1I3QK

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i3qK00
5IYCK 5D4DA 4A3CK 4XSXA 3I4MC 2E2JK 3M4OC 4XLPA 3I4MK 2JA5C 2JA5K 3FKIK 3GTQC 4LJZA 1Y1WC 5C4JC 3GTQK 3PO2C 2WB1L 4OINA 5C4JK 3PO2K 5FLMK 1SMYA 2NVYC 2A69A 1SFOC 1TWHC 1SFOK 2R7ZC 4A3EC 2JA6C 2R7ZK 3HOXC 4A3EK 5C44K 1TWCC 2JA6K 4G7ZA 5M5XK 3HOXK 4A3KC 1TWCK 3S2HK 3HOYK 1I6HC 4A3KK 1TWGC 3S15C 3S1RC 4MEXA 3GTKC 1TWGK 1TWAC 5M5YK 5FJ8K 3S1RK 4NOIA 5C3EK 2E2IK 4BY1C 3M3YC 4YFNA 4BY1K 2NVQC 1I3QC 3M3YK 2A68A 5M3MK 4A3IC 4BY7K 1I3QK 4A3IK 2Y0SD 5C4XC 4C3JK 5IYCC 4A3DC 5C4XK 2B63C 4A3DK 2E2JC 2A6HA 2B63K 4BBSC 4A3GK 3H3VD 4MEYA 2E2HC 4BBSK 4AYBD 3WODA 4YG2A 4BXXK 4LK0A 1K83K 2E2HK 3FKIC 3HOVC 4Q5SA 3HOUK 3HOVK 4XLNA 3GTOC 3S1QC 3S1QK 3GTOK 5FLMC 4OIPA 4QJVA 3HKZL 2WAQL 4A3LK 3GTJC 3GTJK 3HOWC 2CW0A 4QIWL 3HOWK 5C44C 4C3HK 2R93C 3S2HC 3GTMK 3HOZC 3HOYC 2NVXC 2R93K 3HOZK 2NVXK 3CQZC 5IP9K 5C3EC 3S14C 2E2IC 4GZYA 3CQZK 4BY7C 2O5JA 3S14K 3RZDC 2YU9C 3I4NK 1I50C 5IP7K 3RZDK 2YU9K 1I50K 4QJVB 2PA8D 1YNNA 2O5IA 4A3GC 4G7OA 4BXXC 1K83C 2BE5A 3HOUC 4BBRK 2JA7K 3S1NC 5M3FK 3EQLA 3S1NK 4KN4A 4Y52C 4KN7A 4Y7NC 4A3LC 4Q4ZA 4Y52K 3S2DC 4Y7NK 1YNJA 3S2DK 4OIRA 3DXJA 2WB1D 3K7AC 2PMZL 2Y0SL 3GTMC 3K7AK 4YFKA 4XSZA 5IYDC 5M5WK 5IYDK 5IP9C 4A3MK 3H3VL 1Y1VC 4KMUA 4YFXA 4AYBL 3S1MC 4A3JC 1Y1VK 3S1MK 3I4NC 1R9TC 5IP7C 4A3JK 2A6EA 1R9TK 3GTLC 4X6AC 3GTLK 5IYBC 4X6AK 3M4OK 4MQ9A 5IYBK 3S16C 2JA8C 1WCMC 3S16K 2JA8K 1WCMK 1Y1WK 1HQMA 4BBRC 2JA7C 1TWFC 4A3BC 1BDFA 1TWFK 3S17C 4A3BK 2NVYK 2NVTC 3GTPC 3GTGC 3S17K 2NVTK 4LLGA 1TWHK 3GTGK 3GTPK 4C3IK 4JK1A 4A3FC 4OIQA 4C2MK 3H0GC 5TMFA 4A3FK 2R92C 3H0GK 1I6HK 4OIOA 1IW7A 2PA8L 5TMCA 2R92K 3HKZD 2WAQD 3GTKK 3RZOC 3S15K 1ZYRA 1TWAK 3RZOK 4ZH4A 4A3MC 2PPBA 4QIWD 2NVQK 2VUMC 4G7HA 3PO3C 4LK1A 4A93C 2VUMK 3PO3K 2PMZD 4A93K 1I6VA 4A3CC 1XPPA
chains in the Genus database with same CATH superfamily
5IYCK 3GTOA 1WIHA 4KC6A 1HI9A 1EFWA 2E2JK 1XZQB 1GE9A 1XZPB 4XLPA 1VH2A 3GTQC 3GTQK 2R93A 2NVXA 2P5MA 1TWHC 2R7ZC 2JA6C 2R7ZK 5C44K 2JA6K 3HOYK 3A8IA 1TWGC 4MEXA 3GEIA 1TWGK 1B4AA 1TWAC 5C3EK 5IOSA 4YFNA 5L46A 2NVQC 2A68A 5M3MK 4A3IC 1K83A 4A3IK 4A3GK 1YCLA 4Q5SA 3HOVC 4FZBA 3HOUK 3QX3A 3HOVK 1J6VA 5FLMC 3N0BA 3HKZL 1V5VA 2WAQL 4A3LK 1O2BA 4GTDA 4BLAA 3A8JA 3HOZC 3LAPA 3HOZK 3S14C 4GZYA 4KMDA 2O5JA 5CHPA 1IE0A 3S14K 4BY7C 3RZDC 2YU9C 3I4NK 5IP7K 3RZDK 2YU9K 4QJVB 2O5IA 4G7OA 4XCHA 2BE5A 1F7VA 3FOFA 4M1XA 3A8KA 4Y7NC 4Y7NK 3OEPA 4C3HC 3K7AC 1BJTA 4KATA 3K7AK 5IYDC 5IYDK 1DCPA 4A3MK 3S1MC 1Y1VC 1ZQ1C 3S1MK 1Y1VK 1R9TC 3GTQA 1R9TK 3GTLC 3LPXA 3TTGA 1JOEA 3GTLK 1YX2A 3M4OK 1EK8A 2ZFZA 1TWHA 1WCMC 2R7ZA 5E68A 1WCMK 5HL8A 2JA6A 1ZXOA 3S17C 1JVIA 1TWGA 3S17K 4LLGA 1TWAA 4PAAA 4C2MC 3OREA 4C2MK 2R92C 1I6HK 1IW7A 2R92K 3TFJA 4ZH4A 4QIWD 3V4GA 4C45A 1IL2A 2JA5A 1VLOA 1I6VA 1XPPA 2JH3A 4XSXA 3T00A 4KARA 3FKIK 5IOTA 4GTBA 1XXCA 2P8TA 1WSRA 2NVYC 1SFOC 1SFOK 3HOXC 2YU9A 4G7ZA 5M5XK 3HOXK 4A3KC 2CFAB 4A3KK 2ZUFA 3S1RC 3M3YC 5FJ8K 3S1RK 4BY1C 1O26A 4PABA 2E2IK 1WOOA 4BY1K 3M3YK 3HXAA 4WJ3M 4KM9A 4A3DC 5IYCC 4DDQA 4A3DK 2E2JC 4BBSC 2D6FC 4BBSK 1USMA 3WODA 4YG2A 5EGHA 1IQ0A 2PHCB 4XLNA 1ISEA 5CJ9A 4QIWL 1IBAA 1Y1VA 5C44C 1R9TA 3GTMK 3HOYC 3BP8C 3GTLA 5IP9K 5C3EC 4P5BA 1J6XA 1WCMA 3MMLB 3NUHA 2PA8D 3JSTA 4A3GC 3CAGA 1L0WA 3OPFA 3HOUC 2JA7K 2GSOA 3EQLA 4Y52C 3GDZA 1B4BA 4A3LC 4Y52K 1O24A 5EGEA 1YNJA 4FM9A 2KWAA 5JVOA 3SZYA 4OIRA 3DXJA 4GTFA 5IOQA 4KMUA 3I4NC 5IP7C 2A6EA 1J98A 4GFQA 1USOA 2NVYA 2Y3PA 4MQ9A 1DCOA 1DD5A 1Y1WK 1EH1A 1TWFC 1TWFK 2NVTC 2NVTK 1XZQA 4GTAA 1XZPA 4LR2A 3AH5A 4JK1A 1DCHA 3H0GC 3TFIA 1RU0A 3H0GK 2PA8L 5TMCA 3S15K 3GTKK 4A3MC 4WILA 1KQ4A 4A93C 1ZBSA 2PMZD 4A93K 3VA7A 4A3CC 2GSUA 4A3CK 2GAGC 3M4OC 2XCOA 2V6TA 5C4JC 4OINA 3Q3QA 5C4JK 1SMYA 3N0CA 4KASA 1F9NA 3AQOA 1TWCC 3GEEA 3S2HK 1TWCK 1I6HC 1XXBA 4P5AA 3AD7C 5M5YK 4NOIA 4J3NA 1I3QC 1JQWA 1VJEA 1WOSA 1I3QK 3SZZA 1O29A 2Y0SD 2A6HA 1BGWA 3H3VD 4MEYA 2E2HC 4BXXK 4KAWX 1K83K 2E2HK 3FKIC 3GIRA 3G4CA 4QJVA 3T02A 1PJ6A 3GTJC 1O28A 3GTJK 4ILDA 4RMFA 4KMHA 3CQZC 2E2IC 3CQZK 3N3YA 1I50C 1I50K 1TWFA 1O25A 5JFEA 2W7VA 1J6WA 1X31C 1BS2A 4BBRK 3LAJA 3ERED 1F93A 5M3FK 4KN7A 3S2DC 3S2DK 2RH6A 3S0XA 4KB2A 3GTMC 2WB1D 2Y0SL 3AQPA 3BP3A 4XSZA 5M5WK 2EBBA 1XXAA 4GTLA 5IP9C 3H3VL 4YFXA 1PJ7A 1F7UA 4KM8A 3IPJA 5IYBC 5IYBK 2JA8C 2JA8K 3AD9C 2XCQA 2JA7C 1TWCA 4A3BC 1BDFA 4A3BK 3L4JA 2R92A 3GTPC 2GAHC 3GTGC 2ZUEA 3GTPK 1TWHK 3GTGK 1AB4A 1O2FB 4A3FC 1I3QA 4A3FK 4OIOA 4AH6A 3RZOC 1TWAK 3RZOK 2V6UA 2PPBA 1O2AA 4G0WA 2NVQK 2VUMC 2E2HA 2VUMK 4GTCA 3FKIA 5D4DA 2CFAA 3I4MC 3I4MK 1EI6A 4BKWA 2JA5C 3GTJA 1G51A 2FQTA 2JA5K 1SFOA 3BUEA 4LJZA 1Y1WC 3PO2C 2WB1L 3PO2K 5FLMK 2GSNA 2A69A 3CQZA 4A3EC 2E2IA 4A3EK 4GTEA 1I50A 4KDDA 3S15C 3GTKC 4WJ4A 4BY7K 1WSVA 3GSIA 4C3JC 1WQFA 5C4XC 4C3JK 5C4XK 2B63C 2B63K 3FOEA 4AYBD 4LK0A 1VRQC 3S1QC 3GTOC 3T01A 3S1QK 3GTOK 3GTMA 4OIPA 5TJ3A 1WORA 3HOWC 2CW0A 4KB4A 3HOWK 4C3HK 2R93C 3S2HC 1WOPA 2R93K 2NVXC 1EQRA 4P9SA 2NVXK 2XCRB 2JA7A 3FHZA 1YNNA 4G0VA 3GTPA 3GTGA 4BXXC 1K83C 2RGRA 4O2DA 3S1NC 3S1NK 4KN4A 4BLBA 4Q4ZA 3TFHA 2VUMA 1INNA 2PMZL 5IORA 1O27A 4YFKA 3L4KA 1ZVUA 4AYBL 1PJ5A 4A3JC 1IS1A 1WQHA 3GEHA 4A3JK 1Y1WA 4X6AC 2FQOA 4X6AK 4LOWA 3S16C 3S16K 4GT9A 1HQMA 4BBRC 3H0GA 2NVYK 3GTKA 4C3IC 4C3IK 4OIQA 5TMFA 3AD8C 1VGXA 3G4AA 4LQYA 1C0AA 3HKZD 2WAQD 1ZYRA 2B63A 1UV7A 2V6SA 4KMAA 3PO3C 4G7HA 3ADAC 4LK1A 3PO3K 1WQGA 4G0UA
chains in the Genus database with same CATH topology
5IYCK 5D4DA 4A3CK 4XSXA 3I4MC 2E2JK 3M4OC 4XLPA 3I4MK 2JA5C 2JA5K 3FKIK 3GTQC 4LJZA 1Y1WC 5C4JC 3GTQK 3PO2C 2WB1L 4OINA 5C4JK 3PO2K 5FLMK 1SMYA 2NVYC 2A69A 1SFOC 1TWHC 1SFOK 2R7ZC 4A3EC 2JA6C 2R7ZK 3HOXC 4A3EK 5C44K 1TWCC 2JA6K 4G7ZA 5M5XK 3HOXK 4A3KC 1TWCK 3S2HK 3HOYK 1I6HC 4A3KK 1TWGC 3S15C 3S1RC 4MEXA 3GTKC 1TWGK 1TWAC 5M5YK 5FJ8K 3S1RK 4NOIA 5C3EK 2E2IK 4BY1C 3M3YC 4YFNA 4BY1K 2NVQC 1I3QC 3M3YK 2A68A 5M3MK 4A3IC 4BY7K 1I3QK 4A3IK 2Y0SD 5C4XC 4C3JK 5IYCC 4A3DC 5C4XK 2B63C 4A3DK 2E2JC 2A6HA 2B63K 4BBSC 4A3GK 3H3VD 4MEYA 2E2HC 4BBSK 4AYBD 3WODA 4YG2A 4BXXK 4LK0A 1K83K 2E2HK 3FKIC 3HOVC 4Q5SA 3HOUK 3HOVK 4XLNA 3GTOC 3S1QC 3S1QK 3GTOK 5FLMC 4OIPA 4QJVA 3HKZL 2WAQL 4A3LK 3GTJC 3GTJK 3HOWC 2CW0A 4QIWL 3HOWK 5C44C 4C3HK 2R93C 3S2HC 3GTMK 3HOZC 3HOYC 2NVXC 2R93K 3HOZK 2NVXK 3CQZC 5IP9K 5C3EC 3S14C 2E2IC 4GZYA 3CQZK 4BY7C 2O5JA 3S14K 3RZDC 2YU9C 3I4NK 1I50C 5IP7K 3RZDK 2YU9K 1I50K 4QJVB 2PA8D 1YNNA 2O5IA 4A3GC 4G7OA 4BXXC 1K83C 2BE5A 3HOUC 4BBRK 2JA7K 3S1NC 5M3FK 3EQLA 3S1NK 4KN4A 4Y52C 4KN7A 4Y7NC 4A3LC 4Q4ZA 4Y52K 3S2DC 4Y7NK 1YNJA 3S2DK 4OIRA 3DXJA 2WB1D 3K7AC 2PMZL 2Y0SL 3GTMC 3K7AK 4YFKA 4XSZA 5IYDC 5M5WK 5IYDK 5IP9C 4A3MK 3H3VL 1Y1VC 4KMUA 4YFXA 4AYBL 3S1MC 4A3JC 1Y1VK 3S1MK 3I4NC 1R9TC 5IP7C 4A3JK 2A6EA 1R9TK 3GTLC 4X6AC 3GTLK 5IYBC 4X6AK 3M4OK 4MQ9A 5IYBK 3S16C 2JA8C 1WCMC 3S16K 2JA8K 1WCMK 1Y1WK 1HQMA 4BBRC 2JA7C 1TWFC 4A3BC 1BDFA 1TWFK 3S17C 4A3BK 2NVYK 2NVTC 3GTPC 3GTGC 3S17K 2NVTK 4LLGA 1TWHK 3GTGK 3GTPK 4C3IK 4JK1A 4A3FC 4OIQA 4C2MK 3H0GC 5TMFA 4A3FK 2R92C 3H0GK 1I6HK 4OIOA 1IW7A 2PA8L 5TMCA 2R92K 3HKZD 2WAQD 3GTKK 3RZOC 3S15K 1ZYRA 1TWAK 3RZOK 4ZH4A 4A3MC 2PPBA 4QIWD 2NVQK 2VUMC 4G7HA 3PO3C 4LK1A 4A93C 2VUMK 3PO3K 2PMZD 4A93K 1I6VA 4A3CC 1XPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC K;  5D4D A;  4A3C K;  4XSX A;  3I4M C;  2E2J K;  3M4O C;  4XLP A;  3I4M K;  2JA5 C;  2JA5 K;  3FKI K;  3GTQ C;  4LJZ A;  1Y1W C;  5C4J C;  3GTQ K;  3PO2 C;  2WB1 L;  4OIN A;  5C4J K;  3PO2 K;  5FLM K;  1SMY A;  2NVY C;  2A69 A;  1SFO C;  1TWH C;  1SFO K;  2R7Z C;  4A3E C;  2JA6 C;  2R7Z K;  3HOX C;  4A3E K;  5C44 K;  1TWC C;  2JA6 K;  4G7Z A;  5M5X K;  3HOX K;  4A3K C;  1TWC K;  3S2H K;  3HOY K;  1I6H C;  4A3K K;  1TWG C;  3S15 C;  3S1R C;  4MEX A;  3GTK C;  1TWG K;  1TWA C;  5M5Y K;  5FJ8 K;  3S1R K;  4NOI A;  5C3E K;  2E2I K;  4BY1 C;  3M3Y C;  4YFN A;  4BY1 K;  2NVQ C;  1I3Q C;  3M3Y K;  2A68 A;  5M3M K;  4A3I C;  4BY7 K;  1I3Q K;  4A3I K;  2Y0S D;  5C4X C;  4C3J K;  5IYC C;  4A3D C;  5C4X K;  2B63 C;  4A3D K;  2E2J C;  2A6H A;  2B63 K;  4BBS C;  4A3G K;  3H3V D;  4MEY A;  2E2H C;  4BBS K;  4AYB D;  3WOD A;  4YG2 A;  4BXX K;  4LK0 A;  1K83 K;  2E2H K;  3FKI C;  3HOV C;  4Q5S A;  3HOU K;  3HOV K;  4XLN A;  3GTO C;  3S1Q C;  3S1Q K;  3GTO K;  5FLM C;  4OIP A;  4QJV A;  3HKZ L;  2WAQ L;  4A3L K;  3GTJ C;  3GTJ K;  3HOW C;  2CW0 A;  4QIW L;  3HOW K;  5C44 C;  4C3H K;  2R93 C;  3S2H C;  3GTM K;  3HOZ C;  3HOY C;  2NVX C;  2R93 K;  3HOZ K;  2NVX K;  3CQZ C;  5IP9 K;  5C3E C;  3S14 C;  2E2I C;  4GZY A;  3CQZ K;  4BY7 C;  2O5J A;  3S14 K;  3RZD C;  2YU9 C;  3I4N K;  1I50 C;  5IP7 K;  3RZD K;  2YU9 K;  1I50 K;  4QJV B;  2PA8 D;  1YNN A;  2O5I A;  4A3G C;  4G7O A;  4BXX C;  1K83 C;  2BE5 A;  3HOU C;  4BBR K;  2JA7 K;  3S1N C;  5M3F K;  3EQL A;  3S1N K;  4KN4 A;  4Y52 C;  4KN7 A;  4Y7N C;  4A3L C;  4Q4Z A;  4Y52 K;  3S2D C;  4Y7N K;  1YNJ A;  3S2D K;  4OIR A;  3DXJ A;  2WB1 D;  3K7A C;  2PMZ L;  2Y0S L;  3GTM C;  3K7A K;  4YFK A;  4XSZ A;  5IYD C;  5M5W K;  5IYD K;  5IP9 C;  4A3M K;  3H3V L;  1Y1V C;  4KMU A;  4YFX A;  4AYB L;  3S1M C;  4A3J C;  1Y1V K;  3S1M K;  3I4N C;  1R9T C;  5IP7 C;  4A3J K;  2A6E A;  1R9T K;  3GTL C;  4X6A C;  3GTL K;  5IYB C;  4X6A K;  3M4O K;  4MQ9 A;  5IYB K;  3S16 C;  2JA8 C;  1WCM C;  3S16 K;  2JA8 K;  1WCM K;  1Y1W K;  1HQM A;  4BBR C;  2JA7 C;  1TWF C;  4A3B C;  1BDF A;  1TWF K;  3S17 C;  4A3B K;  2NVY K;  2NVT C;  3GTP C;  3GTG C;  3S17 K;  2NVT K;  4LLG A;  1TWH K;  3GTG K;  3GTP K;  4C3I K;  4JK1 A;  4A3F C;  4OIQ A;  4C2M K;  3H0G C;  5TMF A;  4A3F K;  2R92 C;  3H0G K;  1I6H K;  4OIO A;  1IW7 A;  2PA8 L;  5TMC A;  2R92 K;  3HKZ D;  2WAQ D;  3GTK K;  3RZO C;  3S15 K;  1ZYR A;  1TWA K;  3RZO K;  4ZH4 A;  4A3M C;  2PPB A;  4QIW D;  2NVQ K;  2VUM C;  4G7H A;  3PO3 C;  4LK1 A;  4A93 C;  2VUM K;  3PO3 K;  2PMZ D;  4A93 K;  1I6V A;  4A3C C;  1XPP A; 
#chains in the Genus database with same CATH topology
 5IYC K;  3GTO A;  1WIH A;  4KC6 A;  1HI9 A;  1EFW A;  2E2J K;  1XZQ B;  1GE9 A;  1XZP B;  4XLP A;  1VH2 A;  3GTQ C;  3GTQ K;  2R93 A;  2NVX A;  2P5M A;  1TWH C;  2R7Z C;  2JA6 C;  2R7Z K;  5C44 K;  2JA6 K;  3HOY K;  3A8I A;  1TWG C;  4MEX A;  3GEI A;  1TWG K;  1B4A A;  1TWA C;  5C3E K;  5IOS A;  4YFN A;  5L46 A;  2NVQ C;  2A68 A;  5M3M K;  4A3I C;  1K83 A;  4A3I K;  4A3G K;  1YCL A;  4Q5S A;  3HOV C;  4FZB A;  3HOU K;  3QX3 A;  3HOV K;  1J6V A;  5FLM C;  3N0B A;  3HKZ L;  1V5V A;  2WAQ L;  4A3L K;  1O2B A;  4GTD A;  4BLA A;  3A8J A;  3HOZ C;  3LAP A;  3HOZ K;  3S14 C;  4GZY A;  4KMD A;  2O5J A;  5CHP A;  1IE0 A;  3S14 K;  4BY7 C;  3RZD C;  2YU9 C;  3I4N K;  5IP7 K;  3RZD K;  2YU9 K;  4QJV B;  2O5I A;  4G7O A;  4XCH A;  2BE5 A;  1F7V A;  3FOF A;  4M1X A;  3A8K A;  4Y7N C;  4Y7N K;  3OEP A;  4C3H C;  3K7A C;  1BJT A;  4KAT A;  3K7A K;  5IYD C;  5IYD K;  1DCP A;  4A3M K;  3S1M C;  1Y1V C;  1ZQ1 C;  3S1M K;  1Y1V K;  1R9T C;  3GTQ A;  1R9T K;  3GTL C;  3LPX A;  3TTG A;  1JOE A;  3GTL K;  1YX2 A;  3M4O K;  1EK8 A;  2ZFZ A;  1TWH A;  1WCM C;  2R7Z A;  5E68 A;  1WCM K;  5HL8 A;  2JA6 A;  1ZXO A;  3S17 C;  1JVI A;  1TWG A;  3S17 K;  4LLG A;  1TWA A;  4PAA A;  4C2M C;  3ORE A;  4C2M K;  2R92 C;  1I6H K;  1IW7 A;  2R92 K;  3TFJ A;  4ZH4 A;  4QIW D;  3V4G A;  4C45 A;  1IL2 A;  2JA5 A;  1VLO A;  1I6V A;  1XPP A;  2JH3 A;  4XSX A;  3T00 A;  4KAR A;  3FKI K;  5IOT A;  4GTB A;  1XXC A;  2P8T A;  1WSR A;  2NVY C;  1SFO C;  1SFO K;  3HOX C;  2YU9 A;  4G7Z A;  5M5X K;  3HOX K;  4A3K C;  2CFA B;  4A3K K;  2ZUF A;  3S1R C;  3M3Y C;  5FJ8 K;  3S1R K;  4BY1 C;  1O26 A;  4PAB A;  2E2I K;  1WOO A;  4BY1 K;  3M3Y K;  3HXA A;  4WJ3 M;  4KM9 A;  4A3D C;  5IYC C;  4DDQ A;  4A3D K;  2E2J C;  4BBS C;  2D6F C;  4BBS K;  1USM A;  3WOD A;  4YG2 A;  5EGH A;  1IQ0 A;  2PHC B;  4XLN A;  1ISE A;  5CJ9 A;  4QIW L;  1IBA A;  1Y1V A;  5C44 C;  1R9T A;  3GTM K;  3HOY C;  3BP8 C;  3GTL A;  5IP9 K;  5C3E C;  4P5B A;  1J6X A;  1WCM A;  3MML B;  3NUH A;  2PA8 D;  3JST A;  4A3G C;  3CAG A;  1L0W A;  3OPF A;  3HOU C;  2JA7 K;  2GSO A;  3EQL A;  4Y52 C;  3GDZ A;  1B4B A;  4A3L C;  4Y52 K;  1O24 A;  5EGE A;  1YNJ A;  4FM9 A;  2KWA A;  5JVO A;  3SZY A;  4OIR A;  3DXJ A;  4GTF A;  5IOQ A;  4KMU A;  3I4N C;  5IP7 C;  2A6E A;  1J98 A;  4GFQ A;  1USO A;  2NVY A;  2Y3P A;  4MQ9 A;  1DCO A;  1DD5 A;  1Y1W K;  1EH1 A;  1TWF C;  1TWF K;  2NVT C;  2NVT K;  1XZQ A;  4GTA A;  1XZP A;  4LR2 A;  3AH5 A;  4JK1 A;  1DCH A;  3H0G C;  3TFI A;  1RU0 A;  3H0G K;  2PA8 L;  5TMC A;  3S15 K;  3GTK K;  4A3M C;  4WIL A;  1KQ4 A;  4A93 C;  1ZBS A;  2PMZ D;  4A93 K;  3VA7 A;  4A3C C;  2GSU A;  4A3C K;  2GAG C;  3M4O C;  2XCO A;  2V6T A;  5C4J C;  4OIN A;  3Q3Q A;  5C4J K;  1SMY A;  3N0C A;  4KAS A;  1F9N A;  3AQO A;  1TWC C;  3GEE A;  3S2H K;  1TWC K;  1I6H C;  1XXB A;  4P5A A;  3AD7 C;  5M5Y K;  4NOI A;  4J3N A;  1I3Q C;  1JQW A;  1VJE A;  1WOS A;  1I3Q K;  3SZZ A;  1O29 A;  2Y0S D;  2A6H A;  1BGW A;  3H3V D;  4MEY A;  2E2H C;  4BXX K;  4KAW X;  1K83 K;  2E2H K;  3FKI C;  3GIR A;  3G4C A;  4QJV A;  3T02 A;  1PJ6 A;  3GTJ C;  1O28 A;  3GTJ K;  4ILD A;  4RMF A;  4KMH A;  3CQZ C;  2E2I C;  3CQZ K;  3N3Y A;  1I50 C;  1I50 K;  1TWF A;  1O25 A;  5JFE A;  2W7V A;  1J6W A;  1X31 C;  1BS2 A;  4BBR K;  3LAJ A;  3ERE D;  1F93 A;  5M3F K;  4KN7 A;  3S2D C;  3S2D K;  2RH6 A;  3S0X A;  4KB2 A;  3GTM C;  2WB1 D;  2Y0S L;  3AQP A;  3BP3 A;  4XSZ A;  5M5W K;  2EBB A;  1XXA A;  4GTL A;  5IP9 C;  3H3V L;  4YFX A;  1PJ7 A;  1F7U A;  4KM8 A;  3IPJ A;  5IYB C;  5IYB K;  2JA8 C;  2JA8 K;  3AD9 C;  2XCQ A;  2JA7 C;  1TWC A;  4A3B C;  1BDF A;  4A3B K;  3L4J A;  2R92 A;  3GTP C;  2GAH C;  3GTG C;  2ZUE A;  3GTP K;  1TWH K;  3GTG K;  1AB4 A;  1O2F B;  4A3F C;  1I3Q A;  4A3F K;  4OIO A;  4AH6 A;  3RZO C;  1TWA K;  3RZO K;  2V6U A;  2PPB A;  1O2A A;  4G0W A;  2NVQ K;  2VUM C;  2E2H A;  2VUM K;  4GTC A;  3FKI A;  5D4D A;  2CFA A;  3I4M C;  3I4M K;  1EI6 A;  4BKW A;  2JA5 C;  3GTJ A;  1G51 A;  2FQT A;  2JA5 K;  1SFO A;  3BUE A;  4LJZ A;  1Y1W C;  3PO2 C;  2WB1 L;  3PO2 K;  5FLM K;  2GSN A;  2A69 A;  3CQZ A;  4A3E C;  2E2I A;  4A3E K;  4GTE A;  1I50 A;  4KDD A;  3S15 C;  3GTK C;  4WJ4 A;  4BY7 K;  1WSV A;  3GSI A;  4C3J C;  1WQF A;  5C4X C;  4C3J K;  5C4X K;  2B63 C;  2B63 K;  3FOE A;  4AYB D;  4LK0 A;  1VRQ C;  3S1Q C;  3GTO C;  3T01 A;  3S1Q K;  3GTO K;  3GTM A;  4OIP A;  5TJ3 A;  1WOR A;  3HOW C;  2CW0 A;  4KB4 A;  3HOW K;  4C3H K;  2R93 C;  3S2H C;  1WOP A;  2R93 K;  2NVX C;  1EQR A;  4P9S A;  2NVX K;  2XCR B;  2JA7 A;  3FHZ A;  1YNN A;  4G0V A;  3GTP A;  3GTG A;  4BXX C;  1K83 C;  2RGR A;  4O2D A;  3S1N C;  3S1N K;  4KN4 A;  4BLB A;  4Q4Z A;  3TFH A;  2VUM A;  1INN A;  2PMZ L;  5IOR A;  1O27 A;  4YFK A;  3L4K A;  1ZVU A;  4AYB L;  1PJ5 A;  4A3J C;  1IS1 A;  1WQH A;  3GEH A;  4A3J K;  1Y1W A;  4X6A C;  2FQO A;  4X6A K;  4LOW A;  3S16 C;  3S16 K;  4GT9 A;  1HQM A;  4BBR C;  3H0G A;  2NVY K;  3GTK A;  4C3I C;  4C3I K;  4OIQ A;  5TMF A;  3AD8 C;  1VGX A;  3G4A A;  4LQY A;  1C0A A;  3HKZ D;  2WAQ D;  1ZYR A;  2B63 A;  1UV7 A;  2V6S A;  4KMA A;  3PO3 C;  4G7H A;  3ADA C;  4LK1 A;  3PO3 K;  1WQG A;  4G0U A; 
#chains in the Genus database with same CATH homology
 5IYC K;  5D4D A;  4A3C K;  4XSX A;  3I4M C;  2E2J K;  3M4O C;  4XLP A;  3I4M K;  2JA5 C;  2JA5 K;  3FKI K;  3GTQ C;  4LJZ A;  1Y1W C;  5C4J C;  3GTQ K;  3PO2 C;  2WB1 L;  4OIN A;  5C4J K;  3PO2 K;  5FLM K;  1SMY A;  2NVY C;  2A69 A;  1SFO C;  1TWH C;  1SFO K;  2R7Z C;  4A3E C;  2JA6 C;  2R7Z K;  3HOX C;  4A3E K;  5C44 K;  1TWC C;  2JA6 K;  4G7Z A;  5M5X K;  3HOX K;  4A3K C;  1TWC K;  3S2H K;  3HOY K;  1I6H C;  4A3K K;  1TWG C;  3S15 C;  3S1R C;  4MEX A;  3GTK C;  1TWG K;  1TWA C;  5M5Y K;  5FJ8 K;  3S1R K;  4NOI A;  5C3E K;  2E2I K;  4BY1 C;  3M3Y C;  4YFN A;  4BY1 K;  2NVQ C;  1I3Q C;  3M3Y K;  2A68 A;  5M3M K;  4A3I C;  4BY7 K;  1I3Q K;  4A3I K;  2Y0S D;  5C4X C;  4C3J K;  5IYC C;  4A3D C;  5C4X K;  2B63 C;  4A3D K;  2E2J C;  2A6H A;  2B63 K;  4BBS C;  4A3G K;  3H3V D;  4MEY A;  2E2H C;  4BBS K;  4AYB D;  3WOD A;  4YG2 A;  4BXX K;  4LK0 A;  1K83 K;  2E2H K;  3FKI C;  3HOV C;  4Q5S A;  3HOU K;  3HOV K;  4XLN A;  3GTO C;  3S1Q C;  3S1Q K;  3GTO K;  5FLM C;  4OIP A;  4QJV A;  3HKZ L;  2WAQ L;  4A3L K;  3GTJ C;  3GTJ K;  3HOW C;  2CW0 A;  4QIW L;  3HOW K;  5C44 C;  4C3H K;  2R93 C;  3S2H C;  3GTM K;  3HOZ C;  3HOY C;  2NVX C;  2R93 K;  3HOZ K;  2NVX K;  3CQZ C;  5IP9 K;  5C3E C;  3S14 C;  2E2I C;  4GZY A;  3CQZ K;  4BY7 C;  2O5J A;  3S14 K;  3RZD C;  2YU9 C;  3I4N K;  1I50 C;  5IP7 K;  3RZD K;  2YU9 K;  1I50 K;  4QJV B;  2PA8 D;  1YNN A;  2O5I A;  4A3G C;  4G7O A;  4BXX C;  1K83 C;  2BE5 A;  3HOU C;  4BBR K;  2JA7 K;  3S1N C;  5M3F K;  3EQL A;  3S1N K;  4KN4 A;  4Y52 C;  4KN7 A;  4Y7N C;  4A3L C;  4Q4Z A;  4Y52 K;  3S2D C;  4Y7N K;  1YNJ A;  3S2D K;  4OIR A;  3DXJ A;  2WB1 D;  3K7A C;  2PMZ L;  2Y0S L;  3GTM C;  3K7A K;  4YFK A;  4XSZ A;  5IYD C;  5M5W K;  5IYD K;  5IP9 C;  4A3M K;  3H3V L;  1Y1V C;  4KMU A;  4YFX A;  4AYB L;  3S1M C;  4A3J C;  1Y1V K;  3S1M K;  3I4N C;  1R9T C;  5IP7 C;  4A3J K;  2A6E A;  1R9T K;  3GTL C;  4X6A C;  3GTL K;  5IYB C;  4X6A K;  3M4O K;  4MQ9 A;  5IYB K;  3S16 C;  2JA8 C;  1WCM C;  3S16 K;  2JA8 K;  1WCM K;  1Y1W K;  1HQM A;  4BBR C;  2JA7 C;  1TWF C;  4A3B C;  1BDF A;  1TWF K;  3S17 C;  4A3B K;  2NVY K;  2NVT C;  3GTP C;  3GTG C;  3S17 K;  2NVT K;  4LLG A;  1TWH K;  3GTG K;  3GTP K;  4C3I K;  4JK1 A;  4A3F C;  4OIQ A;  4C2M K;  3H0G C;  5TMF A;  4A3F K;  2R92 C;  3H0G K;  1I6H K;  4OIO A;  1IW7 A;  2PA8 L;  5TMC A;  2R92 K;  3HKZ D;  2WAQ D;  3GTK K;  3RZO C;  3S15 K;  1ZYR A;  1TWA K;  3RZO K;  4ZH4 A;  4A3M C;  2PPB A;  4QIW D;  2NVQ K;  2VUM C;  4G7H A;  3PO3 C;  4LK1 A;  4A93 C;  2VUM K;  3PO3 K;  2PMZ D;  4A93 K;  1I6V A;  4A3C C;  1XPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...