1I3QK

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i3qK00
2A68A 3S1NC 1Y1VC 4A3CC 4QIWD 5IYCK 1IW7A 3GTKC 4A3GK 3S17C 4OIRA 2E2IC 3M3YC 5C44K 1TWAK 1WCMK 2JA8K 4BBRK 5C3EK 3S14K 4LK0A 1I6HK 4X6AK 4A3DK 4YFKA 3GTMC 4NOIA 3I4MK 4A3BC 4C3HK 3GTJK 2JA5K 3I4NC 2A6HA 5C4XC 2E2HK 3S1RC 5M5WK 3K7AK 3GTGC 4MEXA 3HOYK 4BY7C 4KN7A 4A3EC 1BDFA 2Y0SD 4QJVB 4C3IK 3S15C 4BXXC 5FLMC 4A3IK 1SFOK 4Y52C 2PA8L 4KMUA 3S1MK 2R92K 2R93K 1XPPA 2VUMK 2O5JA 1Y1WC 4MQ9A 2JA6C 1YNJA 3HOWC 4A3FC 4LLGA 2NVTK 4XLNA 5IYDK 3RZDC 3GTQC 5IP9K 3S16C 4Q5SA 2NVYC 3HKZL 4ZH4A 4JK1A 5TMCA 4A3MC 4Q4ZA 2JA7K 4A3LK 3HOVC 2PPBA 1TWHK 4G7HA 3PO3K 1I3QK 5IYBC 4AYBL 2BE5A 3RZOK 4BBSK 2PMZL 4Y7NK 1TWAC 5C44C 4BBRC 2NVQK 3WODA 3S2HK 5C3EC 3HOXK 1I6HC 1TWCC 3GTJC 4C2MK 5C4JK 1TWGK 2JA5C 2NVXK 3S2DK 3H3VD 2E2HC 1SMYA 4A3JC 1R9TC 3S1NK 4BY1C 3M4OK 4A3CK 4KN4A 4YG2A 2E2JK 3GTOK 2WAQL 3HOZK 5M3MK 4OIQA 3S1MC 3GTLK 4MEYA 5IP7K 2VUMC 2WB1L 4XSZA 4OIPA 1I50C 3H0GC 4A3BK 3PO2C 4A93C 5C4XK 1YNNA 5IYDC 2B63C 4XLPA 1TWFK 3S1RK 2A6EA 5IP9C 2YU9K 3GTGK 4BY7K 3FKIC 4QIWL 5M3FK 4G7ZA 4A3GC 3CQZK 5IYCC 2A69A 2JA7C 3S15K 4C3JK 3S1QK 1I6VA 1K83K 4A3KK 2R7ZK 3PO3C 2JA8C 1I3QC 1WCMC 2PA8D 3GTPK 2CW0A 4LJZA 1Y1WK 3RZOC 3S14C 2JA6K 3HOUK 4X6AC 3HOWK 4A3DC 4Y7NC 3I4MC 3S2HC 3EQLA 3RZDK 3S16K 2NVYK 1Y1VK 3K7AC 3GTKK 3HOYC 4GZYA 1ZYRA 2Y0SL 3HKZD 5C4JC 4A3MK 3HOVK 2E2IK 3M3YK 3S17K 1HQMA 5IYBK 4A3IC 1SFOC 4OINA 4XSXA 3M4OC 4AYBD 2E2JC 2R92C 3GTOC 2R93C 4YFNA 2O5IA 3GTMK 3HOZC 2PMZD 4G7OA 5D4DA 3GTLC 3I4NK 5TMFA 5IP7C 5FJ8K 2NVTC 5M5XK 1TWCK 4A3EK 4A3LC 5M5YK 1TWFC 5FLMK 4A3JK 1R9TK 2YU9C 1TWHC 4YFXA 4BY1K 4BXXK 4Y52K 3CQZC 3DXJA 4BBSC 2WAQD 3S1QC 1K83C 4A3KC 4QJVA 4A3FK 2R7ZC 2NVQC 3GTPC 4LK1A 2WB1D 1I50K 4OIOA 3H0GK 3HOXC 3GTQK 3PO2K 3HOUC 4A93K 2NVXC 2B63K 1TWGC 3H3VL 3S2DC 3FKIK
chains in the Genus database with same CATH superfamily
4A3GK 1TWHA 1USOA 3L4KA 4OIRA 2GAHC 4GTDA 5C44K 4BBRK 2V6TA 4WJ3M 5C3EK 4AH6A 1O2FB 3G4AA 4A3DK 3I4MK 1IBAA 3I4NC 5C4XC 1JOEA 2PHCB 2NVXA 1XXBA 3K7AK 3HOYK 1BDFA 2Y0SD 3S15C 2JH3A 4BXXC 3GTOA 2PA8L 2VUMK 2O5JA 2FQOA 3GTLA 1XZQA 1YNJA 2W7VA 4FZBA 4XLNA 4Q5SA 4BLAA 1TWFA 4ZH4A 4PAAA 4A3MC 3PO3K 5EGHA 1J6XA 1I3QK 2BE5A 4P5BA 2R7ZA 1WSRA 4Y7NK 1PJ7A 5JFEA 4BKWA 3AH5A 2NVYA 3GDZA 2E2HC 1SMYA 4A3JC 3S1NK 2E2IA 4KN4A 4PABA 4C3IC 2WAQL 3VA7A 3HOZK 3N0BA 2WB1L 1I50C 1EQRA 4A3BK 1XXAA 3T01A 1KQ4A 1YNNA 3GIRA 3GTGK 1WOSA 4KB2A 4QIWL 4A3GC 2JA7C 4KAWX 3AD8C 1I6VA 1VGXA 4LOWA 2PA8D 2CW0A 4A3DC 1IS1A 3I4MC 5IOTA 3H0GA 3QX3A 1WQGA 1B4AA 2ZUFA 3L4JA 1JQWA 1O28A 3K7AC 2KWAA 3HOYC 3FKIA 1ZVUA 4OINA 1YCLA 1BJTA 4G7OA 4J3NA 3S2DC 3I4NK 4WJ4A 5IP7C 3OREA 4O2DA 2JA5A 1TWCK 5EGEA 1WQFA 1HI9A 2YU9C 4BXXK 4KATA 3CQZC 3NUHA 1SFOA 4G0WA 2WAQD 1G51A 2R93A 1K83C 4A3KC 1X31C 2WB1D 1USMA 4A93K 4LQYA 4ILDA 4BLBA 1BS2A 3S1NC 4QIWD 3G4CA 1IW7A 3ADAC 3M3YC 2JA8K 1WCMK 1O2BA 2GSUA 4C45A 3GTMC 4A3BC 4C3HK 2E2HK 3GTGC 5M5WK 4A3EC 4C3IK 4Y52C 1IQ0A 1EH1A 1XPPA 4A3FC 1VLOA 4GFQA 2NVTK 3GTQC 3N3YA 3HXAA 3HKZL 5TMCA 2JA7K 3Q3QA 2PPBA 4AYBL 3GTPA 1TWAC 4GT9A 3T00A 1I6HC 1TWCC 3GTJC 1TWGK 3OPFA 1Y1VA 3GTKA 4DDQA 2RH6A 4YG2A 1XZQB 3S0XA 4P5AA 4OIQA 3S1MC 5IP7K 2GSNA 4XSZA 4KM9A 4A93C 1YX2A 1VH2A 3AQOA 5IOSA 2YU9K 1B4BA 1XZPA 5IP9C 4BY7K 3CQZK 3BP8C 4C3JK 1K83K 4A3KK 2JA8C 1WCMC 1Y1WK 2JA6K 3HOWK 1I50A 1O26A 4C3HC 3RZDK 1WOOA 4GZYA 1ZYRA 3HKZD 4C2MC 1EI6A 3M3YK 4XSXA 3A8IA 3M4OC 4AYBD 3GTOC 1GE9A 3GTMK 2CFAB 5D4DA 3GTLC 5FJ8K 4RMFA 2NVTC 3OEPA 2CFAA 1VJEA 3GEEA 4A3EK 1TWFC 1R9TK 4BY1K 4YFXA 4Y52K 2VUMA 2R7ZC 3GEIA 4QJVA 4A3FK 3GTQK 3PO2K 1JVIA 2EBBA 4M1XA 3A8KA 5HL8A 4KC6A 2RGRA 1TWGC 2B63K 2A68A 4KMDA 5IYCK 4KASA 3S17C 1I3QA 2E2IC 1J6WA 1BGWA 3CQZA 1WOPA 1IL2A 1TWAK 5IOQA 3SZYA 3AD7C 3S14K 4LK0A 1I6HK 1INNA 4X6AK 4YFKA 3GTJK 2GAGC 1AB4A 4G0UA 4MEXA 4BY7C 5L46A 4KN7A 4GTEA 5FLMC 1VRQC 4C3JC 4A3IK 1ZBSA 4KMUA 5CHPA 3S1MK 2R92K 1F7VA 3IPJA 3LPXA 1Y1WC 5TJ3A 3SZZA 2JA6C 3HOWC 2FQTA 4P9SA 3RZDC 5IP9K 3GTGA 4JK1A 4A3LK 4Q4ZA 4KM8A 1TWHK 1O29A 1C0AA 4GTFA 3HOXK 2NVXK 4C2MK 2JA5C 1RU0A 3GEHA 1R9TC 4A3CK 4BY1C 3M4OK 3GTOK 1UV7A 3GTLK 4MEYA 1WQHA 3PO2C 1O27A 1TWCA 5IYDC 2B63C 4XLPA 1TWFK 3S1RK 3GTJA 3FOFA 4G7ZA 5IYCC 3FOEA 1V5VA 3FHZA 3TFHA 1L0WA 2R7ZK 2P5MA 3BP3A 4LJZA 3S14C 4FM9A 3RZOC 4X6AC 3S2HC 3EQLA 3S16K 2NVYK 1XXCA 1O2AA 5C4JC 3S17K 2Y3PA 3HOVK 2E2IK 1DCHA 1HQMA 5IYBK 4A3IC 2XCQA 2E2JC 2R92C 2V6UA 1WCMA 4YFNA 2O5IA 1J98A 1XZPB 3T02A 4KDDA 4G0VA 4WILA 2E2HA 4A3LC 4XCHA 5M5YK 5FLMK 1TWHC 4GTAA 3S1QC 3GTPC 4GTCA 3H0GK 3HOXC 3HOUC 2NVXC 3H3VL 1O25A 2JA7A 3FKIK 4A3CC 1Y1VC 3GTKC 2P8TA 5JVOA 1F93A 3LAPA 4NOIA 2JA5K 2A6HA 3S1RC 1IE0A 1TWGA 4KMHA 4QJVB 1SFOK 2R93K 4MQ9A 2XCRB 4KB4A 4LLGA 5IYDK 3S16C 2NVYC 2YU9A 3TFJA 3HOVC 4G7HA 5IORA 2V6SA 5IYBC 3MMLB 1K83A 3RZOK 4BBSK 1WORA 3TTGA 1ZQ1C 2PMZL 5C44C 1Y1WA 4KARA 4BBRC 3WODA 2NVQK 5C3EC 3JSTA 3S2HK 2JA6A 1F9NA 2XCOA 5C4JK 3S2DK 4GTLA 3V4GA 3H3VD 1ISEA 3TFIA 2E2JK 4GTBA 4KMAA 5M3MK 3GTMA 2VUMC 1DCOA 4OIPA 3H0GC 1DCPA 1O24A 5C4XK 1WSVA 2GSOA 2A6EA 2ZUEA 3FKIC 5M3FK 1R9TA 2A69A 3S15K 3S1QK 1J6VA 3PO3C 1I3QC 3GTPK 3LAJA 2D6FC 3HOUK 3AD9C 4Y7NC 3GTQA 5CJ9A 4LR2A 2B63A 1Y1VK 3GTKK 4A3MK 2Y0SL 1PJ6A 5E68A 1F7UA 3ERED 1SFOC 3AQPA 2R93C 1TWAA 1EK8A 3HOZC 2PMZD 3GSIA 2ZFZA 3CAGA 5TMFA 5M5XK 1WIHA 1EFWA 4A3JK 1PJ5A 3DXJA 4BBSC 3N0CA 2R92A 3A8JA 2NVQC 4LK1A 4OIOA 1I50K 1DD5A 1ZXOA 3BUEA
chains in the Genus database with same CATH topology
2A68A 3S1NC 1Y1VC 4A3CC 4QIWD 5IYCK 1IW7A 3GTKC 4A3GK 3S17C 4OIRA 2E2IC 3M3YC 5C44K 1TWAK 1WCMK 2JA8K 4BBRK 5C3EK 3S14K 4LK0A 1I6HK 4X6AK 4A3DK 4YFKA 3GTMC 4NOIA 3I4MK 4A3BC 4C3HK 3GTJK 2JA5K 3I4NC 2A6HA 5C4XC 2E2HK 3S1RC 5M5WK 3K7AK 3GTGC 4MEXA 3HOYK 4BY7C 4KN7A 4A3EC 1BDFA 2Y0SD 4QJVB 4C3IK 3S15C 4BXXC 5FLMC 4A3IK 1SFOK 4Y52C 2PA8L 4KMUA 3S1MK 2R92K 2R93K 1XPPA 2VUMK 2O5JA 1Y1WC 4MQ9A 2JA6C 1YNJA 3HOWC 4A3FC 4LLGA 2NVTK 4XLNA 5IYDK 3RZDC 3GTQC 5IP9K 3S16C 4Q5SA 2NVYC 3HKZL 4ZH4A 4JK1A 5TMCA 4A3MC 4Q4ZA 2JA7K 4A3LK 3HOVC 2PPBA 1TWHK 4G7HA 3PO3K 1I3QK 5IYBC 4AYBL 2BE5A 3RZOK 4BBSK 2PMZL 4Y7NK 1TWAC 5C44C 4BBRC 2NVQK 3WODA 3S2HK 5C3EC 3HOXK 1I6HC 1TWCC 3GTJC 4C2MK 5C4JK 1TWGK 2JA5C 2NVXK 3S2DK 3H3VD 2E2HC 1SMYA 4A3JC 1R9TC 3S1NK 4BY1C 3M4OK 4A3CK 4KN4A 4YG2A 2E2JK 3GTOK 2WAQL 3HOZK 5M3MK 4OIQA 3S1MC 3GTLK 4MEYA 5IP7K 2VUMC 2WB1L 4XSZA 4OIPA 1I50C 3H0GC 4A3BK 3PO2C 4A93C 5C4XK 1YNNA 5IYDC 2B63C 4XLPA 1TWFK 3S1RK 2A6EA 5IP9C 2YU9K 3GTGK 4BY7K 3FKIC 4QIWL 5M3FK 4G7ZA 4A3GC 3CQZK 5IYCC 2A69A 2JA7C 3S15K 4C3JK 3S1QK 1I6VA 1K83K 4A3KK 2R7ZK 3PO3C 2JA8C 1I3QC 1WCMC 2PA8D 3GTPK 2CW0A 4LJZA 1Y1WK 3RZOC 3S14C 2JA6K 3HOUK 4X6AC 3HOWK 4A3DC 4Y7NC 3I4MC 3S2HC 3EQLA 3RZDK 3S16K 2NVYK 1Y1VK 3K7AC 3GTKK 3HOYC 4GZYA 1ZYRA 2Y0SL 3HKZD 5C4JC 4A3MK 3HOVK 2E2IK 3M3YK 3S17K 1HQMA 5IYBK 4A3IC 1SFOC 4OINA 4XSXA 3M4OC 4AYBD 2E2JC 2R92C 3GTOC 2R93C 4YFNA 2O5IA 3GTMK 3HOZC 2PMZD 4G7OA 5D4DA 3GTLC 3I4NK 5TMFA 5IP7C 5FJ8K 2NVTC 5M5XK 1TWCK 4A3EK 4A3LC 5M5YK 1TWFC 5FLMK 4A3JK 1R9TK 2YU9C 1TWHC 4YFXA 4BY1K 4BXXK 4Y52K 3CQZC 3DXJA 4BBSC 2WAQD 3S1QC 1K83C 4A3KC 4QJVA 4A3FK 2R7ZC 2NVQC 3GTPC 4LK1A 2WB1D 1I50K 4OIOA 3H0GK 3HOXC 3GTQK 3PO2K 3HOUC 4A93K 2NVXC 2B63K 1TWGC 3H3VL 3S2DC 3FKIK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 A;  3S1N C;  1Y1V C;  4A3C C;  4QIW D;  5IYC K;  1IW7 A;  3GTK C;  4A3G K;  3S17 C;  4OIR A;  2E2I C;  3M3Y C;  5C44 K;  1TWA K;  1WCM K;  2JA8 K;  4BBR K;  5C3E K;  3S14 K;  4LK0 A;  1I6H K;  4X6A K;  4A3D K;  4YFK A;  3GTM C;  4NOI A;  3I4M K;  4A3B C;  4C3H K;  3GTJ K;  2JA5 K;  3I4N C;  2A6H A;  5C4X C;  2E2H K;  3S1R C;  5M5W K;  3K7A K;  3GTG C;  4MEX A;  3HOY K;  4BY7 C;  4KN7 A;  4A3E C;  1BDF A;  2Y0S D;  4QJV B;  4C3I K;  3S15 C;  4BXX C;  5FLM C;  4A3I K;  1SFO K;  4Y52 C;  2PA8 L;  4KMU A;  3S1M K;  2R92 K;  2R93 K;  1XPP A;  2VUM K;  2O5J A;  1Y1W C;  4MQ9 A;  2JA6 C;  1YNJ A;  3HOW C;  4A3F C;  4LLG A;  2NVT K;  4XLN A;  5IYD K;  3RZD C;  3GTQ C;  5IP9 K;  3S16 C;  4Q5S A;  2NVY C;  3HKZ L;  4ZH4 A;  4JK1 A;  5TMC A;  4A3M C;  4Q4Z A;  2JA7 K;  4A3L K;  3HOV C;  2PPB A;  1TWH K;  4G7H A;  3PO3 K;  1I3Q K;  5IYB C;  4AYB L;  2BE5 A;  3RZO K;  4BBS K;  2PMZ L;  4Y7N K;  1TWA C;  5C44 C;  4BBR C;  2NVQ K;  3WOD A;  3S2H K;  5C3E C;  3HOX K;  1I6H C;  1TWC C;  3GTJ C;  4C2M K;  5C4J K;  1TWG K;  2JA5 C;  2NVX K;  3S2D K;  3H3V D;  2E2H C;  1SMY A;  4A3J C;  1R9T C;  3S1N K;  4BY1 C;  3M4O K;  4A3C K;  4KN4 A;  4YG2 A;  2E2J K;  3GTO K;  2WAQ L;  3HOZ K;  5M3M K;  4OIQ A;  3S1M C;  3GTL K;  4MEY A;  5IP7 K;  2VUM C;  2WB1 L;  4XSZ A;  4OIP A;  1I50 C;  3H0G C;  4A3B K;  3PO2 C;  4A93 C;  5C4X K;  1YNN A;  5IYD C;  2B63 C;  4XLP A;  1TWF K;  3S1R K;  2A6E A;  5IP9 C;  2YU9 K;  3GTG K;  4BY7 K;  3FKI C;  4QIW L;  5M3F K;  4G7Z A;  4A3G C;  3CQZ K;  5IYC C;  2A69 A;  2JA7 C;  3S15 K;  4C3J K;  3S1Q K;  1I6V A;  1K83 K;  4A3K K;  2R7Z K;  3PO3 C;  2JA8 C;  1I3Q C;  1WCM C;  2PA8 D;  3GTP K;  2CW0 A;  4LJZ A;  1Y1W K;  3RZO C;  3S14 C;  2JA6 K;  3HOU K;  4X6A C;  3HOW K;  4A3D C;  4Y7N C;  3I4M C;  3S2H C;  3EQL A;  3RZD K;  3S16 K;  2NVY K;  1Y1V K;  3K7A C;  3GTK K;  3HOY C;  4GZY A;  1ZYR A;  2Y0S L;  3HKZ D;  5C4J C;  4A3M K;  3HOV K;  2E2I K;  3M3Y K;  3S17 K;  1HQM A;  5IYB K;  4A3I C;  1SFO C;  4OIN A;  4XSX A;  3M4O C;  4AYB D;  2E2J C;  2R92 C;  3GTO C;  2R93 C;  4YFN A;  2O5I A;  3GTM K;  3HOZ C;  2PMZ D;  4G7O A;  5D4D A;  3GTL C;  3I4N K;  5TMF A;  5IP7 C;  5FJ8 K;  2NVT C;  5M5X K;  1TWC K;  4A3E K;  4A3L C;  5M5Y K;  1TWF C;  5FLM K;  4A3J K;  1R9T K;  2YU9 C;  1TWH C;  4YFX A;  4BY1 K;  4BXX K;  4Y52 K;  3CQZ C;  3DXJ A;  4BBS C;  2WAQ D;  3S1Q C;  1K83 C;  4A3K C;  4QJV A;  4A3F K;  2R7Z C;  2NVQ C;  3GTP C;  4LK1 A;  2WB1 D;  1I50 K;  4OIO A;  3H0G K;  3HOX C;  3GTQ K;  3PO2 K;  3HOU C;  4A93 K;  2NVX C;  2B63 K;  1TWG C;  3H3V L;  3S2D C;  3FKI K; 
#chains in the Genus database with same CATH topology
 4A3G K;  1TWH A;  1USO A;  3L4K A;  4OIR A;  2GAH C;  4GTD A;  5C44 K;  4BBR K;  2V6T A;  4WJ3 M;  5C3E K;  4AH6 A;  1O2F B;  3G4A A;  4A3D K;  3I4M K;  1IBA A;  3I4N C;  5C4X C;  1JOE A;  2PHC B;  2NVX A;  1XXB A;  3K7A K;  3HOY K;  1BDF A;  2Y0S D;  3S15 C;  2JH3 A;  4BXX C;  3GTO A;  2PA8 L;  2VUM K;  2O5J A;  2FQO A;  3GTL A;  1XZQ A;  1YNJ A;  2W7V A;  4FZB A;  4XLN A;  4Q5S A;  4BLA A;  1TWF A;  4ZH4 A;  4PAA A;  4A3M C;  3PO3 K;  5EGH A;  1J6X A;  1I3Q K;  2BE5 A;  4P5B A;  2R7Z A;  1WSR A;  4Y7N K;  1PJ7 A;  5JFE A;  4BKW A;  3AH5 A;  2NVY A;  3GDZ A;  2E2H C;  1SMY A;  4A3J C;  3S1N K;  2E2I A;  4KN4 A;  4PAB A;  4C3I C;  2WAQ L;  3VA7 A;  3HOZ K;  3N0B A;  2WB1 L;  1I50 C;  1EQR A;  4A3B K;  1XXA A;  3T01 A;  1KQ4 A;  1YNN A;  3GIR A;  3GTG K;  1WOS A;  4KB2 A;  4QIW L;  4A3G C;  2JA7 C;  4KAW X;  3AD8 C;  1I6V A;  1VGX A;  4LOW A;  2PA8 D;  2CW0 A;  4A3D C;  1IS1 A;  3I4M C;  5IOT A;  3H0G A;  3QX3 A;  1WQG A;  1B4A A;  2ZUF A;  3L4J A;  1JQW A;  1O28 A;  3K7A C;  2KWA A;  3HOY C;  3FKI A;  1ZVU A;  4OIN A;  1YCL A;  1BJT A;  4G7O A;  4J3N A;  3S2D C;  3I4N K;  4WJ4 A;  5IP7 C;  3ORE A;  4O2D A;  2JA5 A;  1TWC K;  5EGE A;  1WQF A;  1HI9 A;  2YU9 C;  4BXX K;  4KAT A;  3CQZ C;  3NUH A;  1SFO A;  4G0W A;  2WAQ D;  1G51 A;  2R93 A;  1K83 C;  4A3K C;  1X31 C;  2WB1 D;  1USM A;  4A93 K;  4LQY A;  4ILD A;  4BLB A;  1BS2 A;  3S1N C;  4QIW D;  3G4C A;  1IW7 A;  3ADA C;  3M3Y C;  2JA8 K;  1WCM K;  1O2B A;  2GSU A;  4C45 A;  3GTM C;  4A3B C;  4C3H K;  2E2H K;  3GTG C;  5M5W K;  4A3E C;  4C3I K;  4Y52 C;  1IQ0 A;  1EH1 A;  1XPP A;  4A3F C;  1VLO A;  4GFQ A;  2NVT K;  3GTQ C;  3N3Y A;  3HXA A;  3HKZ L;  5TMC A;  2JA7 K;  3Q3Q A;  2PPB A;  4AYB L;  3GTP A;  1TWA C;  4GT9 A;  3T00 A;  1I6H C;  1TWC C;  3GTJ C;  1TWG K;  3OPF A;  1Y1V A;  3GTK A;  4DDQ A;  2RH6 A;  4YG2 A;  1XZQ B;  3S0X A;  4P5A A;  4OIQ A;  3S1M C;  5IP7 K;  2GSN A;  4XSZ A;  4KM9 A;  4A93 C;  1YX2 A;  1VH2 A;  3AQO A;  5IOS A;  2YU9 K;  1B4B A;  1XZP A;  5IP9 C;  4BY7 K;  3CQZ K;  3BP8 C;  4C3J K;  1K83 K;  4A3K K;  2JA8 C;  1WCM C;  1Y1W K;  2JA6 K;  3HOW K;  1I50 A;  1O26 A;  4C3H C;  3RZD K;  1WOO A;  4GZY A;  1ZYR A;  3HKZ D;  4C2M C;  1EI6 A;  3M3Y K;  4XSX A;  3A8I A;  3M4O C;  4AYB D;  3GTO C;  1GE9 A;  3GTM K;  2CFA B;  5D4D A;  3GTL C;  5FJ8 K;  4RMF A;  2NVT C;  3OEP A;  2CFA A;  1VJE A;  3GEE A;  4A3E K;  1TWF C;  1R9T K;  4BY1 K;  4YFX A;  4Y52 K;  2VUM A;  2R7Z C;  3GEI A;  4QJV A;  4A3F K;  3GTQ K;  3PO2 K;  1JVI A;  2EBB A;  4M1X A;  3A8K A;  5HL8 A;  4KC6 A;  2RGR A;  1TWG C;  2B63 K;  2A68 A;  4KMD A;  5IYC K;  4KAS A;  3S17 C;  1I3Q A;  2E2I C;  1J6W A;  1BGW A;  3CQZ A;  1WOP A;  1IL2 A;  1TWA K;  5IOQ A;  3SZY A;  3AD7 C;  3S14 K;  4LK0 A;  1I6H K;  1INN A;  4X6A K;  4YFK A;  3GTJ K;  2GAG C;  1AB4 A;  4G0U A;  4MEX A;  4BY7 C;  5L46 A;  4KN7 A;  4GTE A;  5FLM C;  1VRQ C;  4C3J C;  4A3I K;  1ZBS A;  4KMU A;  5CHP A;  3S1M K;  2R92 K;  1F7V A;  3IPJ A;  3LPX A;  1Y1W C;  5TJ3 A;  3SZZ A;  2JA6 C;  3HOW C;  2FQT A;  4P9S A;  3RZD C;  5IP9 K;  3GTG A;  4JK1 A;  4A3L K;  4Q4Z A;  4KM8 A;  1TWH K;  1O29 A;  1C0A A;  4GTF A;  3HOX K;  2NVX K;  4C2M K;  2JA5 C;  1RU0 A;  3GEH A;  1R9T C;  4A3C K;  4BY1 C;  3M4O K;  3GTO K;  1UV7 A;  3GTL K;  4MEY A;  1WQH A;  3PO2 C;  1O27 A;  1TWC A;  5IYD C;  2B63 C;  4XLP A;  1TWF K;  3S1R K;  3GTJ A;  3FOF A;  4G7Z A;  5IYC C;  3FOE A;  1V5V A;  3FHZ A;  3TFH A;  1L0W A;  2R7Z K;  2P5M A;  3BP3 A;  4LJZ A;  3S14 C;  4FM9 A;  3RZO C;  4X6A C;  3S2H C;  3EQL A;  3S16 K;  2NVY K;  1XXC A;  1O2A A;  5C4J C;  3S17 K;  2Y3P A;  3HOV K;  2E2I K;  1DCH A;  1HQM A;  5IYB K;  4A3I C;  2XCQ A;  2E2J C;  2R92 C;  2V6U A;  1WCM A;  4YFN A;  2O5I A;  1J98 A;  1XZP B;  3T02 A;  4KDD A;  4G0V A;  4WIL A;  2E2H A;  4A3L C;  4XCH A;  5M5Y K;  5FLM K;  1TWH C;  4GTA A;  3S1Q C;  3GTP C;  4GTC A;  3H0G K;  3HOX C;  3HOU C;  2NVX C;  3H3V L;  1O25 A;  2JA7 A;  3FKI K;  4A3C C;  1Y1V C;  3GTK C;  2P8T A;  5JVO A;  1F93 A;  3LAP A;  4NOI A;  2JA5 K;  2A6H A;  3S1R C;  1IE0 A;  1TWG A;  4KMH A;  4QJV B;  1SFO K;  2R93 K;  4MQ9 A;  2XCR B;  4KB4 A;  4LLG A;  5IYD K;  3S16 C;  2NVY C;  2YU9 A;  3TFJ A;  3HOV C;  4G7H A;  5IOR A;  2V6S A;  5IYB C;  3MML B;  1K83 A;  3RZO K;  4BBS K;  1WOR A;  3TTG A;  1ZQ1 C;  2PMZ L;  5C44 C;  1Y1W A;  4KAR A;  4BBR C;  3WOD A;  2NVQ K;  5C3E C;  3JST A;  3S2H K;  2JA6 A;  1F9N A;  2XCO A;  5C4J K;  3S2D K;  4GTL A;  3V4G A;  3H3V D;  1ISE A;  3TFI A;  2E2J K;  4GTB A;  4KMA A;  5M3M K;  3GTM A;  2VUM C;  1DCO A;  4OIP A;  3H0G C;  1DCP A;  1O24 A;  5C4X K;  1WSV A;  2GSO A;  2A6E A;  2ZUE A;  3FKI C;  5M3F K;  1R9T A;  2A69 A;  3S15 K;  3S1Q K;  1J6V A;  3PO3 C;  1I3Q C;  3GTP K;  3LAJ A;  2D6F C;  3HOU K;  3AD9 C;  4Y7N C;  3GTQ A;  5CJ9 A;  4LR2 A;  2B63 A;  1Y1V K;  3GTK K;  4A3M K;  2Y0S L;  1PJ6 A;  5E68 A;  1F7U A;  3ERE D;  1SFO C;  3AQP A;  2R93 C;  1TWA A;  1EK8 A;  3HOZ C;  2PMZ D;  3GSI A;  2ZFZ A;  3CAG A;  5TMF A;  5M5X K;  1WIH A;  1EFW A;  4A3J K;  1PJ5 A;  3DXJ A;  4BBS C;  3N0C A;  2R92 A;  3A8J A;  2NVQ C;  4LK1 A;  4OIO A;  1I50 K;  1DD5 A;  1ZXO A;  3BUE A; 
#chains in the Genus database with same CATH homology
 2A68 A;  3S1N C;  1Y1V C;  4A3C C;  4QIW D;  5IYC K;  1IW7 A;  3GTK C;  4A3G K;  3S17 C;  4OIR A;  2E2I C;  3M3Y C;  5C44 K;  1TWA K;  1WCM K;  2JA8 K;  4BBR K;  5C3E K;  3S14 K;  4LK0 A;  1I6H K;  4X6A K;  4A3D K;  4YFK A;  3GTM C;  4NOI A;  3I4M K;  4A3B C;  4C3H K;  3GTJ K;  2JA5 K;  3I4N C;  2A6H A;  5C4X C;  2E2H K;  3S1R C;  5M5W K;  3K7A K;  3GTG C;  4MEX A;  3HOY K;  4BY7 C;  4KN7 A;  4A3E C;  1BDF A;  2Y0S D;  4QJV B;  4C3I K;  3S15 C;  4BXX C;  5FLM C;  4A3I K;  1SFO K;  4Y52 C;  2PA8 L;  4KMU A;  3S1M K;  2R92 K;  2R93 K;  1XPP A;  2VUM K;  2O5J A;  1Y1W C;  4MQ9 A;  2JA6 C;  1YNJ A;  3HOW C;  4A3F C;  4LLG A;  2NVT K;  4XLN A;  5IYD K;  3RZD C;  3GTQ C;  5IP9 K;  3S16 C;  4Q5S A;  2NVY C;  3HKZ L;  4ZH4 A;  4JK1 A;  5TMC A;  4A3M C;  4Q4Z A;  2JA7 K;  4A3L K;  3HOV C;  2PPB A;  1TWH K;  4G7H A;  3PO3 K;  1I3Q K;  5IYB C;  4AYB L;  2BE5 A;  3RZO K;  4BBS K;  2PMZ L;  4Y7N K;  1TWA C;  5C44 C;  4BBR C;  2NVQ K;  3WOD A;  3S2H K;  5C3E C;  3HOX K;  1I6H C;  1TWC C;  3GTJ C;  4C2M K;  5C4J K;  1TWG K;  2JA5 C;  2NVX K;  3S2D K;  3H3V D;  2E2H C;  1SMY A;  4A3J C;  1R9T C;  3S1N K;  4BY1 C;  3M4O K;  4A3C K;  4KN4 A;  4YG2 A;  2E2J K;  3GTO K;  2WAQ L;  3HOZ K;  5M3M K;  4OIQ A;  3S1M C;  3GTL K;  4MEY A;  5IP7 K;  2VUM C;  2WB1 L;  4XSZ A;  4OIP A;  1I50 C;  3H0G C;  4A3B K;  3PO2 C;  4A93 C;  5C4X K;  1YNN A;  5IYD C;  2B63 C;  4XLP A;  1TWF K;  3S1R K;  2A6E A;  5IP9 C;  2YU9 K;  3GTG K;  4BY7 K;  3FKI C;  4QIW L;  5M3F K;  4G7Z A;  4A3G C;  3CQZ K;  5IYC C;  2A69 A;  2JA7 C;  3S15 K;  4C3J K;  3S1Q K;  1I6V A;  1K83 K;  4A3K K;  2R7Z K;  3PO3 C;  2JA8 C;  1I3Q C;  1WCM C;  2PA8 D;  3GTP K;  2CW0 A;  4LJZ A;  1Y1W K;  3RZO C;  3S14 C;  2JA6 K;  3HOU K;  4X6A C;  3HOW K;  4A3D C;  4Y7N C;  3I4M C;  3S2H C;  3EQL A;  3RZD K;  3S16 K;  2NVY K;  1Y1V K;  3K7A C;  3GTK K;  3HOY C;  4GZY A;  1ZYR A;  2Y0S L;  3HKZ D;  5C4J C;  4A3M K;  3HOV K;  2E2I K;  3M3Y K;  3S17 K;  1HQM A;  5IYB K;  4A3I C;  1SFO C;  4OIN A;  4XSX A;  3M4O C;  4AYB D;  2E2J C;  2R92 C;  3GTO C;  2R93 C;  4YFN A;  2O5I A;  3GTM K;  3HOZ C;  2PMZ D;  4G7O A;  5D4D A;  3GTL C;  3I4N K;  5TMF A;  5IP7 C;  5FJ8 K;  2NVT C;  5M5X K;  1TWC K;  4A3E K;  4A3L C;  5M5Y K;  1TWF C;  5FLM K;  4A3J K;  1R9T K;  2YU9 C;  1TWH C;  4YFX A;  4BY1 K;  4BXX K;  4Y52 K;  3CQZ C;  3DXJ A;  4BBS C;  2WAQ D;  3S1Q C;  1K83 C;  4A3K C;  4QJV A;  4A3F K;  2R7Z C;  2NVQ C;  3GTP C;  4LK1 A;  2WB1 D;  1I50 K;  4OIO A;  3H0G K;  3HOX C;  3GTQ K;  3PO2 K;  3HOU C;  4A93 K;  2NVX C;  2B63 K;  1TWG C;  3H3V L;  3S2D C;  3FKI K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...