3RZOK

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzoK00
3S14C 5IYBC 4C3HK 4QIWL 4Q4ZA 3HOYC 3GTOC 1YNNA 4QJVB 4JK1A 4A3LC 2B63C 3GTGK 4A3EC 4A3IC 2NVXK 2JA6C 4XSXA 2CW0A 2JA7K 3GTMC 2R92C 5FJ8K 1TWAK 4A3GC 3HKZD 3K7AK 3S1RC 4OIPA 1SMYA 4A3DC 4YG2A 3GTJC 1R9TC 2R93C 2A6HA 3EQLA 1TWCK 4KN7A 2JA5C 3HOZK 3I4NK 3S15K 4A3BK 3RZDC 2E2IK 3GTLC 2O5JA 1WCMK 2WAQL 4BY1K 4OIQA 4AYBL 3I4MC 3S1NC 2A69A 2JA8C 4Q5SA 4LK1A 5C4JK 5C4XK 5IP7C 2PMZL 2NVQC 3S16K 1YNJA 2NVTK 5IP9K 3GTGC 4X6AK 3GTKK 1Y1VC 1IW7A 4Y52C 2JA7C 3S17K 4BXXK 3S2DK 3M4OK 1TWAC 4MEXA 2PMZD 4YFKA 1ZYRA 5FLMK 5C3EC 4ZH4A 4QJVA 1TWGK 3CQZC 1TWCC 3HOZC 2E2JK 3S15C 4A3BC 4QIWD 3PO2K 3I4NC 2E2IC 4G7ZA 2NVYC 5D4DA 4BY1C 3HOUK 4C3JK 3GTQC 1TWFK 4G7HA 1SFOK 5C4JC 1I6VA 1I50K 5M5YK 5C4XC 3M3YK 4BBSK 4BY7K 3HOWK 1HQMA 3HOVK 1I3QK 4KN4A 1K83K 5M5XK 3GTKC 4X6AC 4A3CK 4A93K 4YFXA 3HOXK 4BXXC 2WAQD 3S2DC 4BBRK 3M4OC 4C3IK 4A3FK 1TWHK 3S1QK 5FLMC 4XLPA 4A3JK 4AYBD 2NVXC 5M3FK 3S1MK 5C44K 3GTOK 3DXJA 3K7AC 2E2JC 3PO2C 4A3EK 2WB1L 3GTMK 2R7ZK 3S2HK 4A3MK 2R92K 3HOUC 1BDFA 2YU9K 1I6HK 1TWFC 1Y1WK 3PO3K 3S1RK 1SFOC 5IYDK 1WCMC 3H0GK 3GTPK 1I50C 2R93K 2Y0SL 5TMFA 4OINA 2PPBA 4XSZA 3M3YC 4BBSC 2WB1D 3HOWC 3RZOK 3RZDK 3GTLK 1I3QC 3HOVC 1K83C 2VUMK 3S16C 4LLGA 3HOXC 4BBRC 4Y7NK 2O5IA 2NVTC 5IP9C 1TWHC 4A3FC 4MQ9A 4A3JC 2E2HK 3FKIK 5IYCK 5IP7K 3HKZL 2NVQK 3S1MC 5C44C 3S17C 4A3KK 4LJZA 1Y1VK 4MEYA 4OIRA 3GTQK 3S14K 5IYBK 4Y52K 2R7ZC 1TWGC 4YFNA 3S2HC 4A3MC 3HOYK 2YU9C 1I6HC 1Y1WC 4A3LK 2B63K 5C3EK 3WODA 3PO3C 5IYDC 3H0GC 4A3IK 3GTPC 2JA6K 2A6EA 3CQZK 2A68A 4A3GK 3RZOC 3S1QC 2NVYK 3H3VL 2VUMC 5M5WK 4KMUA 4A3DK 2PA8L 3GTJK 1R9TK 4NOIA 2BE5A 4GZYA 4BY7C 4Y7NC 2JA5K 2E2HC 1XPPA 3FKIC 5IYCC 4OIOA 4C2MK 4A3CC 4A93C 5M3MK 3H3VD 4A3KC 2PA8D 3I4MK 3S1NK 2Y0SD 4LK0A 4XLNA 4G7OA 2JA8K 5TMCA
chains in the Genus database with same CATH superfamily
4QJVB 3VA7A 4A3IC 3GTMC 4XCHA 3GTOA 2R92C 3S0XA 2ZUEA 2R7ZA 1USOA 3OREA 3TFJA 4A3DC 3TTGA 1WOSA 1R9TC 1TWCK 2JA5C 3S15K 3RZDC 4C2MC 3IPJA 1XZQB 1WOOA 4BY1K 3GTLA 3I4MC 3A8KA 3S1NC 1O24A 2JA8C 4LK1A 3FOFA 5C4XK 2PMZL 4KMHA 2E2HA 3FKIA 3GTGC 2JA7C 1ZXOA 3GIRA 3GTQA 4QJVA 2GAHC 4M1XA 3HOZC 3I4NC 2NVYC 2GSUA 5IOSA 3HOUK 3GTJA 1O29A 3HOWK 1XZQA 3L4KA 5M5XK 4X6AC 3GTKC 4A93K 3HOXK 3CAGA 4C3IK 3L4JA 2GSOA 1TWHK 3N3YA 4XLPA 1J6VA 3S1MK 3OPFA 4GTAA 2P5MA 3T00A 2WB1L 3GTMK 1J98A 2R92K 4G0UA 4C3JC 1TWFC 3PO3K 3H0GK 1TWCA 5TMFA 4OINA 3RZDK 3HOVC 1K83C 1O26A 3BP3A 3S16C 4LLGA 2O5IA 2NVTC 5IP9C 4A3FC 4MQ9A 5IYCK 1VLOA 3S17C 3SZYA 1Y1VK 3G4CA 4MEYA 3S14K 5IYBK 1TWGC 1F7UA 1Y1WC 1V5VA 4LQYA 3GSIA 1WOPA 2NVYK 1WORA 4KMUA 2BE5A 4GZYA 1YCLA 4BLAA 3LPXA 2VUMA 5CHPA 2RH6A 4A3KC 4KASA 1IS1A 4LK0A 2W7VA 5TMCA 2FQTA 4C3HK 1TWHA 1YNNA 5IOQA 4A3LC 2B63C 2PHCB 4GTDA 2JA6C 2CW0A 3A8IA 3GTMA 3QX3A 4GFQA 2R92A 2R93C 3FOEA 3EQLA 4KN7A 4GTCA 1ZBSA 2O5JA 3H0GA 2E2IK 4KAWX 1R9TA 4OIQA 3AD8C 2NVQC 3S16K 1YNJA 2NVTK 5IP9K 1PJ7A 1WQHA 4KM8A 3S17K 5EGHA 4BXXK 3S2DK 1Y1VA 1TWAC 2FQOA 3M4OK 1ZYRA 1TWGK 3CQZC 2E2JK 4A3BC 4GTBA 3PO2K 5D4DA 1WQFA 2NVYA 5C4JC 5M5YK 1F7VA 1I3QK 4LR2A 2WAQD 1DCHA 5FLMC 4AYBD 2NVXC 4KM9A 5C44K 3DXJA 3K7AC 1O25A 4KB2A 3S2HK 4A3MK 1IE0A 2YU9K 1SFOC 5IYDK 1WCMC 3GTPK 1INNA 1I50C 2R93K 3M3YC 4BBSC 2E2IA 3RZOK 2VUMK 1WSRA 3TFIA 4KDDA 4BBRC 4Y7NK 1DCPA 5HL8A 4A3JC 2NVQK 4FZBA 1EK8A 4LJZA 1EFWA 5JVOA 2R7ZC 1I6HC 3A8JA 1TWGA 4A3IK 2A6EA 2GAGC 3CQZK 1DCOA 3SZZA 1XXCA 4A3DK 1R9TK 4ILDA 4BY7C 2ZFZA 2JA5K 2KWAA 4BKWA 2E2HC 3FKIC 1O27A 3AD9C 4C2MK 4A3CC 3ADAC 5M3MK 4LOWA 3H3VD 2PA8D 1I3QA 3I4MK 3S1NK 3S1QC 2JA8K 3GTQC 3AD7C 4GTLA 4G0VA 3HOYC 3GTGK 2NVXK 2JA7K 1PJ5A 4GTEA 4A3GC 3K7AK 3S1RC 1SMYA 1XXBA 3GTJC 2A6HA 2YU9A 1L0WA 1XZPB 3HOZK 3I4NK 3GTPA 1WCMK 1KQ4A 2WAQL 2R93A 2V6SA 1IL2A 4AYBL 3NUHA 4KATA 4Q5SA 5IP7C 1GE9A 4X6AK 3GTKK 4Y52C 1ISEA 1VRQC 4J3NA 3T02A 4MEXA 2PMZD 5JFEA 1VJEA 3MMLB 4ZH4A 1BS2A 4KC6A 2JH3A 1TWCC 3S15C 1B4BA 4QIWD 3CQZA 4BY1C 4RMFA 4C3JK 1TWFK 1XZPA 1I6VA 2XCQA 5C4XC 2JA5A 4BY7K 1HQMA 1JOEA 3HOVK 1DD5A 4KN4A 1K83K 4WJ4A 5EGEA 4A3CK 1IBAA 3G4AA 4KARA 4G0WA 4KB4A 4A3FK 1O2FB 3S1QK 5M3FK 3GTGA 2NVXA 1O2AA 2JA7A 4FM9A 1J6WA 3HOUC 3AH5A 1Y1WK 1EI6A 3S1RK 2PPBA 2Y3PA 3LAJA 2WB1D 3HOWC 1WCMA 3HOXC 4C3IC 1TWHC 1RU0A 3Q3QA 3GEIA 5IP7K 3S1MC 4KMAA 1HI9A 4A3KK 5TJ3A 3GTKA 4OIRA 4Y52K 3GEHA 4YFNA 5IOTA 1BGWA 4A3LK 2B63K 3PO3C 1F93A 3WODA 3H0GC 2JA6K 4KMDA 4BLBA 3JSTA 4GT9A 3FHZA 1ZVUA 4P9SA 4NOIA 1ZQ1C 1TWFA 5L46A 3AQPA 5IYCC 4OIOA 4C45A 4PAAA 4AH6A 4G7OA 1J6XA 2Y0SD 1Y1VC 1K83A 3ERED 3S14C 5IYBC 4QIWL 3GEEA 1WIHA 4Q4ZA 3GTOC 4JK1A 4A3EC 4P5AA 4XSXA 5FJ8K 1TWAK 3HKZD 3HXAA 1O28A 4OIPA 1WSVA 4YG2A 4DDQA 1Y1WA 4A3BK 1EH1A 3GTLC 1YX2A 3T01A 1X31C 4P5BA 2A69A 5C4JK 4C3HC 1BJTA 1JQWA 2XCOA 2D6FC 5CJ9A 1F9NA 4O2DA 1IW7A 1PJ6A 2V6UA 4YFKA 5FLMK 5C3EC 3LAPA 1G51A 4PABA 2B63A 1JVIA 3BUEA 2E2IC 4G7ZA 2JA6A 2GSNA 3BP8C 4G7HA 1SFOK 1I50K 3M3YK 4BBSK 1VH2A 3OEPA 4YFXA 4BXXC 2P8TA 3S2DC 4BBRK 3M4OC 3N0BA 4A3JK 3V4GA 1XXAA 1WQGA 3GTOK 2E2JC 1IQ0A 3PO2C 4A3EK 2R7ZK 1TWAA 1BDFA 1I6HK 4WJ3M 3N0CA 5IORA 2Y0SL 1C0AA 2EBBA 4XSZA 2RGRA 2CFAB 3GTLK 1I3QC 3TFHA 1O2BA 5E68A 3AQOA 2E2HK 1B4AA 3FKIK 1UV7A 3HKZL 5C44C 1USMA 3GTQK 1VGXA 4GTFA 3S2HC 1EQRA 4A3MC 3HOYK 2YU9C 4WILA 5C3EK 5IYDC 3GTPC 2XCRB 3GDZA 2A68A 4A3GK 3RZOC 2ZUFA 3H3VL 2VUMC 5M5WK 2PA8L 3GTJK 1AB4A 4Y7NC 1SFOA 2V6TA 1I50A 1XPPA 2CFAA 4A93C 4XLNA
chains in the Genus database with same CATH topology
3S14C 5IYBC 4C3HK 4QIWL 4Q4ZA 3HOYC 3GTOC 1YNNA 4QJVB 4JK1A 4A3LC 2B63C 3GTGK 4A3EC 4A3IC 2NVXK 2JA6C 4XSXA 2CW0A 2JA7K 3GTMC 2R92C 5FJ8K 1TWAK 4A3GC 3HKZD 3K7AK 3S1RC 4OIPA 1SMYA 4A3DC 4YG2A 3GTJC 1R9TC 2R93C 2A6HA 3EQLA 1TWCK 4KN7A 2JA5C 3HOZK 3I4NK 3S15K 4A3BK 3RZDC 2E2IK 3GTLC 2O5JA 1WCMK 2WAQL 4BY1K 4OIQA 4AYBL 3I4MC 3S1NC 2A69A 2JA8C 4Q5SA 4LK1A 5C4JK 5C4XK 5IP7C 2PMZL 2NVQC 3S16K 1YNJA 2NVTK 5IP9K 3GTGC 4X6AK 3GTKK 1Y1VC 1IW7A 4Y52C 2JA7C 3S17K 4BXXK 3S2DK 3M4OK 1TWAC 4MEXA 2PMZD 4YFKA 1ZYRA 5FLMK 5C3EC 4ZH4A 4QJVA 1TWGK 3CQZC 1TWCC 3HOZC 2E2JK 3S15C 4A3BC 4QIWD 3PO2K 3I4NC 2E2IC 4G7ZA 2NVYC 5D4DA 4BY1C 3HOUK 4C3JK 3GTQC 1TWFK 4G7HA 1SFOK 5C4JC 1I6VA 1I50K 5M5YK 5C4XC 3M3YK 4BBSK 4BY7K 3HOWK 1HQMA 3HOVK 1I3QK 4KN4A 1K83K 5M5XK 3GTKC 4X6AC 4A3CK 4A93K 4YFXA 3HOXK 4BXXC 2WAQD 3S2DC 4BBRK 3M4OC 4C3IK 4A3FK 1TWHK 3S1QK 5FLMC 4XLPA 4A3JK 4AYBD 2NVXC 5M3FK 3S1MK 5C44K 3GTOK 3DXJA 3K7AC 2E2JC 3PO2C 4A3EK 2WB1L 3GTMK 2R7ZK 3S2HK 4A3MK 2R92K 3HOUC 1BDFA 2YU9K 1I6HK 1TWFC 1Y1WK 3PO3K 3S1RK 1SFOC 5IYDK 1WCMC 3H0GK 3GTPK 1I50C 2R93K 2Y0SL 5TMFA 4OINA 2PPBA 4XSZA 3M3YC 4BBSC 2WB1D 3HOWC 3RZOK 3RZDK 3GTLK 1I3QC 3HOVC 1K83C 2VUMK 3S16C 4LLGA 3HOXC 4BBRC 4Y7NK 2O5IA 2NVTC 5IP9C 1TWHC 4A3FC 4MQ9A 4A3JC 2E2HK 3FKIK 5IYCK 5IP7K 3HKZL 2NVQK 3S1MC 5C44C 3S17C 4A3KK 4LJZA 1Y1VK 4MEYA 4OIRA 3GTQK 3S14K 5IYBK 4Y52K 2R7ZC 1TWGC 4YFNA 3S2HC 4A3MC 3HOYK 2YU9C 1I6HC 1Y1WC 4A3LK 2B63K 5C3EK 3WODA 3PO3C 5IYDC 3H0GC 4A3IK 3GTPC 2JA6K 2A6EA 3CQZK 2A68A 4A3GK 3RZOC 3S1QC 2NVYK 3H3VL 2VUMC 5M5WK 4KMUA 4A3DK 2PA8L 3GTJK 1R9TK 4NOIA 2BE5A 4GZYA 4BY7C 4Y7NC 2JA5K 2E2HC 1XPPA 3FKIC 5IYCC 4OIOA 4C2MK 4A3CC 4A93C 5M3MK 3H3VD 4A3KC 2PA8D 3I4MK 3S1NK 2Y0SD 4LK0A 4XLNA 4G7OA 2JA8K 5TMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 C;  5IYB C;  4C3H K;  4QIW L;  4Q4Z A;  3HOY C;  3GTO C;  1YNN A;  4QJV B;  4JK1 A;  4A3L C;  2B63 C;  3GTG K;  4A3E C;  4A3I C;  2NVX K;  2JA6 C;  4XSX A;  2CW0 A;  2JA7 K;  3GTM C;  2R92 C;  5FJ8 K;  1TWA K;  4A3G C;  3HKZ D;  3K7A K;  3S1R C;  4OIP A;  1SMY A;  4A3D C;  4YG2 A;  3GTJ C;  1R9T C;  2R93 C;  2A6H A;  3EQL A;  1TWC K;  4KN7 A;  2JA5 C;  3HOZ K;  3I4N K;  3S15 K;  4A3B K;  3RZD C;  2E2I K;  3GTL C;  2O5J A;  1WCM K;  2WAQ L;  4BY1 K;  4OIQ A;  4AYB L;  3I4M C;  3S1N C;  2A69 A;  2JA8 C;  4Q5S A;  4LK1 A;  5C4J K;  5C4X K;  5IP7 C;  2PMZ L;  2NVQ C;  3S16 K;  1YNJ A;  2NVT K;  5IP9 K;  3GTG C;  4X6A K;  3GTK K;  1Y1V C;  1IW7 A;  4Y52 C;  2JA7 C;  3S17 K;  4BXX K;  3S2D K;  3M4O K;  1TWA C;  4MEX A;  2PMZ D;  4YFK A;  1ZYR A;  5FLM K;  5C3E C;  4ZH4 A;  4QJV A;  1TWG K;  3CQZ C;  1TWC C;  3HOZ C;  2E2J K;  3S15 C;  4A3B C;  4QIW D;  3PO2 K;  3I4N C;  2E2I C;  4G7Z A;  2NVY C;  5D4D A;  4BY1 C;  3HOU K;  4C3J K;  3GTQ C;  1TWF K;  4G7H A;  1SFO K;  5C4J C;  1I6V A;  1I50 K;  5M5Y K;  5C4X C;  3M3Y K;  4BBS K;  4BY7 K;  3HOW K;  1HQM A;  3HOV K;  1I3Q K;  4KN4 A;  1K83 K;  5M5X K;  3GTK C;  4X6A C;  4A3C K;  4A93 K;  4YFX A;  3HOX K;  4BXX C;  2WAQ D;  3S2D C;  4BBR K;  3M4O C;  4C3I K;  4A3F K;  1TWH K;  3S1Q K;  5FLM C;  4XLP A;  4A3J K;  4AYB D;  2NVX C;  5M3F K;  3S1M K;  5C44 K;  3GTO K;  3DXJ A;  3K7A C;  2E2J C;  3PO2 C;  4A3E K;  2WB1 L;  3GTM K;  2R7Z K;  3S2H K;  4A3M K;  2R92 K;  3HOU C;  1BDF A;  2YU9 K;  1I6H K;  1TWF C;  1Y1W K;  3PO3 K;  3S1R K;  1SFO C;  5IYD K;  1WCM C;  3H0G K;  3GTP K;  1I50 C;  2R93 K;  2Y0S L;  5TMF A;  4OIN A;  2PPB A;  4XSZ A;  3M3Y C;  4BBS C;  2WB1 D;  3HOW C;  3RZO K;  3RZD K;  3GTL K;  1I3Q C;  3HOV C;  1K83 C;  2VUM K;  3S16 C;  4LLG A;  3HOX C;  4BBR C;  4Y7N K;  2O5I A;  2NVT C;  5IP9 C;  1TWH C;  4A3F C;  4MQ9 A;  4A3J C;  2E2H K;  3FKI K;  5IYC K;  5IP7 K;  3HKZ L;  2NVQ K;  3S1M C;  5C44 C;  3S17 C;  4A3K K;  4LJZ A;  1Y1V K;  4MEY A;  4OIR A;  3GTQ K;  3S14 K;  5IYB K;  4Y52 K;  2R7Z C;  1TWG C;  4YFN A;  3S2H C;  4A3M C;  3HOY K;  2YU9 C;  1I6H C;  1Y1W C;  4A3L K;  2B63 K;  5C3E K;  3WOD A;  3PO3 C;  5IYD C;  3H0G C;  4A3I K;  3GTP C;  2JA6 K;  2A6E A;  3CQZ K;  2A68 A;  4A3G K;  3RZO C;  3S1Q C;  2NVY K;  3H3V L;  2VUM C;  5M5W K;  4KMU A;  4A3D K;  2PA8 L;  3GTJ K;  1R9T K;  4NOI A;  2BE5 A;  4GZY A;  4BY7 C;  4Y7N C;  2JA5 K;  2E2H C;  1XPP A;  3FKI C;  5IYC C;  4OIO A;  4C2M K;  4A3C C;  4A93 C;  5M3M K;  3H3V D;  4A3K C;  2PA8 D;  3I4M K;  3S1N K;  2Y0S D;  4LK0 A;  4XLN A;  4G7O A;  2JA8 K;  5TMC A; 
#chains in the Genus database with same CATH topology
 4QJV B;  3VA7 A;  4A3I C;  3GTM C;  4XCH A;  3GTO A;  2R92 C;  3S0X A;  2ZUE A;  2R7Z A;  1USO A;  3ORE A;  3TFJ A;  4A3D C;  3TTG A;  1WOS A;  1R9T C;  1TWC K;  2JA5 C;  3S15 K;  3RZD C;  4C2M C;  3IPJ A;  1XZQ B;  1WOO A;  4BY1 K;  3GTL A;  3I4M C;  3A8K A;  3S1N C;  1O24 A;  2JA8 C;  4LK1 A;  3FOF A;  5C4X K;  2PMZ L;  4KMH A;  2E2H A;  3FKI A;  3GTG C;  2JA7 C;  1ZXO A;  3GIR A;  3GTQ A;  4QJV A;  2GAH C;  4M1X A;  3HOZ C;  3I4N C;  2NVY C;  2GSU A;  5IOS A;  3HOU K;  3GTJ A;  1O29 A;  3HOW K;  1XZQ A;  3L4K A;  5M5X K;  4X6A C;  3GTK C;  4A93 K;  3HOX K;  3CAG A;  4C3I K;  3L4J A;  2GSO A;  1TWH K;  3N3Y A;  4XLP A;  1J6V A;  3S1M K;  3OPF A;  4GTA A;  2P5M A;  3T00 A;  2WB1 L;  3GTM K;  1J98 A;  2R92 K;  4G0U A;  4C3J C;  1TWF C;  3PO3 K;  3H0G K;  1TWC A;  5TMF A;  4OIN A;  3RZD K;  3HOV C;  1K83 C;  1O26 A;  3BP3 A;  3S16 C;  4LLG A;  2O5I A;  2NVT C;  5IP9 C;  4A3F C;  4MQ9 A;  5IYC K;  1VLO A;  3S17 C;  3SZY A;  1Y1V K;  3G4C A;  4MEY A;  3S14 K;  5IYB K;  1TWG C;  1F7U A;  1Y1W C;  1V5V A;  4LQY A;  3GSI A;  1WOP A;  2NVY K;  1WOR A;  4KMU A;  2BE5 A;  4GZY A;  1YCL A;  4BLA A;  3LPX A;  2VUM A;  5CHP A;  2RH6 A;  4A3K C;  4KAS A;  1IS1 A;  4LK0 A;  2W7V A;  5TMC A;  2FQT A;  4C3H K;  1TWH A;  1YNN A;  5IOQ A;  4A3L C;  2B63 C;  2PHC B;  4GTD A;  2JA6 C;  2CW0 A;  3A8I A;  3GTM A;  3QX3 A;  4GFQ A;  2R92 A;  2R93 C;  3FOE A;  3EQL A;  4KN7 A;  4GTC A;  1ZBS A;  2O5J A;  3H0G A;  2E2I K;  4KAW X;  1R9T A;  4OIQ A;  3AD8 C;  2NVQ C;  3S16 K;  1YNJ A;  2NVT K;  5IP9 K;  1PJ7 A;  1WQH A;  4KM8 A;  3S17 K;  5EGH A;  4BXX K;  3S2D K;  1Y1V A;  1TWA C;  2FQO A;  3M4O K;  1ZYR A;  1TWG K;  3CQZ C;  2E2J K;  4A3B C;  4GTB A;  3PO2 K;  5D4D A;  1WQF A;  2NVY A;  5C4J C;  5M5Y K;  1F7V A;  1I3Q K;  4LR2 A;  2WAQ D;  1DCH A;  5FLM C;  4AYB D;  2NVX C;  4KM9 A;  5C44 K;  3DXJ A;  3K7A C;  1O25 A;  4KB2 A;  3S2H K;  4A3M K;  1IE0 A;  2YU9 K;  1SFO C;  5IYD K;  1WCM C;  3GTP K;  1INN A;  1I50 C;  2R93 K;  3M3Y C;  4BBS C;  2E2I A;  3RZO K;  2VUM K;  1WSR A;  3TFI A;  4KDD A;  4BBR C;  4Y7N K;  1DCP A;  5HL8 A;  4A3J C;  2NVQ K;  4FZB A;  1EK8 A;  4LJZ A;  1EFW A;  5JVO A;  2R7Z C;  1I6H C;  3A8J A;  1TWG A;  4A3I K;  2A6E A;  2GAG C;  3CQZ K;  1DCO A;  3SZZ A;  1XXC A;  4A3D K;  1R9T K;  4ILD A;  4BY7 C;  2ZFZ A;  2JA5 K;  2KWA A;  4BKW A;  2E2H C;  3FKI C;  1O27 A;  3AD9 C;  4C2M K;  4A3C C;  3ADA C;  5M3M K;  4LOW A;  3H3V D;  2PA8 D;  1I3Q A;  3I4M K;  3S1N K;  3S1Q C;  2JA8 K;  3GTQ C;  3AD7 C;  4GTL A;  4G0V A;  3HOY C;  3GTG K;  2NVX K;  2JA7 K;  1PJ5 A;  4GTE A;  4A3G C;  3K7A K;  3S1R C;  1SMY A;  1XXB A;  3GTJ C;  2A6H A;  2YU9 A;  1L0W A;  1XZP B;  3HOZ K;  3I4N K;  3GTP A;  1WCM K;  1KQ4 A;  2WAQ L;  2R93 A;  2V6S A;  1IL2 A;  4AYB L;  3NUH A;  4KAT A;  4Q5S A;  5IP7 C;  1GE9 A;  4X6A K;  3GTK K;  4Y52 C;  1ISE A;  1VRQ C;  4J3N A;  3T02 A;  4MEX A;  2PMZ D;  5JFE A;  1VJE A;  3MML B;  4ZH4 A;  1BS2 A;  4KC6 A;  2JH3 A;  1TWC C;  3S15 C;  1B4B A;  4QIW D;  3CQZ A;  4BY1 C;  4RMF A;  4C3J K;  1TWF K;  1XZP A;  1I6V A;  2XCQ A;  5C4X C;  2JA5 A;  4BY7 K;  1HQM A;  1JOE A;  3HOV K;  1DD5 A;  4KN4 A;  1K83 K;  4WJ4 A;  5EGE A;  4A3C K;  1IBA A;  3G4A A;  4KAR A;  4G0W A;  4KB4 A;  4A3F K;  1O2F B;  3S1Q K;  5M3F K;  3GTG A;  2NVX A;  1O2A A;  2JA7 A;  4FM9 A;  1J6W A;  3HOU C;  3AH5 A;  1Y1W K;  1EI6 A;  3S1R K;  2PPB A;  2Y3P A;  3LAJ A;  2WB1 D;  3HOW C;  1WCM A;  3HOX C;  4C3I C;  1TWH C;  1RU0 A;  3Q3Q A;  3GEI A;  5IP7 K;  3S1M C;  4KMA A;  1HI9 A;  4A3K K;  5TJ3 A;  3GTK A;  4OIR A;  4Y52 K;  3GEH A;  4YFN A;  5IOT A;  1BGW A;  4A3L K;  2B63 K;  3PO3 C;  1F93 A;  3WOD A;  3H0G C;  2JA6 K;  4KMD A;  4BLB A;  3JST A;  4GT9 A;  3FHZ A;  1ZVU A;  4P9S A;  4NOI A;  1ZQ1 C;  1TWF A;  5L46 A;  3AQP A;  5IYC C;  4OIO A;  4C45 A;  4PAA A;  4AH6 A;  4G7O A;  1J6X A;  2Y0S D;  1Y1V C;  1K83 A;  3ERE D;  3S14 C;  5IYB C;  4QIW L;  3GEE A;  1WIH A;  4Q4Z A;  3GTO C;  4JK1 A;  4A3E C;  4P5A A;  4XSX A;  5FJ8 K;  1TWA K;  3HKZ D;  3HXA A;  1O28 A;  4OIP A;  1WSV A;  4YG2 A;  4DDQ A;  1Y1W A;  4A3B K;  1EH1 A;  3GTL C;  1YX2 A;  3T01 A;  1X31 C;  4P5B A;  2A69 A;  5C4J K;  4C3H C;  1BJT A;  1JQW A;  2XCO A;  2D6F C;  5CJ9 A;  1F9N A;  4O2D A;  1IW7 A;  1PJ6 A;  2V6U A;  4YFK A;  5FLM K;  5C3E C;  3LAP A;  1G51 A;  4PAB A;  2B63 A;  1JVI A;  3BUE A;  2E2I C;  4G7Z A;  2JA6 A;  2GSN A;  3BP8 C;  4G7H A;  1SFO K;  1I50 K;  3M3Y K;  4BBS K;  1VH2 A;  3OEP A;  4YFX A;  4BXX C;  2P8T A;  3S2D C;  4BBR K;  3M4O C;  3N0B A;  4A3J K;  3V4G A;  1XXA A;  1WQG A;  3GTO K;  2E2J C;  1IQ0 A;  3PO2 C;  4A3E K;  2R7Z K;  1TWA A;  1BDF A;  1I6H K;  4WJ3 M;  3N0C A;  5IOR A;  2Y0S L;  1C0A A;  2EBB A;  4XSZ A;  2RGR A;  2CFA B;  3GTL K;  1I3Q C;  3TFH A;  1O2B A;  5E68 A;  3AQO A;  2E2H K;  1B4A A;  3FKI K;  1UV7 A;  3HKZ L;  5C44 C;  1USM A;  3GTQ K;  1VGX A;  4GTF A;  3S2H C;  1EQR A;  4A3M C;  3HOY K;  2YU9 C;  4WIL A;  5C3E K;  5IYD C;  3GTP C;  2XCR B;  3GDZ A;  2A68 A;  4A3G K;  3RZO C;  2ZUF A;  3H3V L;  2VUM C;  5M5W K;  2PA8 L;  3GTJ K;  1AB4 A;  4Y7N C;  1SFO A;  2V6T A;  1I50 A;  1XPP A;  2CFA A;  4A93 C;  4XLN A; 
#chains in the Genus database with same CATH homology
 3S14 C;  5IYB C;  4C3H K;  4QIW L;  4Q4Z A;  3HOY C;  3GTO C;  1YNN A;  4QJV B;  4JK1 A;  4A3L C;  2B63 C;  3GTG K;  4A3E C;  4A3I C;  2NVX K;  2JA6 C;  4XSX A;  2CW0 A;  2JA7 K;  3GTM C;  2R92 C;  5FJ8 K;  1TWA K;  4A3G C;  3HKZ D;  3K7A K;  3S1R C;  4OIP A;  1SMY A;  4A3D C;  4YG2 A;  3GTJ C;  1R9T C;  2R93 C;  2A6H A;  3EQL A;  1TWC K;  4KN7 A;  2JA5 C;  3HOZ K;  3I4N K;  3S15 K;  4A3B K;  3RZD C;  2E2I K;  3GTL C;  2O5J A;  1WCM K;  2WAQ L;  4BY1 K;  4OIQ A;  4AYB L;  3I4M C;  3S1N C;  2A69 A;  2JA8 C;  4Q5S A;  4LK1 A;  5C4J K;  5C4X K;  5IP7 C;  2PMZ L;  2NVQ C;  3S16 K;  1YNJ A;  2NVT K;  5IP9 K;  3GTG C;  4X6A K;  3GTK K;  1Y1V C;  1IW7 A;  4Y52 C;  2JA7 C;  3S17 K;  4BXX K;  3S2D K;  3M4O K;  1TWA C;  4MEX A;  2PMZ D;  4YFK A;  1ZYR A;  5FLM K;  5C3E C;  4ZH4 A;  4QJV A;  1TWG K;  3CQZ C;  1TWC C;  3HOZ C;  2E2J K;  3S15 C;  4A3B C;  4QIW D;  3PO2 K;  3I4N C;  2E2I C;  4G7Z A;  2NVY C;  5D4D A;  4BY1 C;  3HOU K;  4C3J K;  3GTQ C;  1TWF K;  4G7H A;  1SFO K;  5C4J C;  1I6V A;  1I50 K;  5M5Y K;  5C4X C;  3M3Y K;  4BBS K;  4BY7 K;  3HOW K;  1HQM A;  3HOV K;  1I3Q K;  4KN4 A;  1K83 K;  5M5X K;  3GTK C;  4X6A C;  4A3C K;  4A93 K;  4YFX A;  3HOX K;  4BXX C;  2WAQ D;  3S2D C;  4BBR K;  3M4O C;  4C3I K;  4A3F K;  1TWH K;  3S1Q K;  5FLM C;  4XLP A;  4A3J K;  4AYB D;  2NVX C;  5M3F K;  3S1M K;  5C44 K;  3GTO K;  3DXJ A;  3K7A C;  2E2J C;  3PO2 C;  4A3E K;  2WB1 L;  3GTM K;  2R7Z K;  3S2H K;  4A3M K;  2R92 K;  3HOU C;  1BDF A;  2YU9 K;  1I6H K;  1TWF C;  1Y1W K;  3PO3 K;  3S1R K;  1SFO C;  5IYD K;  1WCM C;  3H0G K;  3GTP K;  1I50 C;  2R93 K;  2Y0S L;  5TMF A;  4OIN A;  2PPB A;  4XSZ A;  3M3Y C;  4BBS C;  2WB1 D;  3HOW C;  3RZO K;  3RZD K;  3GTL K;  1I3Q C;  3HOV C;  1K83 C;  2VUM K;  3S16 C;  4LLG A;  3HOX C;  4BBR C;  4Y7N K;  2O5I A;  2NVT C;  5IP9 C;  1TWH C;  4A3F C;  4MQ9 A;  4A3J C;  2E2H K;  3FKI K;  5IYC K;  5IP7 K;  3HKZ L;  2NVQ K;  3S1M C;  5C44 C;  3S17 C;  4A3K K;  4LJZ A;  1Y1V K;  4MEY A;  4OIR A;  3GTQ K;  3S14 K;  5IYB K;  4Y52 K;  2R7Z C;  1TWG C;  4YFN A;  3S2H C;  4A3M C;  3HOY K;  2YU9 C;  1I6H C;  1Y1W C;  4A3L K;  2B63 K;  5C3E K;  3WOD A;  3PO3 C;  5IYD C;  3H0G C;  4A3I K;  3GTP C;  2JA6 K;  2A6E A;  3CQZ K;  2A68 A;  4A3G K;  3RZO C;  3S1Q C;  2NVY K;  3H3V L;  2VUM C;  5M5W K;  4KMU A;  4A3D K;  2PA8 L;  3GTJ K;  1R9T K;  4NOI A;  2BE5 A;  4GZY A;  4BY7 C;  4Y7N C;  2JA5 K;  2E2H C;  1XPP A;  3FKI C;  5IYC C;  4OIO A;  4C2M K;  4A3C C;  4A93 C;  5M3M K;  3H3V D;  4A3K C;  2PA8 D;  3I4M K;  3S1N K;  2Y0S D;  4LK0 A;  4XLN A;  4G7O A;  2JA8 K;  5TMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...