3RZOK

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzoK00
4LJZA 2JA6K 3GTMC 2VUMK 2WB1L 3S1RK 1WCMC 3HOZK 4A93K 4BXXC 4A3DK 4MQ9A 4ZH4A 2B63K 2Y0SL 5IYCC 4BBSC 1I6HC 1Y1VC 2JA5K 3GTOC 5FLMC 3HOVC 3M3YK 1I3QC 4KN4A 4BY1K 3H0GC 3DXJA 2YU9C 3S15C 1TWFC 5C44K 3WODA 4A3CK 3S16C 4A3MK 3HOUC 2PMZD 2E2HK 4A3IK 5IYBC 4QJVB 2NVXC 1TWAK 3GTLK 4MEYA 2R7ZK 3GTJC 5IYDK 3S1MC 5IP7C 4A3KC 2E2JC 2WAQL 4XSZA 2NVYC 1BDFA 2E2HC 3HOXK 4A3GK 1R9TK 4OIQA 4QJVA 4A3CC 3CQZK 3GTKC 3HOYC 4Y7NC 4BY7C 5C3EK 2CW0A 4AYBL 3RZDK 5TMCA 3H0GK 2PPBA 2YU9K 2JA8K 3RZOC 1I50K 4C3IK 4A3FC 3I4NK 3M3YC 1K83K 2NVTK 1ZYRA 1K83C 2NVTC 1Y1VK 4LK0A 2A6EA 4A3FK 3I4NC 1Y1WK 1I50C 4KN7A 4Y52C 3GTQC 3H3VL 2R92C 3HOWC 1XPPA 4A3DC 2NVQK 5TMFA 4AYBD 3S1RC 3HOYK 3HOZC 3PO3C 2VUMC 4BY7K 3FKIC 4A3JC 4NOIA 1I6VA 4MEXA 2NVYK 3FKIK 4QIWD 2PMZL 4BBRC 4G7HA 4A3JK 2WB1D 4A3KK 4LK1A 3PO3K 4A3BC 3GTJK 1TWAC 2O5JA 4A3IC 2NVXK 2R92K 3GTLC 3S1NK 4Y52K 4A3MC 4YFXA 4A3EC 4YFKA 4OIOA 2E2IK 3PO2K 3S14C 3RZOK 4X6AK 4X6AC 3S14K 1I3QK 4Y7NK 1SMYA 4KMUA 3GTOK 3HOVK 3EQLA 4QIWL 2JA5C 4YFNA 4A3LK 1R9TC 1TWCC 4C2MK 3H3VD 3S1NC 5IYDC 2A69A 1WCMK 4A3BK 4A93C 5IYBK 2WAQD 3HOUK 3S1MK 4A3LC 3S2HC 5M5WK 3GTPK 3M4OK 5FJ8K 1TWFK 4LLGA 5C44C 2JA7K 4OIRA 2NVQC 3K7AC 3S15K 2PA8L 2A6HA 4BY1C 1TWHC 5M3MK 2A68A 1Y1WC 3GTQK 3HOWK 1TWGK 5FLMK 2O5IA 3S2DC 3S1QK 4G7OA 2R93C 3S17C 1I6HK 3S2DK 3S1QC 5M5XK 1TWHK 4BBSK 4C3HK 5D4DA 2JA8C 2B63C 5C3EC 3RZDC 4GZYA 5IP9K 3CQZC 3GTKK 5M5YK 3HOXC 1HQMA 4Q5SA 5IP7K 2E2JK 2BE5A 4JK1A 3HKZD 3HKZL 5C4JK 4XLPA 4Q4ZA 2R7ZC 1IW7A 5C4XK 1TWCK 3S16K 1SFOC 4C3JK 3GTGC 5IP9C 3S2HK 3I4MK 4G7ZA 2Y0SD 3I4MC 2E2IC 3PO2C 4YG2A 3S17K 2PA8D 4A3GC 2R93K 3GTGK 1TWGC 1SFOK 4A3EK 5C4XC 1YNJA 4XSXA 5IYCK 4XLNA 5C4JC 4OIPA 5M3FK 3K7AK 4BXXK 2JA7C 4BBRK 1YNNA 2JA6C 3GTPC 3GTMK 3M4OC 4OINA
chains in the Genus database with same CATH superfamily
4LJZA 1EQRA 2JA6K 3S1RK 3GEHA 4A93K 4MQ9A 1JVIA 3TFIA 3M3YK 1I3QC 1I3QA 3H0GC 2YU9C 4XCHA 3S16C 4A3MK 1J6WA 1J6VA 3S1MC 1VH2A 1DD5A 3GTJC 1WQFA 5IP7C 4XSZA 3NUHA 2JA7A 4KM9A 3L4KA 2CW0A 3H0GK 2PPBA 2YU9K 4KMHA 3I4NK 3M3YC 1K83K 2NVTC 4GTBA 4LR2A 1Y1WK 3H3VL 1VJEA 4KDDA 4AYBD 2NVQK 3S1RC 1INNA 1ISEA 4A3JC 4MEXA 2NVYK 4A3KK 2Y3PA 3PO3K 4KMAA 1DCOA 3VA7A 4A3IC 4GTFA 3PO2K 3S14C 1IS1A 4PAAA 3S14K 4Y7NK 3GTOK 2JA5C 4C2MK 4KM8A 1WOPA 1XXAA 3HOUK 4A3LC 1YCLA 3GTMA 1TWFK 2NVQC 3K7AC 3OPFA 1WQHA 4PABA 2PA8L 1L0WA 3A8IA 5M3MK 1Y1WC 3S2DC 2R92A 2R93C 2JH3A 1I6HK 1EH1A 2GSUA 1EI6A 2B63C 2D6FC 2JA6A 5M5YK 1HQMA 5IP7K 4XLPA 4AH6A 5C4XK 1TWCK 3S16K 2NVXA 3GTGC 1O2BA 2ZUEA 1WOOA 3CQZA 4KAWX 4G7ZA 2PA8D 2R93K 5IOTA 3FHZA 1PJ5A 4GTEA 4XLNA 3K7AK 3TFJA 2JA6C 2VUMA 3GTMC 2WB1L 4BXXC 4A3DK 4KC6A 1F7UA 2Y0SL 1Y1VC 2JA5K 1XZPA 3GTOC 1TWGA 5FLMC 3BP3A 4KN4A 4BY1K 1O26A 1TWHA 4A3IK 4QJVB 1O2AA 5IYDK 3BP8C 4G0VA 4A3KC 2NVYC 3HOXK 4A3CC 3GTKC 4KB4A 4M1XA 3RZDK 5TMCA 1YX2A 3S0XA 2JA5A 1PJ6A 2NVTK 1ZYRA 1K83C 2GSOA 4LK0A 3I4NC 4Y52C 2R92C 1SFOA 1C0AA 3HOZC 1PJ7A 3FKIK 2PMZL 1WSVA 4A3BC 3GTJK 3GTJA 4A3MC 4YFXA 2E2IK 3RZOK 5EGEA 5L46A 1I3QK 3N0BA 1WORA 3V4GA 3EQLA 1R9TC 3T00A 2A69A 4A93C 5IYBK 2WAQD 3S2HC 1O28A 5M5WK 3M4OK 5C44C 4LLGA 1R9TA 3S15K 2GAHC 4KMDA 2A6HA 1O27A 3HOWK 3S1QK 4G7OA 3S17C 1B4AA 4BBSK 1TWHK 4KATA 4C3HK 5D4DA 2JA8C 3AH5A 4G0UA 1DCHA 1GE9A 1F9NA 2BE5A 1JOEA 4GTDA 4WILA 4Q4ZA 2CFAA 2R7ZC 1IW7A 1SFOC 4C3JK 1G51A 3MMLB 1O2FB 1F7VA 4G0WA 3I4MK 2GAGC 2V6SA 3I4MC 1SFOK 4A3EK 4BKWA 3ADAC 2NVYA 2JA7C 4BBRK 3GTPC 1UV7A 1ZQ1C 4OINA 2VUMK 1WCMC 1VRQC 4ZH4A 4WJ3M 5IYCC 1K83A 4BBSC 4P5BA 3HOVC 3H0GA 2YU9A 3GEEA 3S15C 4FZBA 3SZYA 5C44K 5HL8A 2E2HK 3GTLK 1WSRA 5JVOA 5CHPA 1TWAK 3AD7C 5IYBC 2R7ZA 5TJ3A 5JFEA 3L4JA 2FQTA 4FM9A 2E2JC 1XXCA 2E2HC 1WQGA 1J6XA 3IPJA 3OREA 1R9TK 1TWFA 3CQZK 1ZXOA 3GSIA 3HOYC 4BY7C 5C3EK 4AYBL 1VGXA 1IBAA 1TWCA 3RZOC 1EFWA 2E2IA 3HXAA 4A3FC 1Y1VA 4C3IC 2A6EA 1O29A 3GTQC 1I50C 1IE0A 2VUMC 3FKIC 4A3GC 4BBRC 2CFAB 4G7HA 3GIRA 4GTLA 4LK1A 1AB4A 2NVXK 2R92K 3AQOA 3S1NK 4O2DA 4Y52K 4A3EC 4OIOA 3SZZA 4KARA 3FOEA 3AD9C 4X6AK 4X6AC 3GTKA 4QIWL 4C3JC 3AQPA 3H3VD 3S1NC 5IYDC 1TWAA 1B4BA 4LQYA 4C45A 1USOA 2RGRA 4OIRA 1EK8A 4BY1C 1WIHA 1ZVUA 1TWHC 3GTQK 1BS2A 3CAGA 1TWGK 5FLMK 2O5IA 2XCQA 1Y1WA 3S1QC 1F93A 1O24A 2P5MA 5C3EC 3GTOA 5IP9K 3BUEA 3CQZC 4GFQA 3G4AA 2E2JK 3G4CA 4JK1A 4LOWA 3HKZD 1O25A 1BGWA 5EGHA 1JQWA 1V5VA 3LPXA 5IP9C 3Q3QA 1X31C 1XXBA 3N3YA 2E2IC 3N0CA 4YG2A 3GTGK 1TWGC 2ZUFA 5C4XC 2PHCB 1YNJA 5CJ9A 5IYCK 2R93A 3AD8C 4P9SA 5M3FK 4OIPA 1USMA 3LAPA 1YNNA 3FOFA 3GEIA 3HOZK 2XCRB 2B63K 1KQ4A 1IQ0A 1XZQA 1I6HC 3DXJA 1TWFC 3WODA 1XZQB 4A3CK 3TFHA 3HOUC 2PMZD 1WOSA 2NVXC 2R7ZK 4A3LK 1VLOA 4MEYA 2WAQL 4A3GK 1BDFA 4C2MC 4OIQA 4QJVA 2RH6A 1I50A 4Y7NC 3A8JA 4GT9A 2JA8K 1I50K 1J98A 4C3IK 4KB2A 4DDQA 1BJTA 1Y1VK 5IOSA 2XCOA 4GTAA 4A3FK 4KN7A 3HOWC 3LAJA 1XPPA 2E2HA 3GTGA 4A3DC 2EBBA 2ZFZA 5TMFA 4P5AA 3HOYK 3PO3C 4BY7K 3FKIA 3T01A 4NOIA 1I6VA 4A3JK 4QIWD 2WB1D 1TWAC 2O5JA 3GTLC 4YFKA 3TTGA 2B63A 5IORA 3QX3A 1SMYA 4KMUA 2KWAA 1WCMA 3HOVK 4YFNA 5E68A 1TWCC 1RU0A 2V6UA 4A3BK 1WCMK 3S1MK 4J3NA 1HI9A 2FQOA 2V6TA 3GTPK 5FJ8K 4RMFA 3GDZA 2JA7K 3GTPA 4BLBA 2A68A 3GTQA 3S2DK 5M5XK 5IOQA 4WJ4A 3RZDC 4GZYA 3A8KA 3GTKK 3HOXC 4Q5SA 3JSTA 4ILDA 2GSNA 3T02A 3HKZL 5C4JK 4BLAA 4KASA 4GTCA 3ERED 1XZPB 2Y0SD 4C3HC 3PO2C 1ZBSA 1IL2A 3S17K 3GTLA 2P8TA 4XSXA 1DCPA 3OEPA 5C4JC 4BXXK 2W7VA 3GTMK 3M4OC 3S2HK
chains in the Genus database with same CATH topology
4LJZA 2JA6K 3GTMC 2VUMK 2WB1L 3S1RK 1WCMC 3HOZK 4A93K 4BXXC 4A3DK 4MQ9A 4ZH4A 2B63K 2Y0SL 5IYCC 4BBSC 1I6HC 1Y1VC 2JA5K 3GTOC 5FLMC 3HOVC 3M3YK 1I3QC 4KN4A 4BY1K 3H0GC 3DXJA 2YU9C 3S15C 1TWFC 5C44K 3WODA 4A3CK 3S16C 4A3MK 3HOUC 2PMZD 2E2HK 4A3IK 5IYBC 4QJVB 2NVXC 1TWAK 3GTLK 4MEYA 2R7ZK 3GTJC 5IYDK 3S1MC 5IP7C 4A3KC 2E2JC 2WAQL 4XSZA 2NVYC 1BDFA 2E2HC 3HOXK 4A3GK 1R9TK 4OIQA 4QJVA 4A3CC 3CQZK 3GTKC 3HOYC 4Y7NC 4BY7C 5C3EK 2CW0A 4AYBL 3RZDK 5TMCA 3H0GK 2PPBA 2YU9K 2JA8K 3RZOC 1I50K 4C3IK 4A3FC 3I4NK 3M3YC 1K83K 2NVTK 1ZYRA 1K83C 2NVTC 1Y1VK 4LK0A 2A6EA 4A3FK 3I4NC 1Y1WK 1I50C 4KN7A 4Y52C 3GTQC 3H3VL 2R92C 3HOWC 1XPPA 4A3DC 2NVQK 5TMFA 4AYBD 3S1RC 3HOYK 3HOZC 3PO3C 2VUMC 4BY7K 3FKIC 4A3JC 4NOIA 1I6VA 4MEXA 2NVYK 3FKIK 4QIWD 2PMZL 4BBRC 4G7HA 4A3JK 2WB1D 4A3KK 4LK1A 3PO3K 4A3BC 3GTJK 1TWAC 2O5JA 4A3IC 2NVXK 2R92K 3GTLC 3S1NK 4Y52K 4A3MC 4YFXA 4A3EC 4YFKA 4OIOA 2E2IK 3PO2K 3S14C 3RZOK 4X6AK 4X6AC 3S14K 1I3QK 4Y7NK 1SMYA 4KMUA 3GTOK 3HOVK 3EQLA 4QIWL 2JA5C 4YFNA 4A3LK 1R9TC 1TWCC 4C2MK 3H3VD 3S1NC 5IYDC 2A69A 1WCMK 4A3BK 4A93C 5IYBK 2WAQD 3HOUK 3S1MK 4A3LC 3S2HC 5M5WK 3GTPK 3M4OK 5FJ8K 1TWFK 4LLGA 5C44C 2JA7K 4OIRA 2NVQC 3K7AC 3S15K 2PA8L 2A6HA 4BY1C 1TWHC 5M3MK 2A68A 1Y1WC 3GTQK 3HOWK 1TWGK 5FLMK 2O5IA 3S2DC 3S1QK 4G7OA 2R93C 3S17C 1I6HK 3S2DK 3S1QC 5M5XK 1TWHK 4BBSK 4C3HK 5D4DA 2JA8C 2B63C 5C3EC 3RZDC 4GZYA 5IP9K 3CQZC 3GTKK 5M5YK 3HOXC 1HQMA 4Q5SA 5IP7K 2E2JK 2BE5A 4JK1A 3HKZD 3HKZL 5C4JK 4XLPA 4Q4ZA 2R7ZC 1IW7A 5C4XK 1TWCK 3S16K 1SFOC 4C3JK 3GTGC 5IP9C 3S2HK 3I4MK 4G7ZA 2Y0SD 3I4MC 2E2IC 3PO2C 4YG2A 3S17K 2PA8D 4A3GC 2R93K 3GTGK 1TWGC 1SFOK 4A3EK 5C4XC 1YNJA 4XSXA 5IYCK 4XLNA 5C4JC 4OIPA 5M3FK 3K7AK 4BXXK 2JA7C 4BBRK 1YNNA 2JA6C 3GTPC 3GTMK 3M4OC 4OINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJZ A;  2JA6 K;  3GTM C;  2VUM K;  2WB1 L;  3S1R K;  1WCM C;  3HOZ K;  4A93 K;  4BXX C;  4A3D K;  4MQ9 A;  4ZH4 A;  2B63 K;  2Y0S L;  5IYC C;  4BBS C;  1I6H C;  1Y1V C;  2JA5 K;  3GTO C;  5FLM C;  3HOV C;  3M3Y K;  1I3Q C;  4KN4 A;  4BY1 K;  3H0G C;  3DXJ A;  2YU9 C;  3S15 C;  1TWF C;  5C44 K;  3WOD A;  4A3C K;  3S16 C;  4A3M K;  3HOU C;  2PMZ D;  2E2H K;  4A3I K;  5IYB C;  4QJV B;  2NVX C;  1TWA K;  3GTL K;  4MEY A;  2R7Z K;  3GTJ C;  5IYD K;  3S1M C;  5IP7 C;  4A3K C;  2E2J C;  2WAQ L;  4XSZ A;  2NVY C;  1BDF A;  2E2H C;  3HOX K;  4A3G K;  1R9T K;  4OIQ A;  4QJV A;  4A3C C;  3CQZ K;  3GTK C;  3HOY C;  4Y7N C;  4BY7 C;  5C3E K;  2CW0 A;  4AYB L;  3RZD K;  5TMC A;  3H0G K;  2PPB A;  2YU9 K;  2JA8 K;  3RZO C;  1I50 K;  4C3I K;  4A3F C;  3I4N K;  3M3Y C;  1K83 K;  2NVT K;  1ZYR A;  1K83 C;  2NVT C;  1Y1V K;  4LK0 A;  2A6E A;  4A3F K;  3I4N C;  1Y1W K;  1I50 C;  4KN7 A;  4Y52 C;  3GTQ C;  3H3V L;  2R92 C;  3HOW C;  1XPP A;  4A3D C;  2NVQ K;  5TMF A;  4AYB D;  3S1R C;  3HOY K;  3HOZ C;  3PO3 C;  2VUM C;  4BY7 K;  3FKI C;  4A3J C;  4NOI A;  1I6V A;  4MEX A;  2NVY K;  3FKI K;  4QIW D;  2PMZ L;  4BBR C;  4G7H A;  4A3J K;  2WB1 D;  4A3K K;  4LK1 A;  3PO3 K;  4A3B C;  3GTJ K;  1TWA C;  2O5J A;  4A3I C;  2NVX K;  2R92 K;  3GTL C;  3S1N K;  4Y52 K;  4A3M C;  4YFX A;  4A3E C;  4YFK A;  4OIO A;  2E2I K;  3PO2 K;  3S14 C;  3RZO K;  4X6A K;  4X6A C;  3S14 K;  1I3Q K;  4Y7N K;  1SMY A;  4KMU A;  3GTO K;  3HOV K;  3EQL A;  4QIW L;  2JA5 C;  4YFN A;  4A3L K;  1R9T C;  1TWC C;  4C2M K;  3H3V D;  3S1N C;  5IYD C;  2A69 A;  1WCM K;  4A3B K;  4A93 C;  5IYB K;  2WAQ D;  3HOU K;  3S1M K;  4A3L C;  3S2H C;  5M5W K;  3GTP K;  3M4O K;  5FJ8 K;  1TWF K;  4LLG A;  5C44 C;  2JA7 K;  4OIR A;  2NVQ C;  3K7A C;  3S15 K;  2PA8 L;  2A6H A;  4BY1 C;  1TWH C;  5M3M K;  2A68 A;  1Y1W C;  3GTQ K;  3HOW K;  1TWG K;  5FLM K;  2O5I A;  3S2D C;  3S1Q K;  4G7O A;  2R93 C;  3S17 C;  1I6H K;  3S2D K;  3S1Q C;  5M5X K;  1TWH K;  4BBS K;  4C3H K;  5D4D A;  2JA8 C;  2B63 C;  5C3E C;  3RZD C;  4GZY A;  5IP9 K;  3CQZ C;  3GTK K;  5M5Y K;  3HOX C;  1HQM A;  4Q5S A;  5IP7 K;  2E2J K;  2BE5 A;  4JK1 A;  3HKZ D;  3HKZ L;  5C4J K;  4XLP A;  4Q4Z A;  2R7Z C;  1IW7 A;  5C4X K;  1TWC K;  3S16 K;  1SFO C;  4C3J K;  3GTG C;  5IP9 C;  3S2H K;  3I4M K;  4G7Z A;  2Y0S D;  3I4M C;  2E2I C;  3PO2 C;  4YG2 A;  3S17 K;  2PA8 D;  4A3G C;  2R93 K;  3GTG K;  1TWG C;  1SFO K;  4A3E K;  5C4X C;  1YNJ A;  4XSX A;  5IYC K;  4XLN A;  5C4J C;  4OIP A;  5M3F K;  3K7A K;  4BXX K;  2JA7 C;  4BBR K;  1YNN A;  2JA6 C;  3GTP C;  3GTM K;  3M4O C;  4OIN A; 
#chains in the Genus database with same CATH topology
 4LJZ A;  1EQR A;  2JA6 K;  3S1R K;  3GEH A;  4A93 K;  4MQ9 A;  1JVI A;  3TFI A;  3M3Y K;  1I3Q C;  1I3Q A;  3H0G C;  2YU9 C;  4XCH A;  3S16 C;  4A3M K;  1J6W A;  1J6V A;  3S1M C;  1VH2 A;  1DD5 A;  3GTJ C;  1WQF A;  5IP7 C;  4XSZ A;  3NUH A;  2JA7 A;  4KM9 A;  3L4K A;  2CW0 A;  3H0G K;  2PPB A;  2YU9 K;  4KMH A;  3I4N K;  3M3Y C;  1K83 K;  2NVT C;  4GTB A;  4LR2 A;  1Y1W K;  3H3V L;  1VJE A;  4KDD A;  4AYB D;  2NVQ K;  3S1R C;  1INN A;  1ISE A;  4A3J C;  4MEX A;  2NVY K;  4A3K K;  2Y3P A;  3PO3 K;  4KMA A;  1DCO A;  3VA7 A;  4A3I C;  4GTF A;  3PO2 K;  3S14 C;  1IS1 A;  4PAA A;  3S14 K;  4Y7N K;  3GTO K;  2JA5 C;  4C2M K;  4KM8 A;  1WOP A;  1XXA A;  3HOU K;  4A3L C;  1YCL A;  3GTM A;  1TWF K;  2NVQ C;  3K7A C;  3OPF A;  1WQH A;  4PAB A;  2PA8 L;  1L0W A;  3A8I A;  5M3M K;  1Y1W C;  3S2D C;  2R92 A;  2R93 C;  2JH3 A;  1I6H K;  1EH1 A;  2GSU A;  1EI6 A;  2B63 C;  2D6F C;  2JA6 A;  5M5Y K;  1HQM A;  5IP7 K;  4XLP A;  4AH6 A;  5C4X K;  1TWC K;  3S16 K;  2NVX A;  3GTG C;  1O2B A;  2ZUE A;  1WOO A;  3CQZ A;  4KAW X;  4G7Z A;  2PA8 D;  2R93 K;  5IOT A;  3FHZ A;  1PJ5 A;  4GTE A;  4XLN A;  3K7A K;  3TFJ A;  2JA6 C;  2VUM A;  3GTM C;  2WB1 L;  4BXX C;  4A3D K;  4KC6 A;  1F7U A;  2Y0S L;  1Y1V C;  2JA5 K;  1XZP A;  3GTO C;  1TWG A;  5FLM C;  3BP3 A;  4KN4 A;  4BY1 K;  1O26 A;  1TWH A;  4A3I K;  4QJV B;  1O2A A;  5IYD K;  3BP8 C;  4G0V A;  4A3K C;  2NVY C;  3HOX K;  4A3C C;  3GTK C;  4KB4 A;  4M1X A;  3RZD K;  5TMC A;  1YX2 A;  3S0X A;  2JA5 A;  1PJ6 A;  2NVT K;  1ZYR A;  1K83 C;  2GSO A;  4LK0 A;  3I4N C;  4Y52 C;  2R92 C;  1SFO A;  1C0A A;  3HOZ C;  1PJ7 A;  3FKI K;  2PMZ L;  1WSV A;  4A3B C;  3GTJ K;  3GTJ A;  4A3M C;  4YFX A;  2E2I K;  3RZO K;  5EGE A;  5L46 A;  1I3Q K;  3N0B A;  1WOR A;  3V4G A;  3EQL A;  1R9T C;  3T00 A;  2A69 A;  4A93 C;  5IYB K;  2WAQ D;  3S2H C;  1O28 A;  5M5W K;  3M4O K;  5C44 C;  4LLG A;  1R9T A;  3S15 K;  2GAH C;  4KMD A;  2A6H A;  1O27 A;  3HOW K;  3S1Q K;  4G7O A;  3S17 C;  1B4A A;  4BBS K;  1TWH K;  4KAT A;  4C3H K;  5D4D A;  2JA8 C;  3AH5 A;  4G0U A;  1DCH A;  1GE9 A;  1F9N A;  2BE5 A;  1JOE A;  4GTD A;  4WIL A;  4Q4Z A;  2CFA A;  2R7Z C;  1IW7 A;  1SFO C;  4C3J K;  1G51 A;  3MML B;  1O2F B;  1F7V A;  4G0W A;  3I4M K;  2GAG C;  2V6S A;  3I4M C;  1SFO K;  4A3E K;  4BKW A;  3ADA C;  2NVY A;  2JA7 C;  4BBR K;  3GTP C;  1UV7 A;  1ZQ1 C;  4OIN A;  2VUM K;  1WCM C;  1VRQ C;  4ZH4 A;  4WJ3 M;  5IYC C;  1K83 A;  4BBS C;  4P5B A;  3HOV C;  3H0G A;  2YU9 A;  3GEE A;  3S15 C;  4FZB A;  3SZY A;  5C44 K;  5HL8 A;  2E2H K;  3GTL K;  1WSR A;  5JVO A;  5CHP A;  1TWA K;  3AD7 C;  5IYB C;  2R7Z A;  5TJ3 A;  5JFE A;  3L4J A;  2FQT A;  4FM9 A;  2E2J C;  1XXC A;  2E2H C;  1WQG A;  1J6X A;  3IPJ A;  3ORE A;  1R9T K;  1TWF A;  3CQZ K;  1ZXO A;  3GSI A;  3HOY C;  4BY7 C;  5C3E K;  4AYB L;  1VGX A;  1IBA A;  1TWC A;  3RZO C;  1EFW A;  2E2I A;  3HXA A;  4A3F C;  1Y1V A;  4C3I C;  2A6E A;  1O29 A;  3GTQ C;  1I50 C;  1IE0 A;  2VUM C;  3FKI C;  4A3G C;  4BBR C;  2CFA B;  4G7H A;  3GIR A;  4GTL A;  4LK1 A;  1AB4 A;  2NVX K;  2R92 K;  3AQO A;  3S1N K;  4O2D A;  4Y52 K;  4A3E C;  4OIO A;  3SZZ A;  4KAR A;  3FOE A;  3AD9 C;  4X6A K;  4X6A C;  3GTK A;  4QIW L;  4C3J C;  3AQP A;  3H3V D;  3S1N C;  5IYD C;  1TWA A;  1B4B A;  4LQY A;  4C45 A;  1USO A;  2RGR A;  4OIR A;  1EK8 A;  4BY1 C;  1WIH A;  1ZVU A;  1TWH C;  3GTQ K;  1BS2 A;  3CAG A;  1TWG K;  5FLM K;  2O5I A;  2XCQ A;  1Y1W A;  3S1Q C;  1F93 A;  1O24 A;  2P5M A;  5C3E C;  3GTO A;  5IP9 K;  3BUE A;  3CQZ C;  4GFQ A;  3G4A A;  2E2J K;  3G4C A;  4JK1 A;  4LOW A;  3HKZ D;  1O25 A;  1BGW A;  5EGH A;  1JQW A;  1V5V A;  3LPX A;  5IP9 C;  3Q3Q A;  1X31 C;  1XXB A;  3N3Y A;  2E2I C;  3N0C A;  4YG2 A;  3GTG K;  1TWG C;  2ZUF A;  5C4X C;  2PHC B;  1YNJ A;  5CJ9 A;  5IYC K;  2R93 A;  3AD8 C;  4P9S A;  5M3F K;  4OIP A;  1USM A;  3LAP A;  1YNN A;  3FOF A;  3GEI A;  3HOZ K;  2XCR B;  2B63 K;  1KQ4 A;  1IQ0 A;  1XZQ A;  1I6H C;  3DXJ A;  1TWF C;  3WOD A;  1XZQ B;  4A3C K;  3TFH A;  3HOU C;  2PMZ D;  1WOS A;  2NVX C;  2R7Z K;  4A3L K;  1VLO A;  4MEY A;  2WAQ L;  4A3G K;  1BDF A;  4C2M C;  4OIQ A;  4QJV A;  2RH6 A;  1I50 A;  4Y7N C;  3A8J A;  4GT9 A;  2JA8 K;  1I50 K;  1J98 A;  4C3I K;  4KB2 A;  4DDQ A;  1BJT A;  1Y1V K;  5IOS A;  2XCO A;  4GTA A;  4A3F K;  4KN7 A;  3HOW C;  3LAJ A;  1XPP A;  2E2H A;  3GTG A;  4A3D C;  2EBB A;  2ZFZ A;  5TMF A;  4P5A A;  3HOY K;  3PO3 C;  4BY7 K;  3FKI A;  3T01 A;  4NOI A;  1I6V A;  4A3J K;  4QIW D;  2WB1 D;  1TWA C;  2O5J A;  3GTL C;  4YFK A;  3TTG A;  2B63 A;  5IOR A;  3QX3 A;  1SMY A;  4KMU A;  2KWA A;  1WCM A;  3HOV K;  4YFN A;  5E68 A;  1TWC C;  1RU0 A;  2V6U A;  4A3B K;  1WCM K;  3S1M K;  4J3N A;  1HI9 A;  2FQO A;  2V6T A;  3GTP K;  5FJ8 K;  4RMF A;  3GDZ A;  2JA7 K;  3GTP A;  4BLB A;  2A68 A;  3GTQ A;  3S2D K;  5M5X K;  5IOQ A;  4WJ4 A;  3RZD C;  4GZY A;  3A8K A;  3GTK K;  3HOX C;  4Q5S A;  3JST A;  4ILD A;  2GSN A;  3T02 A;  3HKZ L;  5C4J K;  4BLA A;  4KAS A;  4GTC A;  3ERE D;  1XZP B;  2Y0S D;  4C3H C;  3PO2 C;  1ZBS A;  1IL2 A;  3S17 K;  3GTL A;  2P8T A;  4XSX A;  1DCP A;  3OEP A;  5C4J C;  4BXX K;  2W7V A;  3GTM K;  3M4O C;  3S2H K; 
#chains in the Genus database with same CATH homology
 4LJZ A;  2JA6 K;  3GTM C;  2VUM K;  2WB1 L;  3S1R K;  1WCM C;  3HOZ K;  4A93 K;  4BXX C;  4A3D K;  4MQ9 A;  4ZH4 A;  2B63 K;  2Y0S L;  5IYC C;  4BBS C;  1I6H C;  1Y1V C;  2JA5 K;  3GTO C;  5FLM C;  3HOV C;  3M3Y K;  1I3Q C;  4KN4 A;  4BY1 K;  3H0G C;  3DXJ A;  2YU9 C;  3S15 C;  1TWF C;  5C44 K;  3WOD A;  4A3C K;  3S16 C;  4A3M K;  3HOU C;  2PMZ D;  2E2H K;  4A3I K;  5IYB C;  4QJV B;  2NVX C;  1TWA K;  3GTL K;  4MEY A;  2R7Z K;  3GTJ C;  5IYD K;  3S1M C;  5IP7 C;  4A3K C;  2E2J C;  2WAQ L;  4XSZ A;  2NVY C;  1BDF A;  2E2H C;  3HOX K;  4A3G K;  1R9T K;  4OIQ A;  4QJV A;  4A3C C;  3CQZ K;  3GTK C;  3HOY C;  4Y7N C;  4BY7 C;  5C3E K;  2CW0 A;  4AYB L;  3RZD K;  5TMC A;  3H0G K;  2PPB A;  2YU9 K;  2JA8 K;  3RZO C;  1I50 K;  4C3I K;  4A3F C;  3I4N K;  3M3Y C;  1K83 K;  2NVT K;  1ZYR A;  1K83 C;  2NVT C;  1Y1V K;  4LK0 A;  2A6E A;  4A3F K;  3I4N C;  1Y1W K;  1I50 C;  4KN7 A;  4Y52 C;  3GTQ C;  3H3V L;  2R92 C;  3HOW C;  1XPP A;  4A3D C;  2NVQ K;  5TMF A;  4AYB D;  3S1R C;  3HOY K;  3HOZ C;  3PO3 C;  2VUM C;  4BY7 K;  3FKI C;  4A3J C;  4NOI A;  1I6V A;  4MEX A;  2NVY K;  3FKI K;  4QIW D;  2PMZ L;  4BBR C;  4G7H A;  4A3J K;  2WB1 D;  4A3K K;  4LK1 A;  3PO3 K;  4A3B C;  3GTJ K;  1TWA C;  2O5J A;  4A3I C;  2NVX K;  2R92 K;  3GTL C;  3S1N K;  4Y52 K;  4A3M C;  4YFX A;  4A3E C;  4YFK A;  4OIO A;  2E2I K;  3PO2 K;  3S14 C;  3RZO K;  4X6A K;  4X6A C;  3S14 K;  1I3Q K;  4Y7N K;  1SMY A;  4KMU A;  3GTO K;  3HOV K;  3EQL A;  4QIW L;  2JA5 C;  4YFN A;  4A3L K;  1R9T C;  1TWC C;  4C2M K;  3H3V D;  3S1N C;  5IYD C;  2A69 A;  1WCM K;  4A3B K;  4A93 C;  5IYB K;  2WAQ D;  3HOU K;  3S1M K;  4A3L C;  3S2H C;  5M5W K;  3GTP K;  3M4O K;  5FJ8 K;  1TWF K;  4LLG A;  5C44 C;  2JA7 K;  4OIR A;  2NVQ C;  3K7A C;  3S15 K;  2PA8 L;  2A6H A;  4BY1 C;  1TWH C;  5M3M K;  2A68 A;  1Y1W C;  3GTQ K;  3HOW K;  1TWG K;  5FLM K;  2O5I A;  3S2D C;  3S1Q K;  4G7O A;  2R93 C;  3S17 C;  1I6H K;  3S2D K;  3S1Q C;  5M5X K;  1TWH K;  4BBS K;  4C3H K;  5D4D A;  2JA8 C;  2B63 C;  5C3E C;  3RZD C;  4GZY A;  5IP9 K;  3CQZ C;  3GTK K;  5M5Y K;  3HOX C;  1HQM A;  4Q5S A;  5IP7 K;  2E2J K;  2BE5 A;  4JK1 A;  3HKZ D;  3HKZ L;  5C4J K;  4XLP A;  4Q4Z A;  2R7Z C;  1IW7 A;  5C4X K;  1TWC K;  3S16 K;  1SFO C;  4C3J K;  3GTG C;  5IP9 C;  3S2H K;  3I4M K;  4G7Z A;  2Y0S D;  3I4M C;  2E2I C;  3PO2 C;  4YG2 A;  3S17 K;  2PA8 D;  4A3G C;  2R93 K;  3GTG K;  1TWG C;  1SFO K;  4A3E K;  5C4X C;  1YNJ A;  4XSX A;  5IYC K;  4XLN A;  5C4J C;  4OIP A;  5M3F K;  3K7A K;  4BXX K;  2JA7 C;  4BBR K;  1YNN A;  2JA6 C;  3GTP C;  3GTM K;  3M4O C;  4OIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...