1I3QK

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i3qK00
2O5IA 4Y52C 5TMCA 1I3QC 2E2JC 3M4OK 3CQZK 4OIQA 4OIPA 2WB1L 2JA7C 3H0GK 4QIWD 4BBRK 2CW0A 5C4XK 1Y1WC 3M3YC 1TWFK 2O5JA 2YU9K 2BE5A 4MQ9A 1Y1VK 4OINA 3FKIC 3RZOK 4A3KK 2JA8C 4BXXC 3CQZC 1TWGC 2B63C 4BBSK 3GTJK 4A3BK 2PA8L 4JK1A 4C2MK 5C4JC 4AYBL 3GTPK 4Q4ZA 3GTKK 3HOYC 4BBRC 3M3YK 1TWAK 2A69A 1TWHC 2JA6K 1SFOC 4Y52K 5C4XC 3EQLA 4LJZA 2VUMK 3I4NK 1I6HK 4G7ZA 2Y0SD 3K7AC 4Y7NK 4A3KC 2JA8K 5IYCK 4Q5SA 3S2HC 2WAQD 4X6AC 5IP9C 3HKZL 3GTKC 3S15K 1HQMA 4A3IC 4A3FK 2PMZD 4A93C 3S1RK 1IW7A 1YNNA 4C3HK 4YFXA 4QJVB 5M3MK 2B63K 2NVTK 3GTMC 3S16K 2NVXC 2R92K 4A3GC 3HOWC 3RZDC 2WAQL 1SFOK 4MEYA 2WB1D 3WODA 3GTQK 2R7ZK 3H0GC 3GTGK 2PMZL 4ZH4A 5IYCC 4A3JK 3GTMK 3S2HK 5C44K 3HOUK 5TMFA 2NVXK 3S14C 1Y1VC 2R93K 3FKIK 5M3FK 3HKZD 3HOWK 1I50K 4A3EC 3S1QK 4A3FC 3GTJC 3S1MK 3PO3K 3DXJA 2NVTC 3HOYK 4YG2A 2E2IK 3GTGC 4A3CK 4LK0A 5C3EC 3GTQC 4BY7K 2R92C 5IYBC 3GTOC 2VUMC 3I4NC 3I4MK 1I3QK 4QJVA 4A3GK 1I6HC 2R93C 3K7AK 4Y7NC 2NVQK 3S1NC 1I50C 4A3EK 4LLGA 1R9TK 4XLNA 1BDFA 4XSXA 5IP7C 2E2HC 4A3JC 3HOVK 3S17K 3GTLK 2E2IC 4XLPA 4A3CC 5M5WK 5FJ8K 2E2JK 3M4OC 3S1QC 4BY1K 4A3DK 2A68A 1SMYA 2JA7K 3HOXC 5FLMC 2JA5C 1TWAC 1Y1WK 1TWHK 5IP7K 2E2HK 3HOVC 5IYBK 1I6VA 4C3JK 4MEXA 3GTOK 3S17C 4BY7C 5M5XK 2NVYC 2R7ZC 2A6EA 5IYDK 3S1NK 4C3IK 1K83C 3HOZK 4BXXK 4G7OA 2A6HA 4QIWL 4OIOA 4A3MK 4GZYA 4A3LK 2JA6C 4A3IK 1TWCK 4A93K 4KN4A 2NVYK 1K83K 3HOZC 3H3VD 5FLMK 2JA5K 4X6AK 5IP9K 2PPBA 2YU9C 2NVQC 4NOIA 2Y0SL 4A3MC 4A3LC 4KN7A 1R9TC 1ZYRA 3RZOC 5D4DA 5IYDC 3S1RC 3PO2C 3GTLC 4YFKA 1WCMK 5C4JK 3GTPC 4A3BC 4YFNA 3RZDK 1TWCC 4BY1C 4A3DC 1YNJA 3PO3C 3S1MC 3S2DK 4KMUA 3HOXK 5M5YK 4LK1A 1TWFC 4XSZA 4AYBD 5C44C 1XPPA 4OIRA 1WCMC 3HOUC 3I4MC 3S14K 3S15C 1TWGK 2PA8D 4BBSC 3H3VL 3S2DC 3PO2K 3S16C 4G7HA 5C3EK
chains in the Genus database with same CATH superfamily
4KMAA 1I3QC 4OIQA 4OIPA 3H0GK 3GTQA 1ISEA 3FHZA 3M3YC 2O5JA 1TWFK 2YU9K 2BE5A 4OINA 3RZOK 3HXAA 4A3KK 4BXXC 4C3HC 4BBSK 1WSRA 4AYBL 3GTPK 3GSIA 1VH2A 4O2DA 3M3YK 3EQLA 3I4NK 2FQTA 4A3KC 2YU9A 3HKZL 1SFOA 2GSNA 1HQMA 3SZZA 3S1RK 5M3MK 3S16K 5IOTA 3AD8C 2NVXC 1WOSA 1JVIA 5IOQA 1SFOK 4KMHA 1JQWA 1GE9A 2R7ZK 2E2IA 2PMZL 3S2HK 2R93K 2NVXK 3FKIK 5M3FK 3HKZD 3GTJC 1BS2A 2XCOA 3DXJA 2NVTC 3HOYK 1Y1WA 2E2IK 5C3EC 1Y1VA 3GTQC 5IYBC 4A3GK 2R93C 3K7AK 4Y7NC 4XLNA 3HOVK 4A3JC 1XXAA 3N0CA 2E2IC 1R9TA 3GEHA 2E2JK 2A68A 3HOXC 5FLMC 2JA5C 1TWAC 1Y1WK 3HOVC 1I6VA 4C3JK 1O26A 2D6FC 3S1NK 3G4AA 3GEIA 5L46A 4G7OA 3GTMA 4OIOA 3OREA 4KM8A 1ZVUA 5E68A 4KN4A 4G0UA 1VJEA 4DDQA 3LAPA 3H3VD 4X6AK 1EFWA 2YU9C 4G0WA 2JA5A 3N3YA 3A8JA 3RZOC 3GTLC 1WCMK 3GTPC 4M1XA 1TWCC 4A3DC 3L4JA 2XCRB 3PO3C 3S2DK 1IQ0A 1TWFC 1O24A 4AYBD 1XPPA 3GTJA 1WCMC 1IS1A 3GTOA 1WORA 1B4BA 2EBBA 1WCMA 4J3NA 4BBSC 1VGXA 4GTEA 4P5AA 3S2DC 3PO2K 3S16C 3AD9C 4G7HA 2O5IA 1XZQB 3GTLA 3CQZK 1C0AA 2WB1L 2JA7C 4QIWD 5C4XK 4MQ9A 3FKIC 1WSVA 3CQZC 3GTJK 4C2MK 3GTKK 1WIHA 3HOYC 4A3BK 4KASA 2JA6A 5C4XC 1INNA 1DCPA 1TWHC 2A69A 1SFOC 2Y0SD 1TWHA 3K7AC 4Y7NK 3S2HC 2WAQD 5IP9C 2ZFZA 4C2MC 3GTKC 4A3IC 1XXBA 4A93C 2NVTK 2B63K 4YFXA 4QJVB 1DCHA 2JH3A 4A3GC 2GAGC 3HOWC 3RZDC 3NUHA 1I3QA 3WODA 4C3JC 4ZH4A 5IYCC 4A3JK 5C44K 3S14C 5TMFA 1Y1VC 4PABA 3HOWK 1I50K 4A3EC 3BP8C 3MMLB 4P5BA 1EH1A 2R92C 1I6HC 4PAAA 3I4MK 1I3QK 3BP3A 4QJVA 3S1NC 1I50C 4A3EK 3SZYA 1RU0A 1YX2A 3S17K 3GTLK 4GTCA 3M4OC 3AH5A 3S1QC 4KMDA 1XZQA 4A3DK 1L0WA 1TWCA 1ZBSA 4AH6A 2GAHC 3S17C 4P9SA 4BY7C 1UV7A 5M5XK 2NVYC 4XCHA 2A6HA 2Y3PA 3ADAC 4GZYA 4KC6A 2JA6C 1TWCK 2NVYK 2R92A 1VRQC 2PPBA 2B63A 3LPXA 1BGWA 1R9TC 1ZYRA 5D4DA 3CAGA 5IYDC 1USMA 2NVYA 3PO2C 3VA7A 4A3BC 4YFNA 4BY1C 1PJ5A 1YNJA 1F7UA 1I50A 2W7VA 3OEPA 1WOPA 4XSZA 3HOUC 3A8KA 5JVOA 2V6SA 2E2JC 3IPJA 1Y1WC 4KM9A 1Y1VK 1O25A 4LR2A 2JA8C 2B63C 1USOA 5C4JC 4ILDA 3GTPA 3GTKA 4Y52K 3FOEA 4LJZA 1I6HK 4KDDA 4G7ZA 5TJ3A 2JA8K 1EI6A 5IYCK 4FM9A 4Q5SA 4X6AC 3S15K 3A8IA 2GSOA 1IW7A 4GTAA 4BKWA 2R92K 3FOFA 2WAQL 4MEYA 2V6TA 1KQ4A 1PJ6A 1TWAA 3FKIA 3S1QK 4A3FC 3JSTA 3S1MK 2RH6A 3OPFA 3GDZA 4YG2A 4LK0A 2V6UA 4BY7K 2JA7A 2VUMC 2CFAB 1O28A 4GTDA 2GSUA 1R9TK 5IP7C 2E2HC 3S0XA 4XLPA 5M5WK 3V4GA 4C3IC 5FJ8K 1IL2A 4BY1K 1SMYA 3LAJA 1DD5A 1TWHK 5IP7K 2E2HK 3GTOK 2KWAA 3G4CA 4FZBA 4G0VA 5IYDK 4C3IK 3HOZK 1BJTA 4BXXK 2NVXA 1F7VA 1YCLA 1J6VA 4A3MK 4A3LK 4A3IK 2R7ZA 4A93K 2CFAA 4BLBA 3HOZC 4LQYA 2NVQC 4NOIA 4A3MC 4A3LC 3S1RC 1O27A 3Q3QA 5C4JK 3AQPA 5EGEA 3TFHA 4KMUA 5EGHA 2ZUFA 3N0BA 3I4MC 4WJ4A 4KATA 1IE0A 4RMFA 3S15C 2PHCB 3AD7C 3GTGA 3ERED 2PA8D 3L4KA 1IBAA 5C3EK 3H0GA 1EQRA 2RGRA 4Y52C 3GTQK 5TMCA 1F93A 2XCQA 3M4OK 4WILA 1O29A 4BBRK 2CW0A 5CJ9A 1O2FB 4GT9A 2P8TA 3TTGA 3TFIA 1TWGC 2PA8L 1JOEA 4JK1A 4Q4ZA 4BBRC 1TWAK 2JA6K 1WOOA 1XXCA 1J6WA 1WQGA 2VUMK 1B4AA 5HL8A 2P5MA 4GTFA 1ZQ1C 4A3FK 4GFQA 2PMZD 3TFJA 1EK8A 1O2BA 1YNNA 3CQZA 4C3HK 3GTMC 1F9NA 5IORA 3QX3A 1K83A 1XZPA 1J6XA 2WB1D 3T02A 4C45A 1WQFA 3H0GC 1HI9A 3GTGK 3GTMK 3GIRA 3HOUK 1WQHA 1V5VA 3PO3K 3GTGC 4A3CK 3T00A 3GTOC 4KAWX 3I4NC 4KB2A 4KB4A 1ZXOA 2NVQK 4LLGA 1BDFA 1X31C 4XSXA 5CHPA 4WJ3M 4A3CC 1AB4A 2JA7K 3BUEA 5IYBK 4MEXA 1G51A 2R7ZC 2A6EA 1K83C 4QIWL 5JFEA 1O2AA 4GTBA 1K83K 5FLMK 2JA5K 5IP9K 2Y0SL 4KN7A 5IOSA 3T01A 2ZUEA 1J98A 4YFKA 1TWGA 3GEEA 3RZDK 4KARA 2VUMA 3S1MC 1PJ7A 1XZPB 3HOXK 5M5YK 4LK1A 2R93A 5C44C 4OIRA 3S14K 4LOWA 2E2HA 2FQOA 1TWGK 1VLOA 4GTLA 3AQOA 3H3VL 1TWFA 1DCOA 4BLAA
chains in the Genus database with same CATH topology
2O5IA 4Y52C 5TMCA 1I3QC 2E2JC 3M4OK 3CQZK 4OIQA 4OIPA 2WB1L 2JA7C 3H0GK 4QIWD 4BBRK 2CW0A 5C4XK 1Y1WC 3M3YC 1TWFK 2O5JA 2YU9K 2BE5A 4MQ9A 1Y1VK 4OINA 3FKIC 3RZOK 4A3KK 2JA8C 4BXXC 3CQZC 1TWGC 2B63C 4BBSK 3GTJK 4A3BK 2PA8L 4JK1A 4C2MK 5C4JC 4AYBL 3GTPK 4Q4ZA 3GTKK 3HOYC 4BBRC 3M3YK 1TWAK 2A69A 1TWHC 2JA6K 1SFOC 4Y52K 5C4XC 3EQLA 4LJZA 2VUMK 3I4NK 1I6HK 4G7ZA 2Y0SD 3K7AC 4Y7NK 4A3KC 2JA8K 5IYCK 4Q5SA 3S2HC 2WAQD 4X6AC 5IP9C 3HKZL 3GTKC 3S15K 1HQMA 4A3IC 4A3FK 2PMZD 4A93C 3S1RK 1IW7A 1YNNA 4C3HK 4YFXA 4QJVB 5M3MK 2B63K 2NVTK 3GTMC 3S16K 2NVXC 2R92K 4A3GC 3HOWC 3RZDC 2WAQL 1SFOK 4MEYA 2WB1D 3WODA 3GTQK 2R7ZK 3H0GC 3GTGK 2PMZL 4ZH4A 5IYCC 4A3JK 3GTMK 3S2HK 5C44K 3HOUK 5TMFA 2NVXK 3S14C 1Y1VC 2R93K 3FKIK 5M3FK 3HKZD 3HOWK 1I50K 4A3EC 3S1QK 4A3FC 3GTJC 3S1MK 3PO3K 3DXJA 2NVTC 3HOYK 4YG2A 2E2IK 3GTGC 4A3CK 4LK0A 5C3EC 3GTQC 4BY7K 2R92C 5IYBC 3GTOC 2VUMC 3I4NC 3I4MK 1I3QK 4QJVA 4A3GK 1I6HC 2R93C 3K7AK 4Y7NC 2NVQK 3S1NC 1I50C 4A3EK 4LLGA 1R9TK 4XLNA 1BDFA 4XSXA 5IP7C 2E2HC 4A3JC 3HOVK 3S17K 3GTLK 2E2IC 4XLPA 4A3CC 5M5WK 5FJ8K 2E2JK 3M4OC 3S1QC 4BY1K 4A3DK 2A68A 1SMYA 2JA7K 3HOXC 5FLMC 2JA5C 1TWAC 1Y1WK 1TWHK 5IP7K 2E2HK 3HOVC 5IYBK 1I6VA 4C3JK 4MEXA 3GTOK 3S17C 4BY7C 5M5XK 2NVYC 2R7ZC 2A6EA 5IYDK 3S1NK 4C3IK 1K83C 3HOZK 4BXXK 4G7OA 2A6HA 4QIWL 4OIOA 4A3MK 4GZYA 4A3LK 2JA6C 4A3IK 1TWCK 4A93K 4KN4A 2NVYK 1K83K 3HOZC 3H3VD 5FLMK 2JA5K 4X6AK 5IP9K 2PPBA 2YU9C 2NVQC 4NOIA 2Y0SL 4A3MC 4A3LC 4KN7A 1R9TC 1ZYRA 3RZOC 5D4DA 5IYDC 3S1RC 3PO2C 3GTLC 4YFKA 1WCMK 5C4JK 3GTPC 4A3BC 4YFNA 3RZDK 1TWCC 4BY1C 4A3DC 1YNJA 3PO3C 3S1MC 3S2DK 4KMUA 3HOXK 5M5YK 4LK1A 1TWFC 4XSZA 4AYBD 5C44C 1XPPA 4OIRA 1WCMC 3HOUC 3I4MC 3S14K 3S15C 1TWGK 2PA8D 4BBSC 3H3VL 3S2DC 3PO2K 3S16C 4G7HA 5C3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5I A;  4Y52 C;  5TMC A;  1I3Q C;  2E2J C;  3M4O K;  3CQZ K;  4OIQ A;  4OIP A;  2WB1 L;  2JA7 C;  3H0G K;  4QIW D;  4BBR K;  2CW0 A;  5C4X K;  1Y1W C;  3M3Y C;  1TWF K;  2O5J A;  2YU9 K;  2BE5 A;  4MQ9 A;  1Y1V K;  4OIN A;  3FKI C;  3RZO K;  4A3K K;  2JA8 C;  4BXX C;  3CQZ C;  1TWG C;  2B63 C;  4BBS K;  3GTJ K;  4A3B K;  2PA8 L;  4JK1 A;  4C2M K;  5C4J C;  4AYB L;  3GTP K;  4Q4Z A;  3GTK K;  3HOY C;  4BBR C;  3M3Y K;  1TWA K;  2A69 A;  1TWH C;  2JA6 K;  1SFO C;  4Y52 K;  5C4X C;  3EQL A;  4LJZ A;  2VUM K;  3I4N K;  1I6H K;  4G7Z A;  2Y0S D;  3K7A C;  4Y7N K;  4A3K C;  2JA8 K;  5IYC K;  4Q5S A;  3S2H C;  2WAQ D;  4X6A C;  5IP9 C;  3HKZ L;  3GTK C;  3S15 K;  1HQM A;  4A3I C;  4A3F K;  2PMZ D;  4A93 C;  3S1R K;  1IW7 A;  1YNN A;  4C3H K;  4YFX A;  4QJV B;  5M3M K;  2B63 K;  2NVT K;  3GTM C;  3S16 K;  2NVX C;  2R92 K;  4A3G C;  3HOW C;  3RZD C;  2WAQ L;  1SFO K;  4MEY A;  2WB1 D;  3WOD A;  3GTQ K;  2R7Z K;  3H0G C;  3GTG K;  2PMZ L;  4ZH4 A;  5IYC C;  4A3J K;  3GTM K;  3S2H K;  5C44 K;  3HOU K;  5TMF A;  2NVX K;  3S14 C;  1Y1V C;  2R93 K;  3FKI K;  5M3F K;  3HKZ D;  3HOW K;  1I50 K;  4A3E C;  3S1Q K;  4A3F C;  3GTJ C;  3S1M K;  3PO3 K;  3DXJ A;  2NVT C;  3HOY K;  4YG2 A;  2E2I K;  3GTG C;  4A3C K;  4LK0 A;  5C3E C;  3GTQ C;  4BY7 K;  2R92 C;  5IYB C;  3GTO C;  2VUM C;  3I4N C;  3I4M K;  1I3Q K;  4QJV A;  4A3G K;  1I6H C;  2R93 C;  3K7A K;  4Y7N C;  2NVQ K;  3S1N C;  1I50 C;  4A3E K;  4LLG A;  1R9T K;  4XLN A;  1BDF A;  4XSX A;  5IP7 C;  2E2H C;  4A3J C;  3HOV K;  3S17 K;  3GTL K;  2E2I C;  4XLP A;  4A3C C;  5M5W K;  5FJ8 K;  2E2J K;  3M4O C;  3S1Q C;  4BY1 K;  4A3D K;  2A68 A;  1SMY A;  2JA7 K;  3HOX C;  5FLM C;  2JA5 C;  1TWA C;  1Y1W K;  1TWH K;  5IP7 K;  2E2H K;  3HOV C;  5IYB K;  1I6V A;  4C3J K;  4MEX A;  3GTO K;  3S17 C;  4BY7 C;  5M5X K;  2NVY C;  2R7Z C;  2A6E A;  5IYD K;  3S1N K;  4C3I K;  1K83 C;  3HOZ K;  4BXX K;  4G7O A;  2A6H A;  4QIW L;  4OIO A;  4A3M K;  4GZY A;  4A3L K;  2JA6 C;  4A3I K;  1TWC K;  4A93 K;  4KN4 A;  2NVY K;  1K83 K;  3HOZ C;  3H3V D;  5FLM K;  2JA5 K;  4X6A K;  5IP9 K;  2PPB A;  2YU9 C;  2NVQ C;  4NOI A;  2Y0S L;  4A3M C;  4A3L C;  4KN7 A;  1R9T C;  1ZYR A;  3RZO C;  5D4D A;  5IYD C;  3S1R C;  3PO2 C;  3GTL C;  4YFK A;  1WCM K;  5C4J K;  3GTP C;  4A3B C;  4YFN A;  3RZD K;  1TWC C;  4BY1 C;  4A3D C;  1YNJ A;  3PO3 C;  3S1M C;  3S2D K;  4KMU A;  3HOX K;  5M5Y K;  4LK1 A;  1TWF C;  4XSZ A;  4AYB D;  5C44 C;  1XPP A;  4OIR A;  1WCM C;  3HOU C;  3I4M C;  3S14 K;  3S15 C;  1TWG K;  2PA8 D;  4BBS C;  3H3V L;  3S2D C;  3PO2 K;  3S16 C;  4G7H A;  5C3E K; 
#chains in the Genus database with same CATH topology
 4KMA A;  1I3Q C;  4OIQ A;  4OIP A;  3H0G K;  3GTQ A;  1ISE A;  3FHZ A;  3M3Y C;  2O5J A;  1TWF K;  2YU9 K;  2BE5 A;  4OIN A;  3RZO K;  3HXA A;  4A3K K;  4BXX C;  4C3H C;  4BBS K;  1WSR A;  4AYB L;  3GTP K;  3GSI A;  1VH2 A;  4O2D A;  3M3Y K;  3EQL A;  3I4N K;  2FQT A;  4A3K C;  2YU9 A;  3HKZ L;  1SFO A;  2GSN A;  1HQM A;  3SZZ A;  3S1R K;  5M3M K;  3S16 K;  5IOT A;  3AD8 C;  2NVX C;  1WOS A;  1JVI A;  5IOQ A;  1SFO K;  4KMH A;  1JQW A;  1GE9 A;  2R7Z K;  2E2I A;  2PMZ L;  3S2H K;  2R93 K;  2NVX K;  3FKI K;  5M3F K;  3HKZ D;  3GTJ C;  1BS2 A;  2XCO A;  3DXJ A;  2NVT C;  3HOY K;  1Y1W A;  2E2I K;  5C3E C;  1Y1V A;  3GTQ C;  5IYB C;  4A3G K;  2R93 C;  3K7A K;  4Y7N C;  4XLN A;  3HOV K;  4A3J C;  1XXA A;  3N0C A;  2E2I C;  1R9T A;  3GEH A;  2E2J K;  2A68 A;  3HOX C;  5FLM C;  2JA5 C;  1TWA C;  1Y1W K;  3HOV C;  1I6V A;  4C3J K;  1O26 A;  2D6F C;  3S1N K;  3G4A A;  3GEI A;  5L46 A;  4G7O A;  3GTM A;  4OIO A;  3ORE A;  4KM8 A;  1ZVU A;  5E68 A;  4KN4 A;  4G0U A;  1VJE A;  4DDQ A;  3LAP A;  3H3V D;  4X6A K;  1EFW A;  2YU9 C;  4G0W A;  2JA5 A;  3N3Y A;  3A8J A;  3RZO C;  3GTL C;  1WCM K;  3GTP C;  4M1X A;  1TWC C;  4A3D C;  3L4J A;  2XCR B;  3PO3 C;  3S2D K;  1IQ0 A;  1TWF C;  1O24 A;  4AYB D;  1XPP A;  3GTJ A;  1WCM C;  1IS1 A;  3GTO A;  1WOR A;  1B4B A;  2EBB A;  1WCM A;  4J3N A;  4BBS C;  1VGX A;  4GTE A;  4P5A A;  3S2D C;  3PO2 K;  3S16 C;  3AD9 C;  4G7H A;  2O5I A;  1XZQ B;  3GTL A;  3CQZ K;  1C0A A;  2WB1 L;  2JA7 C;  4QIW D;  5C4X K;  4MQ9 A;  3FKI C;  1WSV A;  3CQZ C;  3GTJ K;  4C2M K;  3GTK K;  1WIH A;  3HOY C;  4A3B K;  4KAS A;  2JA6 A;  5C4X C;  1INN A;  1DCP A;  1TWH C;  2A69 A;  1SFO C;  2Y0S D;  1TWH A;  3K7A C;  4Y7N K;  3S2H C;  2WAQ D;  5IP9 C;  2ZFZ A;  4C2M C;  3GTK C;  4A3I C;  1XXB A;  4A93 C;  2NVT K;  2B63 K;  4YFX A;  4QJV B;  1DCH A;  2JH3 A;  4A3G C;  2GAG C;  3HOW C;  3RZD C;  3NUH A;  1I3Q A;  3WOD A;  4C3J C;  4ZH4 A;  5IYC C;  4A3J K;  5C44 K;  3S14 C;  5TMF A;  1Y1V C;  4PAB A;  3HOW K;  1I50 K;  4A3E C;  3BP8 C;  3MML B;  4P5B A;  1EH1 A;  2R92 C;  1I6H C;  4PAA A;  3I4M K;  1I3Q K;  3BP3 A;  4QJV A;  3S1N C;  1I50 C;  4A3E K;  3SZY A;  1RU0 A;  1YX2 A;  3S17 K;  3GTL K;  4GTC A;  3M4O C;  3AH5 A;  3S1Q C;  4KMD A;  1XZQ A;  4A3D K;  1L0W A;  1TWC A;  1ZBS A;  4AH6 A;  2GAH C;  3S17 C;  4P9S A;  4BY7 C;  1UV7 A;  5M5X K;  2NVY C;  4XCH A;  2A6H A;  2Y3P A;  3ADA C;  4GZY A;  4KC6 A;  2JA6 C;  1TWC K;  2NVY K;  2R92 A;  1VRQ C;  2PPB A;  2B63 A;  3LPX A;  1BGW A;  1R9T C;  1ZYR A;  5D4D A;  3CAG A;  5IYD C;  1USM A;  2NVY A;  3PO2 C;  3VA7 A;  4A3B C;  4YFN A;  4BY1 C;  1PJ5 A;  1YNJ A;  1F7U A;  1I50 A;  2W7V A;  3OEP A;  1WOP A;  4XSZ A;  3HOU C;  3A8K A;  5JVO A;  2V6S A;  2E2J C;  3IPJ A;  1Y1W C;  4KM9 A;  1Y1V K;  1O25 A;  4LR2 A;  2JA8 C;  2B63 C;  1USO A;  5C4J C;  4ILD A;  3GTP A;  3GTK A;  4Y52 K;  3FOE A;  4LJZ A;  1I6H K;  4KDD A;  4G7Z A;  5TJ3 A;  2JA8 K;  1EI6 A;  5IYC K;  4FM9 A;  4Q5S A;  4X6A C;  3S15 K;  3A8I A;  2GSO A;  1IW7 A;  4GTA A;  4BKW A;  2R92 K;  3FOF A;  2WAQ L;  4MEY A;  2V6T A;  1KQ4 A;  1PJ6 A;  1TWA A;  3FKI A;  3S1Q K;  4A3F C;  3JST A;  3S1M K;  2RH6 A;  3OPF A;  3GDZ A;  4YG2 A;  4LK0 A;  2V6U A;  4BY7 K;  2JA7 A;  2VUM C;  2CFA B;  1O28 A;  4GTD A;  2GSU A;  1R9T K;  5IP7 C;  2E2H C;  3S0X A;  4XLP A;  5M5W K;  3V4G A;  4C3I C;  5FJ8 K;  1IL2 A;  4BY1 K;  1SMY A;  3LAJ A;  1DD5 A;  1TWH K;  5IP7 K;  2E2H K;  3GTO K;  2KWA A;  3G4C A;  4FZB A;  4G0V A;  5IYD K;  4C3I K;  3HOZ K;  1BJT A;  4BXX K;  2NVX A;  1F7V A;  1YCL A;  1J6V A;  4A3M K;  4A3L K;  4A3I K;  2R7Z A;  4A93 K;  2CFA A;  4BLB A;  3HOZ C;  4LQY A;  2NVQ C;  4NOI A;  4A3M C;  4A3L C;  3S1R C;  1O27 A;  3Q3Q A;  5C4J K;  3AQP A;  5EGE A;  3TFH A;  4KMU A;  5EGH A;  2ZUF A;  3N0B A;  3I4M C;  4WJ4 A;  4KAT A;  1IE0 A;  4RMF A;  3S15 C;  2PHC B;  3AD7 C;  3GTG A;  3ERE D;  2PA8 D;  3L4K A;  1IBA A;  5C3E K;  3H0G A;  1EQR A;  2RGR A;  4Y52 C;  3GTQ K;  5TMC A;  1F93 A;  2XCQ A;  3M4O K;  4WIL A;  1O29 A;  4BBR K;  2CW0 A;  5CJ9 A;  1O2F B;  4GT9 A;  2P8T A;  3TTG A;  3TFI A;  1TWG C;  2PA8 L;  1JOE A;  4JK1 A;  4Q4Z A;  4BBR C;  1TWA K;  2JA6 K;  1WOO A;  1XXC A;  1J6W A;  1WQG A;  2VUM K;  1B4A A;  5HL8 A;  2P5M A;  4GTF A;  1ZQ1 C;  4A3F K;  4GFQ A;  2PMZ D;  3TFJ A;  1EK8 A;  1O2B A;  1YNN A;  3CQZ A;  4C3H K;  3GTM C;  1F9N A;  5IOR A;  3QX3 A;  1K83 A;  1XZP A;  1J6X A;  2WB1 D;  3T02 A;  4C45 A;  1WQF A;  3H0G C;  1HI9 A;  3GTG K;  3GTM K;  3GIR A;  3HOU K;  1WQH A;  1V5V A;  3PO3 K;  3GTG C;  4A3C K;  3T00 A;  3GTO C;  4KAW X;  3I4N C;  4KB2 A;  4KB4 A;  1ZXO A;  2NVQ K;  4LLG A;  1BDF A;  1X31 C;  4XSX A;  5CHP A;  4WJ3 M;  4A3C C;  1AB4 A;  2JA7 K;  3BUE A;  5IYB K;  4MEX A;  1G51 A;  2R7Z C;  2A6E A;  1K83 C;  4QIW L;  5JFE A;  1O2A A;  4GTB A;  1K83 K;  5FLM K;  2JA5 K;  5IP9 K;  2Y0S L;  4KN7 A;  5IOS A;  3T01 A;  2ZUE A;  1J98 A;  4YFK A;  1TWG A;  3GEE A;  3RZD K;  4KAR A;  2VUM A;  3S1M C;  1PJ7 A;  1XZP B;  3HOX K;  5M5Y K;  4LK1 A;  2R93 A;  5C44 C;  4OIR A;  3S14 K;  4LOW A;  2E2H A;  2FQO A;  1TWG K;  1VLO A;  4GTL A;  3AQO A;  3H3V L;  1TWF A;  1DCO A;  4BLA A; 
#chains in the Genus database with same CATH homology
 2O5I A;  4Y52 C;  5TMC A;  1I3Q C;  2E2J C;  3M4O K;  3CQZ K;  4OIQ A;  4OIP A;  2WB1 L;  2JA7 C;  3H0G K;  4QIW D;  4BBR K;  2CW0 A;  5C4X K;  1Y1W C;  3M3Y C;  1TWF K;  2O5J A;  2YU9 K;  2BE5 A;  4MQ9 A;  1Y1V K;  4OIN A;  3FKI C;  3RZO K;  4A3K K;  2JA8 C;  4BXX C;  3CQZ C;  1TWG C;  2B63 C;  4BBS K;  3GTJ K;  4A3B K;  2PA8 L;  4JK1 A;  4C2M K;  5C4J C;  4AYB L;  3GTP K;  4Q4Z A;  3GTK K;  3HOY C;  4BBR C;  3M3Y K;  1TWA K;  2A69 A;  1TWH C;  2JA6 K;  1SFO C;  4Y52 K;  5C4X C;  3EQL A;  4LJZ A;  2VUM K;  3I4N K;  1I6H K;  4G7Z A;  2Y0S D;  3K7A C;  4Y7N K;  4A3K C;  2JA8 K;  5IYC K;  4Q5S A;  3S2H C;  2WAQ D;  4X6A C;  5IP9 C;  3HKZ L;  3GTK C;  3S15 K;  1HQM A;  4A3I C;  4A3F K;  2PMZ D;  4A93 C;  3S1R K;  1IW7 A;  1YNN A;  4C3H K;  4YFX A;  4QJV B;  5M3M K;  2B63 K;  2NVT K;  3GTM C;  3S16 K;  2NVX C;  2R92 K;  4A3G C;  3HOW C;  3RZD C;  2WAQ L;  1SFO K;  4MEY A;  2WB1 D;  3WOD A;  3GTQ K;  2R7Z K;  3H0G C;  3GTG K;  2PMZ L;  4ZH4 A;  5IYC C;  4A3J K;  3GTM K;  3S2H K;  5C44 K;  3HOU K;  5TMF A;  2NVX K;  3S14 C;  1Y1V C;  2R93 K;  3FKI K;  5M3F K;  3HKZ D;  3HOW K;  1I50 K;  4A3E C;  3S1Q K;  4A3F C;  3GTJ C;  3S1M K;  3PO3 K;  3DXJ A;  2NVT C;  3HOY K;  4YG2 A;  2E2I K;  3GTG C;  4A3C K;  4LK0 A;  5C3E C;  3GTQ C;  4BY7 K;  2R92 C;  5IYB C;  3GTO C;  2VUM C;  3I4N C;  3I4M K;  1I3Q K;  4QJV A;  4A3G K;  1I6H C;  2R93 C;  3K7A K;  4Y7N C;  2NVQ K;  3S1N C;  1I50 C;  4A3E K;  4LLG A;  1R9T K;  4XLN A;  1BDF A;  4XSX A;  5IP7 C;  2E2H C;  4A3J C;  3HOV K;  3S17 K;  3GTL K;  2E2I C;  4XLP A;  4A3C C;  5M5W K;  5FJ8 K;  2E2J K;  3M4O C;  3S1Q C;  4BY1 K;  4A3D K;  2A68 A;  1SMY A;  2JA7 K;  3HOX C;  5FLM C;  2JA5 C;  1TWA C;  1Y1W K;  1TWH K;  5IP7 K;  2E2H K;  3HOV C;  5IYB K;  1I6V A;  4C3J K;  4MEX A;  3GTO K;  3S17 C;  4BY7 C;  5M5X K;  2NVY C;  2R7Z C;  2A6E A;  5IYD K;  3S1N K;  4C3I K;  1K83 C;  3HOZ K;  4BXX K;  4G7O A;  2A6H A;  4QIW L;  4OIO A;  4A3M K;  4GZY A;  4A3L K;  2JA6 C;  4A3I K;  1TWC K;  4A93 K;  4KN4 A;  2NVY K;  1K83 K;  3HOZ C;  3H3V D;  5FLM K;  2JA5 K;  4X6A K;  5IP9 K;  2PPB A;  2YU9 C;  2NVQ C;  4NOI A;  2Y0S L;  4A3M C;  4A3L C;  4KN7 A;  1R9T C;  1ZYR A;  3RZO C;  5D4D A;  5IYD C;  3S1R C;  3PO2 C;  3GTL C;  4YFK A;  1WCM K;  5C4J K;  3GTP C;  4A3B C;  4YFN A;  3RZD K;  1TWC C;  4BY1 C;  4A3D C;  1YNJ A;  3PO3 C;  3S1M C;  3S2D K;  4KMU A;  3HOX K;  5M5Y K;  4LK1 A;  1TWF C;  4XSZ A;  4AYB D;  5C44 C;  1XPP A;  4OIR A;  1WCM C;  3HOU C;  3I4M C;  3S14 K;  3S15 C;  1TWG K;  2PA8 D;  4BBS C;  3H3V L;  3S2D C;  3PO2 K;  3S16 C;  4G7H A;  5C3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...