C2M K;  1J6W A;  2KWA A;  1JVI A;  3FKI A;  2ZFZ A;  1TWA K;  1B4A A;  2B63 C;  1I6H K;  1O28 A;  3ERE D;  3S14 C;  2BE5 A;  2NVT K;  2PMZ L;  3ORE A;  1F7U A;  2R93 A;  2YU9 K;  4P9S A;  5M3M K;  2V6S A;  2NVY A;  4KB4 A;  2VUM A;  4KAW X;  1TWH C;  4KC6 A;  2Y3P A;  3GEI A;  4BY1 K;  3GTO A;  1O2A A;  3FKI K;  5C3E K;  4XLP A;  4C2M C;  2GSU A;  4Y7N K;  2GSO A;  1WOP A;  1ISE A;  3GTG A;  3I4M K;  2FQO A;  4ZH4 A;  3AD8 C;  1I6H C;  2R93 K;  3AD7 C;  2NVT C;  1HQM A;  2NVY K;  1I3Q A;  2VUM K;  1C0A A;  4A3E K;  4A3J K;  1XXB A;  4WJ4 A;  4LR2 A;  3GTO K;  2YU9 C;  3M3Y K;  3PO2 K;  4C3J K;  4WIL A;  5IOS A;  1EH1 A;  4BY1 C;  3GTG K;  3FKI C;  5C3E C;  3RZO K;  3QX3 A;  4KMD A;  1XPP A;  5IP7 K;  2V6U A;  1I3Q K;  1R9T A;  3I4M C;  4XLN A;  5M3F K;  3S0X A;  3S15 K;  3IPJ A;  2R93 C;  4OIR A;  2NVY C;  2VUM C;  2E2H K;  2XCQ A;  4A3E C;  4A3J C;  1VH2 A;  3GTO C;  2R7Z A;  3M3Y C;  5FLM K;  3PO2 C;  4C3J C;  1VRQ C;  5M5X K;  3S2H K;  3HOW K;  4KAS A;  2JH3 A;  1WOO A;  2A6H A;  3GTG C;  2XCO A;  1SMY A;  2GAG C;  4BLA A;  1R9T K;  3Q3Q A;  3HKZ D;  3RZO C;  2CW0 A;  5IP7 C;  1IE0 A;  1I3Q C;  4A93 K;  3T02 A;  1F7V A;  1XZP B;  1V5V A;  3GSI A;  4QJV A;  3S15 C;  2WAQ D;  1X31 C;  3I4N K;  2R7Z K;  4LK1 A;  1WSV A;  2E2H C;  1DD5 A;  5E68 A;  1BJT A;  3HXA A;  3L4K A;  3GEH A;  3S2H C;  4DDQ A;  3HOW C;  1PJ6 A;  1TWA A;  2E2I K;  1TWG A;  4KM8 A;  1R9T C;  4KDD A;  3FHZ A;  1WOS A;  4XCH A;  3H0G A;  4A93 C;  4NOI A;  5TJ3 A;  4FZB A;  5IOQ A;  3S1M K;  5JVO A;  3I4N C;  1VLO A;  3OPF A;  3HOV K;  5IYD C;  2R7Z C;  4MEY A;  3S1Q K;  1TWG K;  5IYC K;  4BY7 C;  1YNN A;  3HOX K;  1ZVU A;  2Y0S D;  1IQ0 A;  4O2D A;  3H0G K;  4AYB D;  4KAT A;  4Y52 K;  4BKW A;  5IYB K;  1RU0 A;  4X6A K;  3ADA C;  3S1N K;  2GSN A;  3S1M C;  3HOV C;  4A3D K;  1TWF A;  1HI9 A;  4GT9 A;  1WCM A;  4P5B A;  1TWA C;  3S1Q C;  4A3I K;  1TWG C;  5IYC C;  1O2B A;  2JA6 K;  1O24 A;  2D6F C;  3VA7 A;  4XSX A;  3HOX C;  4LOW A;  4C3H K;  1YNJ A;  1BGW A;  3A8I A;  3H0G C;  3T01 A;  1WSR A;  3HKZ L;  1JOE A;  3AQP A;  2E2H A;  1WIH A;  3LAP A;  5IOT A;  4Y52 C;  1TWF K;  5IYB C;  3S17 K;  4LK0 A;  4X6A C;  1WCM K;  3G4C A;  3H3V D;  3S1N C;  1WQH A;  4Y7N C;  2ZUF A;  4G0U A;  1G51 A;  2WAQ L;  4A3K K;  4A3D C;  5IOR A;  4A3G K;  3HOU K;  4C3I K;  1F93 A;  4A3I C;  2JA6 C;  4YFK A;  3AD9 C;  2JA7 K;  1I6V A;  1KQ4 A;  4JK1 A;  1EQR A;  4C3H C;  4AH6 A;  1O26 A;  4YFX A;  3BP3 A;  2XCR B;  4KB2 A;  1TWC K;  5CHP A;  4OIO A;  4FM9 A;  1YX2 A;  1TWF C;  3A8K A;  4KMA A;  2E2J K;  4OIQ A;  3S17 C;  1J6X A;  1WCM C;  1Y1W A;  2A6E A;  1SFO K;  5C4J K;  2E2I A;  3L4J A;  4A3F K;  4KAR A;  4A3K C;  3V4G A;  5M5W K;  2NVX K;  2RGR A;  4BXX K;  4A3G C;  3WOD A;  4C3I C;  3HOU C;  3N0B A;  2JA7 C;  3K7A K;  1PJ7 A;  2Y0S L;  4WJ3 M;  1Y1V A;  5IP9 K;  5FLM C;  1GE9 A;  1Y1W K;  3GDZ A;  3HOY K;  3HOZ K;  1TWC C;  4PAA A;  5CJ9 A;  3SZY A;  4AYB L;  2JA5 A;  2P8T A;  2E2J C;  4KN7 A;  4G0W A;  3GTM A;  5C4J C;  5EGH A;  2O5I A;  2PA8 D;  1K83 A;  4A3F C;  5C4X K;  5EGE A;  2JA8 K;  4QJV B;  2NVQ K;  2NVX C;  5M5Y K;  1J6V A;  4BXX C;  3S14 K;  3S16 K;  1L0W A;  1Y1V K;  4Q4Z A;  1O29 A;  3TTG A;  3K7A C;  5JFE A;  1XXC A;  2JA5 K;  1F9N A;  4PAB A;  5IP9 C;  3MML B;  1Y1W C;  3GTM K;  4RMF A;  4A3L K;  3LAJ A;  3HOZ C;  2E2I C;  1K83 K;  2GAH C;  1WQF A;  4QIW D;  2JA6 A;  5TMC A;  4LLG A;  3H3V L;  5D4D A;  2CFA A;  3M4O K;  4KMH A;  3GTP A;  5C4X C;  2JA8 C;  1PJ5 A;  2NVQ C;  4BBS K;  4GTD A;  1EI6 A;  4GZY A;  3S16 C;  3PO3 K;  1Y1V C;  4KM9 A;  4KMU A;  2PHC B;  3EQL A;  2RH6 A;  1EK8 A;  3NUH A;  1O25 A;  1USM A;  2JA5 C;  2WB1 D;  4MQ9 A;  4LJZ A;  2R92 A;  3GTM C;  4A3L C;  3AQO A;  1O2F B;  1K83 C;  1WOR A;  3GTK A;  3GTP K;  4A3C K;  3FOE A;  2JA7 A;  2CFA B;  3S1R K;  4GTA A;  4G7H A;  3M4O C;  2FQT A;  4MEX A;  5L46 A;  4BBS C;  3N0C A;  1I50 A;  1TWC A;  3DXJ A;  3GTQ A;  4GTC A;  1EFW A;  3PO3 C;  5FJ8 K;  2R92 K;  3GTJ A;  1SFO A;  1ZXO A;  3GTK K;  2PMZ D;  1AB4 A;  1DCO A;  4GTB A;  4GTF A;  2NVX A;  2EBB A;  4G0V A;  4BBR K;  4XSZ A;  1WQG A;  3GTP C;  4A3C C;  3GTL A;  3TFJ A;  2O5J A; 
#chains in the Genus database with same CATH homology
 3S1R C;  1I50 K;  2A68 A;  3I4M K;  3S1Q K;  5IP9 K;  5FLM C;  1TWG K;  5IYC K;  1Y1W K;  2PA8 L;  3GTQ K;  3HOY K;  4BY7 C;  1YNN A;  3HOZ K;  4ZH4 A;  1TWC C;  1I6H C;  4AYB L;  3GTJ K;  2R93 K;  3HOX K;  4A3B K;  2Y0S D;  2NVT C;  1HQM A;  2NVY K;  2E2J C;  2VUM K;  4A3E K;  1ZYR A;  3S2D K;  4A3J K;  4KN7 A;  3H0G K;  5C4J C;  2O5I A;  2PA8 D;  3GTO K;  2R92 C;  4A3F C;  2YU9 C;  5C4X K;  3M3Y K;  3PO2 K;  4AYB D;  4C3J K;  2JA8 K;  4Q5S A;  4QJV B;  2NVQ K;  4Y52 K;  3GTK C;  5IYB K;  3GTL K;  2NVX C;  5M5Y K;  4X6A K;  4BXX C;  3S14 K;  4BY1 C;  3S16 K;  3GTG K;  3CQZ K;  3S1N K;  1Y1V K;  3FKI C;  5C3E C;  4Q4Z A;  3RZO K;  3S1M C;  3HOV C;  4BBR C;  4A3D K;  3K7A C;  2PPB A;  4QIW L;  1XPP A;  5IP7 K;  4A3M K;  5C44 K;  1IW7 A;  2JA5 K;  1TWA C;  1I50 C;  1I3Q K;  3I4M C;  3S1Q C;  5IP9 C;  4XLN A;  4A3I K;  1TWG C;  5IYC C;  5M3F K;  1Y1W C;  2JA6 K;  3GTQ C;  3GTM K;  4A3L K;  3RZD K;  3HOZ C;  3S15 K;  2E2I C;  1K83 K;  1BDF A;  2O5J A;  4YG2 A;  4XSX A;  4OIP A;  3GTJ C;  3HOX C;  4OIR A;  4QIW D;  4A3B C;  2R93 C;  2NVY C;  4C3H K;  1SFO C;  2VUM C;  4YFN A;  1YNJ A;  2A69 A;  5TMC A;  2E2H K;  4LLG A;  4A3E C;  3S2D C;  5IYD K;  5TMF A;  4A3J C;  3H3V L;  3H0G C;  5D4D A;  3M4O K;  3GTO C;  3HKZ L;  2B63 K;  5C4X C;  3M3Y C;  5FLM K;  3PO2 C;  2JA8 C;  5M5X K;  3S2H K;  4Y52 C;  2NVQ C;  4BBS K;  1TWF K;  5IYB C;  3HOW K;  4OIN A;  3GTL C;  4KN4 A;  4LK0 A;  3S17 K;  4X6A C;  2WB1 L;  1WCM K;  4GZY A;  3S16 C;  2A6H A;  3GTG C;  3CQZ C;  3H3V D;  3PO3 K;  1SMY A;  1R9T K;  1Y1V C;  3S1N C;  3HKZ D;  4Y7N C;  3RZO C;  4KMU A;  3EQL A;  2WAQ L;  4A3K K;  2CW0 A;  4A3D C;  5IP7 C;  4A3M C;  5C44 C;  1TWH K;  2JA5 C;  2WB1 D;  4G7Z A;  1I3Q C;  4MQ9 A;  3HOY C;  4A3G K;  4A93 K;  3HOU K;  4C3I K;  4LJZ A;  4A3I C;  4G7O A;  2JA6 C;  4YFK A;  3GTM C;  4A3L C;  3RZD C;  2JA7 K;  4QJV A;  1I6V A;  3S15 C;  1K83 C;  2WAQ D;  4JK1 A;  3I4N K;  3GTP K;  4C2M K;  4A3C K;  2R7Z K;  4LK1 A;  3S1R K;  2E2H C;  4YFX A;  4G7H A;  3M4O C;  4MEX A;  1TWA K;  2B63 C;  1TWC K;  4OIO A;  1I6H K;  3S14 C;  3S2H C;  4BBS C;  1TWF C;  2BE5 A;  2NVT K;  2E2I K;  3HOW C;  3S17 C;  2E2J K;  4OIQ A;  3DXJ A;  2PMZ L;  1WCM C;  4BY7 K;  2A6E A;  1SFO K;  5C4J K;  1R9T C;  3PO3 C;  5FJ8 K;  2R92 K;  4A3F K;  2YU9 K;  5M3M K;  4A3K C;  3GTK K;  5M5W K;  1TWH C;  2NVX K;  2PMZ D;  4BXX K;  4A3G C;  4A93 C;  3WOD A;  4NOI A;  4BY1 K;  3HOU C;  2JA7 C;  3FKI K;  5C3E K;  3S1M K;  3I4N C;  3HOV K;  4BBR K;  4XSZ A;  4XLP A;  3K7A K;  3GTP C;  5IYD C;  4A3C C;  2R7Z C;  2Y0S L;  4Y7N K;  4MEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...