2Y0SL

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 20
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2y0sL00
3PO2K 5TMCA 2PMZL 4A3EK 2E2JC 3S1RK 4A3CC 3GTOC 2E2HC 3S15K 4Q4ZA 3HOWC 3HOZC 4BBSK 2R7ZK 3I4MK 4XLNA 1SMYA 2JA7C 2PA8L 2PPBA 4A3MC 1TWGC 3RZOK 3EQLA 5FLMC 2B63K 4BXXK 5M3FK 4A3JC 2A68A 5IP7K 3PO2C 1WCMC 2Y0SD 3WODA 2A6EA 4MEYA 5D4DA 3RZDC 4BY7C 1R9TC 5C4XK 4A3DK 1I6HK 2JA8K 4OIRA 4YFNA 2NVXK 2JA6K 2NVTK 4XLPA 1TWCK 4ZH4A 2Y0SL 3HOXK 4A3FK 1K83C 3FKIC 4OIQA 3H0GC 5IP9K 4BBRC 5C44C 3DXJA 3S2DC 4A3LC 1XPPA 4C3HK 3HOXC 3S1QC 4G7OA 3HOUC 2JA5C 2WAQD 3GTJC 1HQMA 5IYBC 3HKZL 1SFOK 2PMZD 3S1NK 4X6AC 2R7ZC 4A3KK 5M3MK 2WB1D 3S15C 4LLGA 3GTMC 4A3IC 2WAQL 4NOIA 4Q5SA 3CQZK 3GTPC 5M5XK 3H3VL 4LK0A 1Y1VC 4Y52C 4A3EC 1TWAK 2JA7K 3S1RC 4A3FC 3GTMK 1TWCC 3FKIK 4OINA 2PA8D 4Y7NK 4KN7A 3S17C 3PO3K 4XSZA 3HOWK 2CW0A 1I6HC 3HOZK 3HOUK 3K7AK 4Y7NC 3GTJK 3S17K 5C3EK 2R93K 3HKZD 3HOYK 1K83K 2VUMC 2B63C 4BXXC 3RZOC 5C3EC 4A3GK 2WB1L 5TMFA 5M5YK 3GTKC 3S1MK 4YG2A 1TWFK 2NVYC 3RZDK 2O5IA 1I6VA 2JA8C 3M4OC 5C4XC 4A3KC 1I3QC 2JA5K 2NVYK 2R92C 5IYCC 2NVQK 2E2HK 3S16K 3GTLK 1TWGK 5IP9C 5FLMK 1YNJA 4A3LK 2YU9K 3S2DK 4BBRK 1I50K 5C44K 4MEXA 4AYBL 2NVQC 2A69A 2VUMK 3S16C 4BBSC 3HOVC 3I4NC 4A93K 1I50C 4LJZA 3S1NC 1R9TK 3H3VD 3GTKK 4A3DC 3S14K 2E2JK 4A3CK 3PO3C 4BY1K 3GTOK 1WCMK 4MQ9A 3GTQC 1I3QK 3H0GK 1TWAC 4QJVB 2E2IK 1Y1VK 1Y1WC 3GTGK 4Y52K 5FJ8K 2R93C 3I4MC 2A6HA 4OIPA 1Y1WK 3GTGC 4A3GC 4G7ZA 1TWHC 3HOVK 3I4NK 4QJVA 4C3JK 3S2HC 4A3BC 4GZYA 4YFKA 5IP7C 4QIWD 3GTLC 4A3JK 4A3IK 4LK1A 4XSXA 3GTPK 4G7HA 4YFXA 5IYDK 4A3MK 5C4JC 4X6AK 4OIOA 1TWFC 5IYDC 2NVXC 2YU9C 2NVTC 2JA6C 5C4JK 3M4OK 1BDFA 5M5WK 3CQZC 4AYBD 5IYCK 4BY7K 2R92K 3S1QK 4BY1C 2O5JA 3HOYC 1TWHK 2BE5A 3GTQK 4KN4A 3S2HK 1IW7A 3S14C 4A3BK 3M3YC 1ZYRA 4JK1A 4C2MK 5IYBK 1SFOC 1YNNA 4QIWL 4KMUA 3S1MC 3K7AC 4C3IK 3M3YK 2E2IC 4A93C
chains in the Genus database with same CATH superfamily
3T00A 2B63A 4GT9A 4A3CC 3ADAC 4XCHA 3S15K 1J98A 4Q4ZA 3HOWC 3JSTA 2R7ZK 2JA7C 2PPBA 4A3MC 4C3HC 1TWGC 3A8JA 2GSOA 2A68A 3PO2C 4MEYA 1G51A 3OEPA 1I6HK 1WQHA 2KWAA 2NVTK 4XLPA 1TWCK 3H0GC 5C44C 3DXJA 3S2DC 5IOQA 1ZQ1C 3HOUC 2R92A 1WSRA 4C2MC 3CAGA 3GTMA 1EK8A 5M3MK 3S15C 1JOEA 4LLGA 3CQZA 2Y3PA 3GTPC 1WOOA 4GTFA 4Y52C 4A3EC 1WOPA 2JA7K 4KMAA 1B4BA 4OINA 3S17C 1EFWA 4KN7A 4FM9A 2NVXA 3K7AK 3S17K 1XXCA 3HKZD 3GSIA 3GTGA 5EGHA 4GTEA 1O25A 4YG2A 4C3IC 2NVYC 3RZDK 2RH6A 2O5IA 3M4OC 5C4XC 1I3QC 3AD8C 3QX3A 2NVYK 2NVQK 5FLMK 4AH6A 3S2DK 4GFQA 2V6SA 2NVQC 4M1XA 4AYBL 4GTCA 2V6TA 1ZVUA 1R9TK 4A3DC 1O2BA 1PJ7A 4A3CK 4BY1K 3GTOK 1XXBA 2ZUEA 1VGXA 1RU0A 2A6HA 4QJVA 4A3BC 4GZYA 4O2DA 3GTLC 4A3IK 1EH1A 1XZQA 4YFXA 3TTGA 3A8KA 4X6AK 1DD5A 1USMA 2JA6C 1BDFA 5CHPA 4AYBD 1JQWA 4BY7K 2R92K 3HOYC 1Y1VA 1USOA 1INNA 1WCMA 3M3YC 1ZYRA 4JK1A 5TJ3A 5IYBK 4KB2A 4C2MK 1YNNA 3S1MC 1WQFA 3M3YK 4A93C 1IQ0A 4A3EK 4KMDA 2E2JC 3GTOC 2E2HC 1O27A 1AB4A 4J3NA 4BBSK 2R7ZA 2GSUA 4PABA 1YCLA 1WIHA 4BXXK 1JVIA 5IP7K 3GEHA 1WCMC 3WODA 1DCHA 5D4DA 1WQGA 3RZDC 4BY7C 5C4XK 4BLAA 2R93A 2JA8K 4OIRA 2JA6K 1O26A 4LOWA 2Y0SL 4A3FK 1K83C 3T01A 3S1QC 1O29A 1WORA 5IYBC 2JA7A 4A3KK 3GTPA 3LAPA 2EBBA 1B4AA 2WAQL 3CQZK 1TWAK 3G4CA 1TWCC 1XZQB 3FKIK 2XCQA 3HOZK 4KC6A 3GTJK 3N0BA 1IBAA 4BXXC 2P5MA 3Q3QA 2WB1L 1R9TA 5IOTA 2JA8C 3GTKA 2JH3A 1BS2A 1TWGA 2R92C 5IYCC 2XCRB 4KM9A 2NVYA 2YU9K 4MEXA 4P5AA 5E68A 4G0VA 2VUMK 4A93K 3GTKK 3BP8C 5IOSA 2E2JK 3AQOA 5EGEA 1ZXOA 1VH2A 4MQ9A 1I3QK 1TWAC 1EI6A 5JFEA 4G0WA 3MMLB 3AD9C 1KQ4A 3GTJA 3NUHA 4OIPA 3HOVK 3I4NK 4YFKA 3FKIA 5IP7C 4A3JK 1O2FB 1IE0A 2GAGC 2YU9C 4KASA 5IYCK 4GTAA 3S1QK 4KB4A 1TWCA 3VA7A 1TWHK 3GTQK 3S2HK 1XXAA 4QIWL 4KMUA 3K7AC 2P8TA 5TMCA 2PMZL 2VUMA 4G0UA 3HOZC 1GE9A 3TFHA 4XLNA 4KAWX 3A8IA 5FLMC 2B63K 5M3FK 4A3JC 3SZZA 2Y0SD 5L46A 2GAHC 1R9TC 4A3DK 4WJ3M 2PHCB 4YFNA 2RGRA 3HOXK 4OIQA 3GDZA 5IP9K 4BLBA 4A3LC 4C3HK 3HOXC 4G7OA 2ZUFA 2WAQD 3HKZL 2PMZD 3OREA 5JVOA 4KARA 3L4JA 3LPXA 2R7ZC 4KATA 4A3IC 4NOIA 4Q5SA 5M5XK 3TFIA 4LK0A 3T02A 1F9NA 1VRQC 3S1RC 4FZBA 1O2AA 4Y7NK 1DCPA 2CW0A 1I6HC 1PJ6A 3HOUK 2JA6A 4Y7NC 3FHZA 5C3EK 2R93K 1J6XA 3HOYK 1O24A 2B63C 3RZOC 5C3EC 3AQPA 4A3GK 5TMFA 5M5YK 4RMFA 1F93A 3S1MK 4P9SA 1TWFK 1DCOA 1EQRA 3N3YA 4KMHA 3S16K 2E2HK 3GTLK 1TWGK 1I50A 5IP9C 2JA5A 4A3LK 4BBRK 1I50K 3S16C 3GTLA 2A69A 4BBSC 1I50C 4LJZA 3OPFA 4ILDA 1K83A 1O28A 1WCMK 1V5VA 3H0GK 4QJVB 2E2IK 1Y1VK 1Y1WC 3GTGK 5FJ8K 1IS1A 2R93C 3BUEA 1XZPB 1Y1WK 3GTGC 4A3GC 1TWAA 1UV7A 4C3JK 4LK1A 3IPJA 4XSXA 3GTPK 3GEIA 5IYDK 5C4JC 3AH5A 4LR2A 1TWFC 1ZBSA 5IYDC 1J6VA 2NVXC 5C4JK 3S0XA 5M5WK 3CQZC 1WOSA 2O5JA 3ERED 4BY1C 2GSNA 2E2IA 1Y1WA 4A3BK 1L0WA 3GEEA 1C0AA 4GTLA 4C3IK 2E2IC 3PO2K 3GTOA 1J6WA 4C45A 2CFAA 3S1RK 1VJEA 3N0CA 3L4KA 4LQYA 3LAJA 2E2HA 1XZPA 4GTDA 3I4MK 1SMYA 2PA8L 2XCOA 1ISEA 4KM8A 3RZOK 3EQLA 4WJ4A 1X31C 3G4AA 1TWFA 2A6EA 2CFAB 2NVXK 3BP3A 4ZH4A 1WSVA 3FKIC 1BGWA 4BBRC 1YX2A 1XPPA 5CJ9A 3TFJA 2JA5C 3GTJC 1HQMA 3FOFA 1SFOK 1F7VA 4BKWA 3S1NK 4X6AC 2WB1D 3HXAA 2V6UA 3GTMC 3H3VL 1Y1VC 4A3FC 3GTMK 2PA8D 3PO3K 4XSZA 3HOWK 3H0GA 1BJTA 1F7UA 1K83K 2VUMC 1I3QA 3AD7C 3GTKC 1VLOA 4KDDA 2FQOA 1I6VA 4A3KC 2JA5K 2YU9A 1YNJA 5C44K 3HOVC 3I4NC 1IL2A 3S1NC 3H3VD 3V4GA 1HI9A 3S14K 3PO3C 3GIRA 3GTQC 5IORA 2FQTA 1TWHA 4Y52K 3I4MC 3GTQA 4G7ZA 1TWHC 4DDQA 3S2HC 4QIWD 4WILA 4G7HA 4A3MK 4OIOA 4P5BA 2NVTC 3M4OK 2D6FC 1SFOA 2ZFZA 5HL8A 3SZYA 4GTBA 2BE5A 4KN4A 1IW7A 3S14C 4C3JC 1SFOC 4PAAA 2W7VA 1PJ5A 3FOEA
chains in the Genus database with same CATH topology
3PO2K 5TMCA 2PMZL 4A3EK 2E2JC 3S1RK 4A3CC 3GTOC 2E2HC 3S15K 4Q4ZA 3HOWC 3HOZC 4BBSK 2R7ZK 3I4MK 4XLNA 1SMYA 2JA7C 2PA8L 2PPBA 4A3MC 1TWGC 3RZOK 3EQLA 5FLMC 2B63K 4BXXK 5M3FK 4A3JC 2A68A 5IP7K 3PO2C 1WCMC 2Y0SD 3WODA 2A6EA 4MEYA 5D4DA 3RZDC 4BY7C 1R9TC 5C4XK 4A3DK 1I6HK 2JA8K 4OIRA 4YFNA 2NVXK 2JA6K 2NVTK 4XLPA 1TWCK 4ZH4A 2Y0SL 3HOXK 4A3FK 1K83C 3FKIC 4OIQA 3H0GC 5IP9K 4BBRC 5C44C 3DXJA 3S2DC 4A3LC 1XPPA 4C3HK 3HOXC 3S1QC 4G7OA 3HOUC 2JA5C 2WAQD 3GTJC 1HQMA 5IYBC 3HKZL 1SFOK 2PMZD 3S1NK 4X6AC 2R7ZC 4A3KK 5M3MK 2WB1D 3S15C 4LLGA 3GTMC 4A3IC 2WAQL 4NOIA 4Q5SA 3CQZK 3GTPC 5M5XK 3H3VL 4LK0A 1Y1VC 4Y52C 4A3EC 1TWAK 2JA7K 3S1RC 4A3FC 3GTMK 1TWCC 3FKIK 4OINA 2PA8D 4Y7NK 4KN7A 3S17C 3PO3K 4XSZA 3HOWK 2CW0A 1I6HC 3HOZK 3HOUK 3K7AK 4Y7NC 3GTJK 3S17K 5C3EK 2R93K 3HKZD 3HOYK 1K83K 2VUMC 2B63C 4BXXC 3RZOC 5C3EC 4A3GK 2WB1L 5TMFA 5M5YK 3GTKC 3S1MK 4YG2A 1TWFK 2NVYC 3RZDK 2O5IA 1I6VA 2JA8C 3M4OC 5C4XC 4A3KC 1I3QC 2JA5K 2NVYK 2R92C 5IYCC 2NVQK 2E2HK 3S16K 3GTLK 1TWGK 5IP9C 5FLMK 1YNJA 4A3LK 2YU9K 3S2DK 4BBRK 1I50K 5C44K 4MEXA 4AYBL 2NVQC 2A69A 2VUMK 3S16C 4BBSC 3HOVC 3I4NC 4A93K 1I50C 4LJZA 3S1NC 1R9TK 3H3VD 3GTKK 4A3DC 3S14K 2E2JK 4A3CK 3PO3C 4BY1K 3GTOK 1WCMK 4MQ9A 3GTQC 1I3QK 3H0GK 1TWAC 4QJVB 2E2IK 1Y1VK 1Y1WC 3GTGK 4Y52K 5FJ8K 2R93C 3I4MC 2A6HA 4OIPA 1Y1WK 3GTGC 4A3GC 4G7ZA 1TWHC 3HOVK 3I4NK 4QJVA 4C3JK 3S2HC 4A3BC 4GZYA 4YFKA 5IP7C 4QIWD 3GTLC 4A3JK 4A3IK 4LK1A 4XSXA 3GTPK 4G7HA 4YFXA 5IYDK 4A3MK 5C4JC 4X6AK 4OIOA 1TWFC 5IYDC 2NVXC 2YU9C 2NVTC 2JA6C 5C4JK 3M4OK 1BDFA 5M5WK 3CQZC 4AYBD 5IYCK 4BY7K 2R92K 3S1QK 4BY1C 2O5JA 3HOYC 1TWHK 2BE5A 3GTQK 4KN4A 3S2HK 1IW7A 3S14C 4A3BK 3M3YC 1ZYRA 4JK1A 4C2MK 5IYBK 1SFOC 1YNNA 4QIWL 4KMUA 3S1MC 3K7AC 4C3IK 3M3YK 2E2IC 4A93C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 K;  5TMC A;  2PMZ L;  4A3E K;  2E2J C;  3S1R K;  4A3C C;  3GTO C;  2E2H C;  3S15 K;  4Q4Z A;  3HOW C;  3HOZ C;  4BBS K;  2R7Z K;  3I4M K;  4XLN A;  1SMY A;  2JA7 C;  2PA8 L;  2PPB A;  4A3M C;  1TWG C;  3RZO K;  3EQL A;  5FLM C;  2B63 K;  4BXX K;  5M3F K;  4A3J C;  2A68 A;  5IP7 K;  3PO2 C;  1WCM C;  2Y0S D;  3WOD A;  2A6E A;  4MEY A;  5D4D A;  3RZD C;  4BY7 C;  1R9T C;  5C4X K;  4A3D K;  1I6H K;  2JA8 K;  4OIR A;  4YFN A;  2NVX K;  2JA6 K;  2NVT K;  4XLP A;  1TWC K;  4ZH4 A;  2Y0S L;  3HOX K;  4A3F K;  1K83 C;  3FKI C;  4OIQ A;  3H0G C;  5IP9 K;  4BBR C;  5C44 C;  3DXJ A;  3S2D C;  4A3L C;  1XPP A;  4C3H K;  3HOX C;  3S1Q C;  4G7O A;  3HOU C;  2JA5 C;  2WAQ D;  3GTJ C;  1HQM A;  5IYB C;  3HKZ L;  1SFO K;  2PMZ D;  3S1N K;  4X6A C;  2R7Z C;  4A3K K;  5M3M K;  2WB1 D;  3S15 C;  4LLG A;  3GTM C;  4A3I C;  2WAQ L;  4NOI A;  4Q5S A;  3CQZ K;  3GTP C;  5M5X K;  3H3V L;  4LK0 A;  1Y1V C;  4Y52 C;  4A3E C;  1TWA K;  2JA7 K;  3S1R C;  4A3F C;  3GTM K;  1TWC C;  3FKI K;  4OIN A;  2PA8 D;  4Y7N K;  4KN7 A;  3S17 C;  3PO3 K;  4XSZ A;  3HOW K;  2CW0 A;  1I6H C;  3HOZ K;  3HOU K;  3K7A K;  4Y7N C;  3GTJ K;  3S17 K;  5C3E K;  2R93 K;  3HKZ D;  3HOY K;  1K83 K;  2VUM C;  2B63 C;  4BXX C;  3RZO C;  5C3E C;  4A3G K;  2WB1 L;  5TMF A;  5M5Y K;  3GTK C;  3S1M K;  4YG2 A;  1TWF K;  2NVY C;  3RZD K;  2O5I A;  1I6V A;  2JA8 C;  3M4O C;  5C4X C;  4A3K C;  1I3Q C;  2JA5 K;  2NVY K;  2R92 C;  5IYC C;  2NVQ K;  2E2H K;  3S16 K;  3GTL K;  1TWG K;  5IP9 C;  5FLM K;  1YNJ A;  4A3L K;  2YU9 K;  3S2D K;  4BBR K;  1I50 K;  5C44 K;  4MEX A;  4AYB L;  2NVQ C;  2A69 A;  2VUM K;  3S16 C;  4BBS C;  3HOV C;  3I4N C;  4A93 K;  1I50 C;  4LJZ A;  3S1N C;  1R9T K;  3H3V D;  3GTK K;  4A3D C;  3S14 K;  2E2J K;  4A3C K;  3PO3 C;  4BY1 K;  3GTO K;  1WCM K;  4MQ9 A;  3GTQ C;  1I3Q K;  3H0G K;  1TWA C;  4QJV B;  2E2I K;  1Y1V K;  1Y1W C;  3GTG K;  4Y52 K;  5FJ8 K;  2R93 C;  3I4M C;  2A6H A;  4OIP A;  1Y1W K;  3GTG C;  4A3G C;  4G7Z A;  1TWH C;  3HOV K;  3I4N K;  4QJV A;  4C3J K;  3S2H C;  4A3B C;  4GZY A;  4YFK A;  5IP7 C;  4QIW D;  3GTL C;  4A3J K;  4A3I K;  4LK1 A;  4XSX A;  3GTP K;  4G7H A;  4YFX A;  5IYD K;  4A3M K;  5C4J C;  4X6A K;  4OIO A;  1TWF C;  5IYD C;  2NVX C;  2YU9 C;  2NVT C;  2JA6 C;  5C4J K;  3M4O K;  1BDF A;  5M5W K;  3CQZ C;  4AYB D;  5IYC K;  4BY7 K;  2R92 K;  3S1Q K;  4BY1 C;  2O5J A;  3HOY C;  1TWH K;  2BE5 A;  3GTQ K;  4KN4 A;  3S2H K;  1IW7 A;  3S14 C;  4A3B K;  3M3Y C;  1ZYR A;  4JK1 A;  4C2M K;  5IYB K;  1SFO C;  1YNN A;  4QIW L;  4KMU A;  3S1M C;  3K7A C;  4C3I K;  3M3Y K;  2E2I C;  4A93 C; 
#chains in the Genus database with same CATH topology
 3T00 A;  2B63 A;  4GT9 A;  4A3C C;  3ADA C;  4XCH A;  3S15 K;  1J98 A;  4Q4Z A;  3HOW C;  3JST A;  2R7Z K;  2JA7 C;  2PPB A;  4A3M C;  4C3H C;  1TWG C;  3A8J A;  2GSO A;  2A68 A;  3PO2 C;  4MEY A;  1G51 A;  3OEP A;  1I6H K;  1WQH A;  2KWA A;  2NVT K;  4XLP A;  1TWC K;  3H0G C;  5C44 C;  3DXJ A;  3S2D C;  5IOQ A;  1ZQ1 C;  3HOU C;  2R92 A;  1WSR A;  4C2M C;  3CAG A;  3GTM A;  1EK8 A;  5M3M K;  3S15 C;  1JOE A;  4LLG A;  3CQZ A;  2Y3P A;  3GTP C;  1WOO A;  4GTF A;  4Y52 C;  4A3E C;  1WOP A;  2JA7 K;  4KMA A;  1B4B A;  4OIN A;  3S17 C;  1EFW A;  4KN7 A;  4FM9 A;  2NVX A;  3K7A K;  3S17 K;  1XXC A;  3HKZ D;  3GSI A;  3GTG A;  5EGH A;  4GTE A;  1O25 A;  4YG2 A;  4C3I C;  2NVY C;  3RZD K;  2RH6 A;  2O5I A;  3M4O C;  5C4X C;  1I3Q C;  3AD8 C;  3QX3 A;  2NVY K;  2NVQ K;  5FLM K;  4AH6 A;  3S2D K;  4GFQ A;  2V6S A;  2NVQ C;  4M1X A;  4AYB L;  4GTC A;  2V6T A;  1ZVU A;  1R9T K;  4A3D C;  1O2B A;  1PJ7 A;  4A3C K;  4BY1 K;  3GTO K;  1XXB A;  2ZUE A;  1VGX A;  1RU0 A;  2A6H A;  4QJV A;  4A3B C;  4GZY A;  4O2D A;  3GTL C;  4A3I K;  1EH1 A;  1XZQ A;  4YFX A;  3TTG A;  3A8K A;  4X6A K;  1DD5 A;  1USM A;  2JA6 C;  1BDF A;  5CHP A;  4AYB D;  1JQW A;  4BY7 K;  2R92 K;  3HOY C;  1Y1V A;  1USO A;  1INN A;  1WCM A;  3M3Y C;  1ZYR A;  4JK1 A;  5TJ3 A;  5IYB K;  4KB2 A;  4C2M K;  1YNN A;  3S1M C;  1WQF A;  3M3Y K;  4A93 C;  1IQ0 A;  4A3E K;  4KMD A;  2E2J C;  3GTO C;  2E2H C;  1O27 A;  1AB4 A;  4J3N A;  4BBS K;  2R7Z A;  2GSU A;  4PAB A;  1YCL A;  1WIH A;  4BXX K;  1JVI A;  5IP7 K;  3GEH A;  1WCM C;  3WOD A;  1DCH A;  5D4D A;  1WQG A;  3RZD C;  4BY7 C;  5C4X K;  4BLA A;  2R93 A;  2JA8 K;  4OIR A;  2JA6 K;  1O26 A;  4LOW A;  2Y0S L;  4A3F K;  1K83 C;  3T01 A;  3S1Q C;  1O29 A;  1WOR A;  5IYB C;  2JA7 A;  4A3K K;  3GTP A;  3LAP A;  2EBB A;  1B4A A;  2WAQ L;  3CQZ K;  1TWA K;  3G4C A;  1TWC C;  1XZQ B;  3FKI K;  2XCQ A;  3HOZ K;  4KC6 A;  3GTJ K;  3N0B A;  1IBA A;  4BXX C;  2P5M A;  3Q3Q A;  2WB1 L;  1R9T A;  5IOT A;  2JA8 C;  3GTK A;  2JH3 A;  1BS2 A;  1TWG A;  2R92 C;  5IYC C;  2XCR B;  4KM9 A;  2NVY A;  2YU9 K;  4MEX A;  4P5A A;  5E68 A;  4G0V A;  2VUM K;  4A93 K;  3GTK K;  3BP8 C;  5IOS A;  2E2J K;  3AQO A;  5EGE A;  1ZXO A;  1VH2 A;  4MQ9 A;  1I3Q K;  1TWA C;  1EI6 A;  5JFE A;  4G0W A;  3MML B;  3AD9 C;  1KQ4 A;  3GTJ A;  3NUH A;  4OIP A;  3HOV K;  3I4N K;  4YFK A;  3FKI A;  5IP7 C;  4A3J K;  1O2F B;  1IE0 A;  2GAG C;  2YU9 C;  4KAS A;  5IYC K;  4GTA A;  3S1Q K;  4KB4 A;  1TWC A;  3VA7 A;  1TWH K;  3GTQ K;  3S2H K;  1XXA A;  4QIW L;  4KMU A;  3K7A C;  2P8T A;  5TMC A;  2PMZ L;  2VUM A;  4G0U A;  3HOZ C;  1GE9 A;  3TFH A;  4XLN A;  4KAW X;  3A8I A;  5FLM C;  2B63 K;  5M3F K;  4A3J C;  3SZZ A;  2Y0S D;  5L46 A;  2GAH C;  1R9T C;  4A3D K;  4WJ3 M;  2PHC B;  4YFN A;  2RGR A;  3HOX K;  4OIQ A;  3GDZ A;  5IP9 K;  4BLB A;  4A3L C;  4C3H K;  3HOX C;  4G7O A;  2ZUF A;  2WAQ D;  3HKZ L;  2PMZ D;  3ORE A;  5JVO A;  4KAR A;  3L4J A;  3LPX A;  2R7Z C;  4KAT A;  4A3I C;  4NOI A;  4Q5S A;  5M5X K;  3TFI A;  4LK0 A;  3T02 A;  1F9N A;  1VRQ C;  3S1R C;  4FZB A;  1O2A A;  4Y7N K;  1DCP A;  2CW0 A;  1I6H C;  1PJ6 A;  3HOU K;  2JA6 A;  4Y7N C;  3FHZ A;  5C3E K;  2R93 K;  1J6X A;  3HOY K;  1O24 A;  2B63 C;  3RZO C;  5C3E C;  3AQP A;  4A3G K;  5TMF A;  5M5Y K;  4RMF A;  1F93 A;  3S1M K;  4P9S A;  1TWF K;  1DCO A;  1EQR A;  3N3Y A;  4KMH A;  3S16 K;  2E2H K;  3GTL K;  1TWG K;  1I50 A;  5IP9 C;  2JA5 A;  4A3L K;  4BBR K;  1I50 K;  3S16 C;  3GTL A;  2A69 A;  4BBS C;  1I50 C;  4LJZ A;  3OPF A;  4ILD A;  1K83 A;  1O28 A;  1WCM K;  1V5V A;  3H0G K;  4QJV B;  2E2I K;  1Y1V K;  1Y1W C;  3GTG K;  5FJ8 K;  1IS1 A;  2R93 C;  3BUE A;  1XZP B;  1Y1W K;  3GTG C;  4A3G C;  1TWA A;  1UV7 A;  4C3J K;  4LK1 A;  3IPJ A;  4XSX A;  3GTP K;  3GEI A;  5IYD K;  5C4J C;  3AH5 A;  4LR2 A;  1TWF C;  1ZBS A;  5IYD C;  1J6V A;  2NVX C;  5C4J K;  3S0X A;  5M5W K;  3CQZ C;  1WOS A;  2O5J A;  3ERE D;  4BY1 C;  2GSN A;  2E2I A;  1Y1W A;  4A3B K;  1L0W A;  3GEE A;  1C0A A;  4GTL A;  4C3I K;  2E2I C;  3PO2 K;  3GTO A;  1J6W A;  4C45 A;  2CFA A;  3S1R K;  1VJE A;  3N0C A;  3L4K A;  4LQY A;  3LAJ A;  2E2H A;  1XZP A;  4GTD A;  3I4M K;  1SMY A;  2PA8 L;  2XCO A;  1ISE A;  4KM8 A;  3RZO K;  3EQL A;  4WJ4 A;  1X31 C;  3G4A A;  1TWF A;  2A6E A;  2CFA B;  2NVX K;  3BP3 A;  4ZH4 A;  1WSV A;  3FKI C;  1BGW A;  4BBR C;  1YX2 A;  1XPP A;  5CJ9 A;  3TFJ A;  2JA5 C;  3GTJ C;  1HQM A;  3FOF A;  1SFO K;  1F7V A;  4BKW A;  3S1N K;  4X6A C;  2WB1 D;  3HXA A;  2V6U A;  3GTM C;  3H3V L;  1Y1V C;  4A3F C;  3GTM K;  2PA8 D;  3PO3 K;  4XSZ A;  3HOW K;  3H0G A;  1BJT A;  1F7U A;  1K83 K;  2VUM C;  1I3Q A;  3AD7 C;  3GTK C;  1VLO A;  4KDD A;  2FQO A;  1I6V A;  4A3K C;  2JA5 K;  2YU9 A;  1YNJ A;  5C44 K;  3HOV C;  3I4N C;  1IL2 A;  3S1N C;  3H3V D;  3V4G A;  1HI9 A;  3S14 K;  3PO3 C;  3GIR A;  3GTQ C;  5IOR A;  2FQT A;  1TWH A;  4Y52 K;  3I4M C;  3GTQ A;  4G7Z A;  1TWH C;  4DDQ A;  3S2H C;  4QIW D;  4WIL A;  4G7H A;  4A3M K;  4OIO A;  4P5B A;  2NVT C;  3M4O K;  2D6F C;  1SFO A;  2ZFZ A;  5HL8 A;  3SZY A;  4GTB A;  2BE5 A;  4KN4 A;  1IW7 A;  3S14 C;  4C3J C;  1SFO C;  4PAA A;  2W7V A;  1PJ5 A;  3FOE A; 
#chains in the Genus database with same CATH homology
 3PO2 K;  5TMC A;  2PMZ L;  4A3E K;  2E2J C;  3S1R K;  4A3C C;  3GTO C;  2E2H C;  3S15 K;  4Q4Z A;  3HOW C;  3HOZ C;  4BBS K;  2R7Z K;  3I4M K;  4XLN A;  1SMY A;  2JA7 C;  2PA8 L;  2PPB A;  4A3M C;  1TWG C;  3RZO K;  3EQL A;  5FLM C;  2B63 K;  4BXX K;  5M3F K;  4A3J C;  2A68 A;  5IP7 K;  3PO2 C;  1WCM C;  2Y0S D;  3WOD A;  2A6E A;  4MEY A;  5D4D A;  3RZD C;  4BY7 C;  1R9T C;  5C4X K;  4A3D K;  1I6H K;  2JA8 K;  4OIR A;  4YFN A;  2NVX K;  2JA6 K;  2NVT K;  4XLP A;  1TWC K;  4ZH4 A;  2Y0S L;  3HOX K;  4A3F K;  1K83 C;  3FKI C;  4OIQ A;  3H0G C;  5IP9 K;  4BBR C;  5C44 C;  3DXJ A;  3S2D C;  4A3L C;  1XPP A;  4C3H K;  3HOX C;  3S1Q C;  4G7O A;  3HOU C;  2JA5 C;  2WAQ D;  3GTJ C;  1HQM A;  5IYB C;  3HKZ L;  1SFO K;  2PMZ D;  3S1N K;  4X6A C;  2R7Z C;  4A3K K;  5M3M K;  2WB1 D;  3S15 C;  4LLG A;  3GTM C;  4A3I C;  2WAQ L;  4NOI A;  4Q5S A;  3CQZ K;  3GTP C;  5M5X K;  3H3V L;  4LK0 A;  1Y1V C;  4Y52 C;  4A3E C;  1TWA K;  2JA7 K;  3S1R C;  4A3F C;  3GTM K;  1TWC C;  3FKI K;  4OIN A;  2PA8 D;  4Y7N K;  4KN7 A;  3S17 C;  3PO3 K;  4XSZ A;  3HOW K;  2CW0 A;  1I6H C;  3HOZ K;  3HOU K;  3K7A K;  4Y7N C;  3GTJ K;  3S17 K;  5C3E K;  2R93 K;  3HKZ D;  3HOY K;  1K83 K;  2VUM C;  2B63 C;  4BXX C;  3RZO C;  5C3E C;  4A3G K;  2WB1 L;  5TMF A;  5M5Y K;  3GTK C;  3S1M K;  4YG2 A;  1TWF K;  2NVY C;  3RZD K;  2O5I A;  1I6V A;  2JA8 C;  3M4O C;  5C4X C;  4A3K C;  1I3Q C;  2JA5 K;  2NVY K;  2R92 C;  5IYC C;  2NVQ K;  2E2H K;  3S16 K;  3GTL K;  1TWG K;  5IP9 C;  5FLM K;  1YNJ A;  4A3L K;  2YU9 K;  3S2D K;  4BBR K;  1I50 K;  5C44 K;  4MEX A;  4AYB L;  2NVQ C;  2A69 A;  2VUM K;  3S16 C;  4BBS C;  3HOV C;  3I4N C;  4A93 K;  1I50 C;  4LJZ A;  3S1N C;  1R9T K;  3H3V D;  3GTK K;  4A3D C;  3S14 K;  2E2J K;  4A3C K;  3PO3 C;  4BY1 K;  3GTO K;  1WCM K;  4MQ9 A;  3GTQ C;  1I3Q K;  3H0G K;  1TWA C;  4QJV B;  2E2I K;  1Y1V K;  1Y1W C;  3GTG K;  4Y52 K;  5FJ8 K;  2R93 C;  3I4M C;  2A6H A;  4OIP A;  1Y1W K;  3GTG C;  4A3G C;  4G7Z A;  1TWH C;  3HOV K;  3I4N K;  4QJV A;  4C3J K;  3S2H C;  4A3B C;  4GZY A;  4YFK A;  5IP7 C;  4QIW D;  3GTL C;  4A3J K;  4A3I K;  4LK1 A;  4XSX A;  3GTP K;  4G7H A;  4YFX A;  5IYD K;  4A3M K;  5C4J C;  4X6A K;  4OIO A;  1TWF C;  5IYD C;  2NVX C;  2YU9 C;  2NVT C;  2JA6 C;  5C4J K;  3M4O K;  1BDF A;  5M5W K;  3CQZ C;  4AYB D;  5IYC K;  4BY7 K;  2R92 K;  3S1Q K;  4BY1 C;  2O5J A;  3HOY C;  1TWH K;  2BE5 A;  3GTQ K;  4KN4 A;  3S2H K;  1IW7 A;  3S14 C;  4A3B K;  3M3Y C;  1ZYR A;  4JK1 A;  4C2M K;  5IYB K;  1SFO C;  1YNN A;  4QIW L;  4KMU A;  3S1M C;  3K7A C;  4C3I K;  3M3Y K;  2E2I C;  4A93 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...