3RZOK

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzoK00
2R92C 3M3YC 2A69A 1ZYRA 5IYCK 4C3IK 4OINA 2VUMC 3HOWC 4KMUA 2JA8K 4A3LK 4BBSK 4A3EK 4KN7A 5TMCA 3I4MK 4A3DK 3H0GK 2A6HA 3S15K 5C4JC 4YG2A 3GTPC 3HOUK 1I6HK 3PO3K 5C4XC 4X6AC 3GTJK 4G7OA 4A3FK 1I50C 4XLPA 4QIWL 4AYBL 4Y7NK 1K83C 4A3CK 4QJVB 1TWHC 4BXXK 2R7ZC 4Q5SA 2JA5K 3I4MC 3S15C 4MQ9A 3S1QK 5IYDC 2E2JK 4MEYA 3RZOC 5C3EK 1I6HC 1IW7A 3FKIK 4C3HK 3GTJC 2R93K 2NVYC 1I50K 3K7AK 5IP7C 5FJ8K 1K83K 4LK0A 3WODA 2JA5C 4NOIA 2PA8D 3GTQC 3H3VD 3S16K 3S1QC 4LK1A 3HOYC 1SMYA 5C3EC 3CQZK 4C2MK 1Y1WC 4BY7C 3M4OC 4GZYA 1TWAK 3I4NK 2R92K 3M3YK 2PMZL 4A3BK 2VUMK 2NVXK 1HQMA 2B63C 2YU9K 4OIOA 1TWCC 2NVTC 3HOYK 3HOUC 1Y1WK 4X6AK 5C44C 3HOZC 3S1MC 1TWAC 5M3FK 4A3FC 3I4NC 1WCMC 3S1NC 4A3BC 4YFKA 1TWFK 4A3GK 2PA8L 2NVXC 1TWHK 2A6EA 3S2DK 2R7ZK 3S1RC 2NVQC 2Y0SD 4C3JK 2NVTK 5M5YK 3RZOK 3S14K 3FKIC 2JA7C 5IP9K 2R93C 4XSZA 3S1MK 2NVYK 4BBRK 5FLMK 4G7HA 1WCMK 3S1NK 2WAQL 3DXJA 2BE5A 3EQLA 2NVQK 2CW0A 4A3JK 3RZDK 2E2IC 1XPPA 4QJVA 3CQZC 4BY7K 2WB1L 1R9TC 4OIPA 5FLMC 1Y1VC 3HOVK 4MEXA 4OIRA 2B63K 3HOXK 1BDFA 2YU9C 3PO2K 3HKZD 4LJZA 4LLGA 1TWCK 5TMFA 2PMZD 4A3JC 3RZDC 2E2IK 5IYBK 1R9TK 1YNJA 5C44K 3HOZK 1TWGK 3S17K 4G7ZA 4A3GC 3S2HC 3HOVC 1TWFC 3GTGC 4A3MK 4ZH4A 5M3MK 2JA6K 3S2DC 4Y52C 3S1RK 1I3QK 3GTGK 1YNNA 2E2HC 3GTKC 3S14C 3HOWK 4A93K 5IYBC 2JA7K 5IP9C 4BBSC 3GTLC 1TWGC 4BBRC 4OIQA 4A3EC 4A3DC 4XLNA 3H0GC 4A3MC 2Y0SL 3H3VL 5C4JK 3GTPK 3GTOC 4A3IC 4Y52K 5C4XK 4QIWD 4AYBD 2E2HK 2WAQD 4Y7NC 3GTMK 3GTKK 2O5JA 4A93C 4A3CC 4KN4A 3GTLK 4Q4ZA 4JK1A 4YFNA 4BY1C 1Y1VK 4A3KC 2E2JC 5IYDK 3GTOK 2WB1D 3HOXC 4A3IK 5D4DA 1SFOC 3S17C 3PO2C 4BXXC 3GTMC 3HKZL 3K7AC 5IP7K 5IYCC 3PO3C 4A3LC 2PPBA 2JA8C 5M5XK 5M5WK 4BY1K 3S2HK 3GTQK 2A68A 4YFXA 3S16C 4XSXA 4A3KK 2JA6C 1I6VA 1SFOK 2O5IA 1I3QC 3M4OK
chains in the Genus database with same CATH superfamily
4M1XA 4A3LK 1ZYRA 3HOWC 2VUMC 4KMUA 4BBSK 4A3EK 3H0GK 4KB4A 3BUEA 1JOEA 3GTPC 1I6HK 3GTJK 4G7OA 3T01A 3SZZA 4Y7NK 3GTJA 3OREA 4QJVB 1TWHC 3AQPA 1R9TA 2JA5K 1PJ5A 3GTPA 3S1QK 5IYDC 4MEYA 5L46A 3FKIK 2R93K 4C3HK 3GTJC 2XCQA 4NOIA 3HOYC 3G4AA 3FOFA 4BY7C 4C3HC 4GZYA 3M3YK 3LAPA 2VUMK 2JH3A 1GE9A 1F93A 3A8JA 3HOYK 1IS1A 1IE0A 5M3FK 4A3GK 1TWHK 1ZBSA 3VA7A 4C3JK 2NVTK 3S14K 3S0XA 5IP9K 1WCMK 3Q3QA 1XZQA 1L0WA 3S1NK 3GSIA 1DCOA 4BKWA 3IPJA 2BE5A 2CW0A 4A3JK 2E2IC 1USOA 4KM9A 4PAAA 3HOVK 5IORA 4LR2A 3L4JA 3HOXK 2E2IA 2V6SA 1BDFA 1B4BA 3PO2K 3RZDC 1TWCK 5IYBK 1R9TK 2KWAA 1VGXA 1J6VA 1C0AA 1WOPA 1IBAA 4GT9A 3GTGK 3S14C 4KMAA 5IP9C 3OEPA 3GTLC 2B63A 1EK8A 2Y0SL 3N3YA 1TWHA 3N0BA 4A3IC 3T00A 5JFEA 4QIWD 2ZFZA 4JK1A 4YFNA 1Y1VK 4J3NA 1ZXOA 4A3KC 4KAWX 3GTOK 4A3IK 3HOXC 1SFOC 3K7AC 5IYCC 1JQWA 2JA8C 5M5XK 3GTQK 4RMFA 1VRQC 4YFXA 3S16C 4A3KK 4GTLA 1SFOK 4O2DA 2ZUEA 5IYCK 4C3IK 1J98A 2JA8K 2PHCB 3GEIA 3I4MK 2A6HA 3QX3A 3S15K 4BLBA 4YG2A 3HOUK 4A3FK 5IOSA 1I50C 4QIWL 1AB4A 2NVYA 1K83C 4GTFA 3CQZA 3S15C 5C3EK 5CJ9A 2NVYC 1I50K 3K7AK 3L4KA 5HL8A 2JA7A 3GTQC 1F9NA 3S16K 3BP8C 4XCHA 1SMYA 5C3EC 1DCHA 3CQZK 4C2MK 1Y1WC 3LAJA 1TWAA 4C3IC 4KMHA 2YU9K 4OIOA 1K83A 1XZPA 1Y1WK 5C44C 1TWAC 3I4NC 4YFKA 2R7ZA 2NVXC 4ILDA 1BJTA 2Y0SD 3HXAA 5M5YK 3RZOK 1INNA 2JA7C 2GSUA 4XSZA 3S1MK 2GAGC 3MMLB 1XPPA 2JA6A 4C2MC 1O2FB 1G51A 1PJ7A 4MEXA 2YU9C 4LLGA 4LJZA 1O2BA 3A8KA 1YNJA 3HOZK 3G4CA 1TWGK 2FQOA 1JVIA 3S2DC 2JA6K 3H0GA 1VH2A 1I3QK 1YNNA 1F7UA 3HOWK 4WJ4A 2JA7K 4KB2A 4BBSC 1VJEA 4BBRC 3ADAC 4A3DC 3H0GC 4A3MC 1WOOA 3H3VL 4AH6A 4Y52K 2RGRA 3V4GA 1PJ6A 3GTKK 3LPXA 4Y7NC 4A3CC 3AH5A 4KN4A 4Q4ZA 1O28A 1ZVUA 5IYDK 2CFAA 4A3LC 1XZPB 2ZUFA 3T02A 3FHZA 1J6XA 4BXXK 2O5IA 1I3QC 1WOSA 3M4OK 3CAGA 2JA5A 2R92C 3M3YC 4A3DK 4KN7A 5TMCA 3GTQA 2D6FC 3PO3K 5C4XC 4X6AC 1TWCA 2P5MA 2GAHC 4A3CK 3GTOA 4Q5SA 3TFHA 1O25A 4MQ9A 1WQHA 4P9SA 2E2JK 1I6HC 5EGEA 5FJ8K 1I3QA 2JA5C 2PA8D 1EH1A 3GEEA 3S1QC 1Y1WA 2V6TA 3M4OC 2R92K 2PMZL 1XXAA 1RU0A 4LOWA 1ZQ1C 2B63C 3GTLA 4WJ3M 1TWCC 5EGHA 2NVTC 4X6AK 1XXBA 1WCMC 3S1NC 3ERED 5IOTA 2A6EA 1WIHA 4G0VA 4C45A 4KDDA 3S1RC 2VUMA 4BLAA 4KARA 1XXCA 3FKIC 2XCOA 1WCMA 2R93C 1EFWA 5FLMK 1DCPA 2WAQL 1EI6A 1Y1VA 3DXJA 1WQFA 3EQLA 1O29A 3TFJA 3RZDK 4C3JC 1O27A 4BY7K 1R9TC 1WSVA 4OIPA 5FLMC 2W7VA 1Y1VC 2Y3PA 2YU9A 2B63K 4G0WA 1X31C 4A3JC 2E2IK 1SFOA 4A3GC 2V6UA 3HOVC 1XZQB 1B4AA 4KMDA 3S1RK 1USMA 4WILA 2E2HC 5IYBC 2CFAB 2P8TA 4XLNA 1HI9A 5C4JK 1WORA 3AD8C 3GTOC 1YCLA 4AYBD 2E2HK 2WAQD 3GTLK 4BY1C 4DDQA 4KM8A 1IL2A 2XCRB 2GSOA 4GFQA 5D4DA 3S17C 3PO2C 3NUHA 3HKZL 5IP7K 1O24A 1V5VA 1TWGA 3GTMA 5M5WK 5E68A 4BY1K 4G0UA 3TTGA 2E2HA 4XSXA 1UV7A 1YX2A 1I6VA 3S17K 3GTGC 4GTBA 1TWFA 2A69A 5JVOA 4OINA 3A8IA 3GEHA 5C4JC 3AD7C 4XLPA 4AYBL 4P5AA 2R7ZC 3I4MC 1IQ0A 2FQTA 3FOEA 3RZOC 1IW7A 5IP7C 2RH6A 1K83K 4LK0A 3WODA 3GTGA 3H3VD 4LK1A 1BGWA 1TWAK 3I4NK 4FZBA 5TJ3A 1J6WA 4A3BK 2NVXK 1HQMA 3HOUC 3HOZC 3S1MC 4A3FC 3AQOA 4A3BC 1TWFK 4LQYA 2PA8L 3S2DK 1BS2A 2R7ZK 3OPFA 2NVQC 5CHPA 3FKIA 2R93A 3N0CA 4FM9A 2EBBA 2NVYK 4BBRK 3BP3A 4G7HA 1VLOA 4P5BA 1O2AA 2R92A 2NVQK 4QJVA 3CQZC 4PABA 2WB1L 2GSNA 3GDZA 1I50A 4GTEA 3SZYA 4OIRA 4GTDA 2O5JA 3HKZD 5TMFA 2PMZD 5IOQA 5C44K 4G7ZA 4GTCA 3S2HC 2NVXA 1ISEA 1TWFC 4A3MK 4KATA 4ZH4A 5M3MK 4KASA 4Y52C 3AD9C 3GTKC 4A93K 1TWGC 4OIQA 4A3EC 3TFIA 3GTPK 1WSRA 5C4XK 1F7VA 3GIRA 3GTMK 4A93C 1WQGA 1KQ4A 1O26A 3JSTA 2E2JC 2WB1D 4BXXC 4KC6A 3GTMC 2PPBA 1EQRA 3S2HK 2A68A 3GTKA 2JA6C 3PO3C 4GTAA 1DD5A
chains in the Genus database with same CATH topology
2R92C 3M3YC 2A69A 1ZYRA 5IYCK 4C3IK 4OINA 2VUMC 3HOWC 4KMUA 2JA8K 4A3LK 4BBSK 4A3EK 4KN7A 5TMCA 3I4MK 4A3DK 3H0GK 2A6HA 3S15K 5C4JC 4YG2A 3GTPC 3HOUK 1I6HK 3PO3K 5C4XC 4X6AC 3GTJK 4G7OA 4A3FK 1I50C 4XLPA 4QIWL 4AYBL 4Y7NK 1K83C 4A3CK 4QJVB 1TWHC 4BXXK 2R7ZC 4Q5SA 2JA5K 3I4MC 3S15C 4MQ9A 3S1QK 5IYDC 2E2JK 4MEYA 3RZOC 5C3EK 1I6HC 1IW7A 3FKIK 4C3HK 3GTJC 2R93K 2NVYC 1I50K 3K7AK 5IP7C 5FJ8K 1K83K 4LK0A 3WODA 2JA5C 4NOIA 2PA8D 3GTQC 3H3VD 3S16K 3S1QC 4LK1A 3HOYC 1SMYA 5C3EC 3CQZK 4C2MK 1Y1WC 4BY7C 3M4OC 4GZYA 1TWAK 3I4NK 2R92K 3M3YK 2PMZL 4A3BK 2VUMK 2NVXK 1HQMA 2B63C 2YU9K 4OIOA 1TWCC 2NVTC 3HOYK 3HOUC 1Y1WK 4X6AK 5C44C 3HOZC 3S1MC 1TWAC 5M3FK 4A3FC 3I4NC 1WCMC 3S1NC 4A3BC 4YFKA 1TWFK 4A3GK 2PA8L 2NVXC 1TWHK 2A6EA 3S2DK 2R7ZK 3S1RC 2NVQC 2Y0SD 4C3JK 2NVTK 5M5YK 3RZOK 3S14K 3FKIC 2JA7C 5IP9K 2R93C 4XSZA 3S1MK 2NVYK 4BBRK 5FLMK 4G7HA 1WCMK 3S1NK 2WAQL 3DXJA 2BE5A 3EQLA 2NVQK 2CW0A 4A3JK 3RZDK 2E2IC 1XPPA 4QJVA 3CQZC 4BY7K 2WB1L 1R9TC 4OIPA 5FLMC 1Y1VC 3HOVK 4MEXA 4OIRA 2B63K 3HOXK 1BDFA 2YU9C 3PO2K 3HKZD 4LJZA 4LLGA 1TWCK 5TMFA 2PMZD 4A3JC 3RZDC 2E2IK 5IYBK 1R9TK 1YNJA 5C44K 3HOZK 1TWGK 3S17K 4G7ZA 4A3GC 3S2HC 3HOVC 1TWFC 3GTGC 4A3MK 4ZH4A 5M3MK 2JA6K 3S2DC 4Y52C 3S1RK 1I3QK 3GTGK 1YNNA 2E2HC 3GTKC 3S14C 3HOWK 4A93K 5IYBC 2JA7K 5IP9C 4BBSC 3GTLC 1TWGC 4BBRC 4OIQA 4A3EC 4A3DC 4XLNA 3H0GC 4A3MC 2Y0SL 3H3VL 5C4JK 3GTPK 3GTOC 4A3IC 4Y52K 5C4XK 4QIWD 4AYBD 2E2HK 2WAQD 4Y7NC 3GTMK 3GTKK 2O5JA 4A93C 4A3CC 4KN4A 3GTLK 4Q4ZA 4JK1A 4YFNA 4BY1C 1Y1VK 4A3KC 2E2JC 5IYDK 3GTOK 2WB1D 3HOXC 4A3IK 5D4DA 1SFOC 3S17C 3PO2C 4BXXC 3GTMC 3HKZL 3K7AC 5IP7K 5IYCC 3PO3C 4A3LC 2PPBA 2JA8C 5M5XK 5M5WK 4BY1K 3S2HK 3GTQK 2A68A 4YFXA 3S16C 4XSXA 4A3KK 2JA6C 1I6VA 1SFOK 2O5IA 1I3QC 3M4OK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 C;  3M3Y C;  2A69 A;  1ZYR A;  5IYC K;  4C3I K;  4OIN A;  2VUM C;  3HOW C;  4KMU A;  2JA8 K;  4A3L K;  4BBS K;  4A3E K;  4KN7 A;  5TMC A;  3I4M K;  4A3D K;  3H0G K;  2A6H A;  3S15 K;  5C4J C;  4YG2 A;  3GTP C;  3HOU K;  1I6H K;  3PO3 K;  5C4X C;  4X6A C;  3GTJ K;  4G7O A;  4A3F K;  1I50 C;  4XLP A;  4QIW L;  4AYB L;  4Y7N K;  1K83 C;  4A3C K;  4QJV B;  1TWH C;  4BXX K;  2R7Z C;  4Q5S A;  2JA5 K;  3I4M C;  3S15 C;  4MQ9 A;  3S1Q K;  5IYD C;  2E2J K;  4MEY A;  3RZO C;  5C3E K;  1I6H C;  1IW7 A;  3FKI K;  4C3H K;  3GTJ C;  2R93 K;  2NVY C;  1I50 K;  3K7A K;  5IP7 C;  5FJ8 K;  1K83 K;  4LK0 A;  3WOD A;  2JA5 C;  4NOI A;  2PA8 D;  3GTQ C;  3H3V D;  3S16 K;  3S1Q C;  4LK1 A;  3HOY C;  1SMY A;  5C3E C;  3CQZ K;  4C2M K;  1Y1W C;  4BY7 C;  3M4O C;  4GZY A;  1TWA K;  3I4N K;  2R92 K;  3M3Y K;  2PMZ L;  4A3B K;  2VUM K;  2NVX K;  1HQM A;  2B63 C;  2YU9 K;  4OIO A;  1TWC C;  2NVT C;  3HOY K;  3HOU C;  1Y1W K;  4X6A K;  5C44 C;  3HOZ C;  3S1M C;  1TWA C;  5M3F K;  4A3F C;  3I4N C;  1WCM C;  3S1N C;  4A3B C;  4YFK A;  1TWF K;  4A3G K;  2PA8 L;  2NVX C;  1TWH K;  2A6E A;  3S2D K;  2R7Z K;  3S1R C;  2NVQ C;  2Y0S D;  4C3J K;  2NVT K;  5M5Y K;  3RZO K;  3S14 K;  3FKI C;  2JA7 C;  5IP9 K;  2R93 C;  4XSZ A;  3S1M K;  2NVY K;  4BBR K;  5FLM K;  4G7H A;  1WCM K;  3S1N K;  2WAQ L;  3DXJ A;  2BE5 A;  3EQL A;  2NVQ K;  2CW0 A;  4A3J K;  3RZD K;  2E2I C;  1XPP A;  4QJV A;  3CQZ C;  4BY7 K;  2WB1 L;  1R9T C;  4OIP A;  5FLM C;  1Y1V C;  3HOV K;  4MEX A;  4OIR A;  2B63 K;  3HOX K;  1BDF A;  2YU9 C;  3PO2 K;  3HKZ D;  4LJZ A;  4LLG A;  1TWC K;  5TMF A;  2PMZ D;  4A3J C;  3RZD C;  2E2I K;  5IYB K;  1R9T K;  1YNJ A;  5C44 K;  3HOZ K;  1TWG K;  3S17 K;  4G7Z A;  4A3G C;  3S2H C;  3HOV C;  1TWF C;  3GTG C;  4A3M K;  4ZH4 A;  5M3M K;  2JA6 K;  3S2D C;  4Y52 C;  3S1R K;  1I3Q K;  3GTG K;  1YNN A;  2E2H C;  3GTK C;  3S14 C;  3HOW K;  4A93 K;  5IYB C;  2JA7 K;  5IP9 C;  4BBS C;  3GTL C;  1TWG C;  4BBR C;  4OIQ A;  4A3E C;  4A3D C;  4XLN A;  3H0G C;  4A3M C;  2Y0S L;  3H3V L;  5C4J K;  3GTP K;  3GTO C;  4A3I C;  4Y52 K;  5C4X K;  4QIW D;  4AYB D;  2E2H K;  2WAQ D;  4Y7N C;  3GTM K;  3GTK K;  2O5J A;  4A93 C;  4A3C C;  4KN4 A;  3GTL K;  4Q4Z A;  4JK1 A;  4YFN A;  4BY1 C;  1Y1V K;  4A3K C;  2E2J C;  5IYD K;  3GTO K;  2WB1 D;  3HOX C;  4A3I K;  5D4D A;  1SFO C;  3S17 C;  3PO2 C;  4BXX C;  3GTM C;  3HKZ L;  3K7A C;  5IP7 K;  5IYC C;  3PO3 C;  4A3L C;  2PPB A;  2JA8 C;  5M5X K;  5M5W K;  4BY1 K;  3S2H K;  3GTQ K;  2A68 A;  4YFX A;  3S16 C;  4XSX A;  4A3K K;  2JA6 C;  1I6V A;  1SFO K;  2O5I A;  1I3Q C;  3M4O K; 
#chains in the Genus database with same CATH topology
 4M1X A;  4A3L K;  1ZYR A;  3HOW C;  2VUM C;  4KMU A;  4BBS K;  4A3E K;  3H0G K;  4KB4 A;  3BUE A;  1JOE A;  3GTP C;  1I6H K;  3GTJ K;  4G7O A;  3T01 A;  3SZZ A;  4Y7N K;  3GTJ A;  3ORE A;  4QJV B;  1TWH C;  3AQP A;  1R9T A;  2JA5 K;  1PJ5 A;  3GTP A;  3S1Q K;  5IYD C;  4MEY A;  5L46 A;  3FKI K;  2R93 K;  4C3H K;  3GTJ C;  2XCQ A;  4NOI A;  3HOY C;  3G4A A;  3FOF A;  4BY7 C;  4C3H C;  4GZY A;  3M3Y K;  3LAP A;  2VUM K;  2JH3 A;  1GE9 A;  1F93 A;  3A8J A;  3HOY K;  1IS1 A;  1IE0 A;  5M3F K;  4A3G K;  1TWH K;  1ZBS A;  3VA7 A;  4C3J K;  2NVT K;  3S14 K;  3S0X A;  5IP9 K;  1WCM K;  3Q3Q A;  1XZQ A;  1L0W A;  3S1N K;  3GSI A;  1DCO A;  4BKW A;  3IPJ A;  2BE5 A;  2CW0 A;  4A3J K;  2E2I C;  1USO A;  4KM9 A;  4PAA A;  3HOV K;  5IOR A;  4LR2 A;  3L4J A;  3HOX K;  2E2I A;  2V6S A;  1BDF A;  1B4B A;  3PO2 K;  3RZD C;  1TWC K;  5IYB K;  1R9T K;  2KWA A;  1VGX A;  1J6V A;  1C0A A;  1WOP A;  1IBA A;  4GT9 A;  3GTG K;  3S14 C;  4KMA A;  5IP9 C;  3OEP A;  3GTL C;  2B63 A;  1EK8 A;  2Y0S L;  3N3Y A;  1TWH A;  3N0B A;  4A3I C;  3T00 A;  5JFE A;  4QIW D;  2ZFZ A;  4JK1 A;  4YFN A;  1Y1V K;  4J3N A;  1ZXO A;  4A3K C;  4KAW X;  3GTO K;  4A3I K;  3HOX C;  1SFO C;  3K7A C;  5IYC C;  1JQW A;  2JA8 C;  5M5X K;  3GTQ K;  4RMF A;  1VRQ C;  4YFX A;  3S16 C;  4A3K K;  4GTL A;  1SFO K;  4O2D A;  2ZUE A;  5IYC K;  4C3I K;  1J98 A;  2JA8 K;  2PHC B;  3GEI A;  3I4M K;  2A6H A;  3QX3 A;  3S15 K;  4BLB A;  4YG2 A;  3HOU K;  4A3F K;  5IOS A;  1I50 C;  4QIW L;  1AB4 A;  2NVY A;  1K83 C;  4GTF A;  3CQZ A;  3S15 C;  5C3E K;  5CJ9 A;  2NVY C;  1I50 K;  3K7A K;  3L4K A;  5HL8 A;  2JA7 A;  3GTQ C;  1F9N A;  3S16 K;  3BP8 C;  4XCH A;  1SMY A;  5C3E C;  1DCH A;  3CQZ K;  4C2M K;  1Y1W C;  3LAJ A;  1TWA A;  4C3I C;  4KMH A;  2YU9 K;  4OIO A;  1K83 A;  1XZP A;  1Y1W K;  5C44 C;  1TWA C;  3I4N C;  4YFK A;  2R7Z A;  2NVX C;  4ILD A;  1BJT A;  2Y0S D;  3HXA A;  5M5Y K;  3RZO K;  1INN A;  2JA7 C;  2GSU A;  4XSZ A;  3S1M K;  2GAG C;  3MML B;  1XPP A;  2JA6 A;  4C2M C;  1O2F B;  1G51 A;  1PJ7 A;  4MEX A;  2YU9 C;  4LLG A;  4LJZ A;  1O2B A;  3A8K A;  1YNJ A;  3HOZ K;  3G4C A;  1TWG K;  2FQO A;  1JVI A;  3S2D C;  2JA6 K;  3H0G A;  1VH2 A;  1I3Q K;  1YNN A;  1F7U A;  3HOW K;  4WJ4 A;  2JA7 K;  4KB2 A;  4BBS C;  1VJE A;  4BBR C;  3ADA C;  4A3D C;  3H0G C;  4A3M C;  1WOO A;  3H3V L;  4AH6 A;  4Y52 K;  2RGR A;  3V4G A;  1PJ6 A;  3GTK K;  3LPX A;  4Y7N C;  4A3C C;  3AH5 A;  4KN4 A;  4Q4Z A;  1O28 A;  1ZVU A;  5IYD K;  2CFA A;  4A3L C;  1XZP B;  2ZUF A;  3T02 A;  3FHZ A;  1J6X A;  4BXX K;  2O5I A;  1I3Q C;  1WOS A;  3M4O K;  3CAG A;  2JA5 A;  2R92 C;  3M3Y C;  4A3D K;  4KN7 A;  5TMC A;  3GTQ A;  2D6F C;  3PO3 K;  5C4X C;  4X6A C;  1TWC A;  2P5M A;  2GAH C;  4A3C K;  3GTO A;  4Q5S A;  3TFH A;  1O25 A;  4MQ9 A;  1WQH A;  4P9S A;  2E2J K;  1I6H C;  5EGE A;  5FJ8 K;  1I3Q A;  2JA5 C;  2PA8 D;  1EH1 A;  3GEE A;  3S1Q C;  1Y1W A;  2V6T A;  3M4O C;  2R92 K;  2PMZ L;  1XXA A;  1RU0 A;  4LOW A;  1ZQ1 C;  2B63 C;  3GTL A;  4WJ3 M;  1TWC C;  5EGH A;  2NVT C;  4X6A K;  1XXB A;  1WCM C;  3S1N C;  3ERE D;  5IOT A;  2A6E A;  1WIH A;  4G0V A;  4C45 A;  4KDD A;  3S1R C;  2VUM A;  4BLA A;  4KAR A;  1XXC A;  3FKI C;  2XCO A;  1WCM A;  2R93 C;  1EFW A;  5FLM K;  1DCP A;  2WAQ L;  1EI6 A;  1Y1V A;  3DXJ A;  1WQF A;  3EQL A;  1O29 A;  3TFJ A;  3RZD K;  4C3J C;  1O27 A;  4BY7 K;  1R9T C;  1WSV A;  4OIP A;  5FLM C;  2W7V A;  1Y1V C;  2Y3P A;  2YU9 A;  2B63 K;  4G0W A;  1X31 C;  4A3J C;  2E2I K;  1SFO A;  4A3G C;  2V6U A;  3HOV C;  1XZQ B;  1B4A A;  4KMD A;  3S1R K;  1USM A;  4WIL A;  2E2H C;  5IYB C;  2CFA B;  2P8T A;  4XLN A;  1HI9 A;  5C4J K;  1WOR A;  3AD8 C;  3GTO C;  1YCL A;  4AYB D;  2E2H K;  2WAQ D;  3GTL K;  4BY1 C;  4DDQ A;  4KM8 A;  1IL2 A;  2XCR B;  2GSO A;  4GFQ A;  5D4D A;  3S17 C;  3PO2 C;  3NUH A;  3HKZ L;  5IP7 K;  1O24 A;  1V5V A;  1TWG A;  3GTM A;  5M5W K;  5E68 A;  4BY1 K;  4G0U A;  3TTG A;  2E2H A;  4XSX A;  1UV7 A;  1YX2 A;  1I6V A;  3S17 K;  3GTG C;  4GTB A;  1TWF A;  2A69 A;  5JVO A;  4OIN A;  3A8I A;  3GEH A;  5C4J C;  3AD7 C;  4XLP A;  4AYB L;  4P5A A;  2R7Z C;  3I4M C;  1IQ0 A;  2FQT A;  3FOE A;  3RZO C;  1IW7 A;  5IP7 C;  2RH6 A;  1K83 K;  4LK0 A;  3WOD A;  3GTG A;  3H3V D;  4LK1 A;  1BGW A;  1TWA K;  3I4N K;  4FZB A;  5TJ3 A;  1J6W A;  4A3B K;  2NVX K;  1HQM A;  3HOU C;  3HOZ C;  3S1M C;  4A3F C;  3AQO A;  4A3B C;  1TWF K;  4LQY A;  2PA8 L;  3S2D K;  1BS2 A;  2R7Z K;  3OPF A;  2NVQ C;  5CHP A;  3FKI A;  2R93 A;  3N0C A;  4FM9 A;  2EBB A;  2NVY K;  4BBR K;  3BP3 A;  4G7H A;  1VLO A;  4P5B A;  1O2A A;  2R92 A;  2NVQ K;  4QJV A;  3CQZ C;  4PAB A;  2WB1 L;  2GSN A;  3GDZ A;  1I50 A;  4GTE A;  3SZY A;  4OIR A;  4GTD A;  2O5J A;  3HKZ D;  5TMF A;  2PMZ D;  5IOQ A;  5C44 K;  4G7Z A;  4GTC A;  3S2H C;  2NVX A;  1ISE A;  1TWF C;  4A3M K;  4KAT A;  4ZH4 A;  5M3M K;  4KAS A;  4Y52 C;  3AD9 C;  3GTK C;  4A93 K;  1TWG C;  4OIQ A;  4A3E C;  3TFI A;  3GTP K;  1WSR A;  5C4X K;  1F7V A;  3GIR A;  3GTM K;  4A93 C;  1WQG A;  1KQ4 A;  1O26 A;  3JST A;  2E2J C;  2WB1 D;  4BXX C;  4KC6 A;  3GTM C;  2PPB A;  1EQR A;  3S2H K;  2A68 A;  3GTK A;  2JA6 C;  3PO3 C;  4GTA A;  1DD5 A; 
#chains in the Genus database with same CATH homology
 2R92 C;  3M3Y C;  2A69 A;  1ZYR A;  5IYC K;  4C3I K;  4OIN A;  2VUM C;  3HOW C;  4KMU A;  2JA8 K;  4A3L K;  4BBS K;  4A3E K;  4KN7 A;  5TMC A;  3I4M K;  4A3D K;  3H0G K;  2A6H A;  3S15 K;  5C4J C;  4YG2 A;  3GTP C;  3HOU K;  1I6H K;  3PO3 K;  5C4X C;  4X6A C;  3GTJ K;  4G7O A;  4A3F K;  1I50 C;  4XLP A;  4QIW L;  4AYB L;  4Y7N K;  1K83 C;  4A3C K;  4QJV B;  1TWH C;  4BXX K;  2R7Z C;  4Q5S A;  2JA5 K;  3I4M C;  3S15 C;  4MQ9 A;  3S1Q K;  5IYD C;  2E2J K;  4MEY A;  3RZO C;  5C3E K;  1I6H C;  1IW7 A;  3FKI K;  4C3H K;  3GTJ C;  2R93 K;  2NVY C;  1I50 K;  3K7A K;  5IP7 C;  5FJ8 K;  1K83 K;  4LK0 A;  3WOD A;  2JA5 C;  4NOI A;  2PA8 D;  3GTQ C;  3H3V D;  3S16 K;  3S1Q C;  4LK1 A;  3HOY C;  1SMY A;  5C3E C;  3CQZ K;  4C2M K;  1Y1W C;  4BY7 C;  3M4O C;  4GZY A;  1TWA K;  3I4N K;  2R92 K;  3M3Y K;  2PMZ L;  4A3B K;  2VUM K;  2NVX K;  1HQM A;  2B63 C;  2YU9 K;  4OIO A;  1TWC C;  2NVT C;  3HOY K;  3HOU C;  1Y1W K;  4X6A K;  5C44 C;  3HOZ C;  3S1M C;  1TWA C;  5M3F K;  4A3F C;  3I4N C;  1WCM C;  3S1N C;  4A3B C;  4YFK A;  1TWF K;  4A3G K;  2PA8 L;  2NVX C;  1TWH K;  2A6E A;  3S2D K;  2R7Z K;  3S1R C;  2NVQ C;  2Y0S D;  4C3J K;  2NVT K;  5M5Y K;  3RZO K;  3S14 K;  3FKI C;  2JA7 C;  5IP9 K;  2R93 C;  4XSZ A;  3S1M K;  2NVY K;  4BBR K;  5FLM K;  4G7H A;  1WCM K;  3S1N K;  2WAQ L;  3DXJ A;  2BE5 A;  3EQL A;  2NVQ K;  2CW0 A;  4A3J K;  3RZD K;  2E2I C;  1XPP A;  4QJV A;  3CQZ C;  4BY7 K;  2WB1 L;  1R9T C;  4OIP A;  5FLM C;  1Y1V C;  3HOV K;  4MEX A;  4OIR A;  2B63 K;  3HOX K;  1BDF A;  2YU9 C;  3PO2 K;  3HKZ D;  4LJZ A;  4LLG A;  1TWC K;  5TMF A;  2PMZ D;  4A3J C;  3RZD C;  2E2I K;  5IYB K;  1R9T K;  1YNJ A;  5C44 K;  3HOZ K;  1TWG K;  3S17 K;  4G7Z A;  4A3G C;  3S2H C;  3HOV C;  1TWF C;  3GTG C;  4A3M K;  4ZH4 A;  5M3M K;  2JA6 K;  3S2D C;  4Y52 C;  3S1R K;  1I3Q K;  3GTG K;  1YNN A;  2E2H C;  3GTK C;  3S14 C;  3HOW K;  4A93 K;  5IYB C;  2JA7 K;  5IP9 C;  4BBS C;  3GTL C;  1TWG C;  4BBR C;  4OIQ A;  4A3E C;  4A3D C;  4XLN A;  3H0G C;  4A3M C;  2Y0S L;  3H3V L;  5C4J K;  3GTP K;  3GTO C;  4A3I C;  4Y52 K;  5C4X K;  4QIW D;  4AYB D;  2E2H K;  2WAQ D;  4Y7N C;  3GTM K;  3GTK K;  2O5J A;  4A93 C;  4A3C C;  4KN4 A;  3GTL K;  4Q4Z A;  4JK1 A;  4YFN A;  4BY1 C;  1Y1V K;  4A3K C;  2E2J C;  5IYD K;  3GTO K;  2WB1 D;  3HOX C;  4A3I K;  5D4D A;  1SFO C;  3S17 C;  3PO2 C;  4BXX C;  3GTM C;  3HKZ L;  3K7A C;  5IP7 K;  5IYC C;  3PO3 C;  4A3L C;  2PPB A;  2JA8 C;  5M5X K;  5M5W K;  4BY1 K;  3S2H K;  3GTQ K;  2A68 A;  4YFX A;  3S16 C;  4XSX A;  4A3K K;  2JA6 C;  1I6V A;  1SFO K;  2O5I A;  1I3Q C;  3M4O K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...