3RZOK

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzoK00
2NVYC 5M3FK 1I50K 2JA8C 4A3DC 4Y7NK 2VUMC 3GTGC 4GZYA 3GTQK 2CW0A 2R7ZC 1TWCC 4C2MK 4A3BC 4A3CK 4YFNA 4XLPA 4Q4ZA 4OIQA 3S17K 1XPPA 2YU9C 5M5YK 1R9TK 1K83K 1WCMC 1TWAK 3S2DC 1SMYA 2NVQK 3PO3C 4A3GK 4YFXA 4A3IK 2JA7K 2JA7C 2JA6K 2R93K 3I4MC 2JA5C 3GTPK 1TWHK 3RZOC 3S1RC 3GTOC 3GTGK 1TWFC 2E2IK 2B63C 1I3QC 3FKIC 3GTMC 2Y0SL 3K7AK 2YU9K 5M5XK 2E2JC 3DXJA 5IYDC 4BXXK 4JK1A 1I6HK 3S2DK 3PO3K 2A6EA 4YFKA 2WAQL 3HKZD 4LK0A 3HOVC 3S1QK 3GTOK 4BY7K 3GTJK 5FJ8K 1TWFK 1I3QK 5FLMC 2PMZD 4KN7A 4C3JK 3GTMK 3S15C 2A68A 3M4OC 4AYBD 2E2HK 4BBSK 5C44K 3I4NC 1SFOC 4QIWL 4A93C 5IYBK 3HOVK 3PO2C 2R92C 2NVYK 2JA8K 3HOYC 4A3DK 2PA8D 1TWGC 2WB1D 2VUMK 1ZYRA 4MEYA 1I6VA 1TWCK 5FLMK 2O5IA 2R7ZK 4G7ZA 3M3YC 4A3BK 5IP9C 1BDFA 3S15K 3M4OK 1Y1WC 4A3FC 4A3MC 4BBRC 1WCMK 4MEXA 1YNNA 2PPBA 4Q5SA 5C3EC 4A93K 2A69A 2PMZL 2R92K 3HOWC 3I4MK 4X6AC 2JA5K 4OINA 3HOXC 3S1MC 3RZOK 3S1RK 5IYCC 1HQMA 2B63K 3FKIK 4A3KC 3H3VD 4OIOA 5IP9K 3S1NC 4BY1C 4A3LC 5M5WK 1Y1WK 4A3FK 2E2JK 3EQLA 4A3EC 4A3MK 5IYDK 3S14C 1I50C 4MQ9A 5C4XC 5D4DA 5C4JC 3S16C 4LJZA 3HOUC 3S2HC 1K83C 3H0GC 4OIRA 4LLGA 4A3KK 2NVQC 2Y0SD 4ZH4A 4BY1K 2NVTC 4A3GC 2BE5A 4XSZA 2JA6C 3HKZL 3HOZC 2R93C 3S14K 4Y52C 5IP7C 3GTPC 1TWHC 5C4XK 4XSXA 2NVXC 3S16K 5C4JK 2A6HA 2WAQD 1SFOK 2E2IC 3RZDC 3I4NK 3H3VL 3PO2K 4YG2A 2O5JA 4A3JC 3HOYK 3HOUK 4G7OA 1IW7A 3K7AC 4QJVB 3S2HK 1TWGK 3CQZC 3H0GK 4KMUA 3GTKC 1I6HC 3M3YK 4BXXC 4AYBL 4NOIA 4G7HA 2NVTK 5TMCA 3HOZK 3GTLC 3S1QC 1Y1VC 4BBRK 4QJVA 5IP7K 4Y52K 1YNJA 2NVXK 4BY7C 2PA8L 3GTJC 5C3EK 4Y7NC 2WB1L 4QIWD 3RZDK 3GTQC 3HOWK 4A3CC 4A3JK 4XLNA 4X6AK 3HOXK 3S1MK 3S17C 4KN4A 5IYCK 4C3IK 3CQZK 1R9TC 3GTKK 4OIPA 4LK1A 4C3HK 1TWAC 2E2HC 4BBSC 3WODA 3S1NK 5M3MK 5C44C 4A3LK 4A3IC 5IYBC 3GTLK 4A3EK 5TMFA 1Y1VK
chains in the Genus database with same CATH superfamily
4RMFA 2JA8C 5EGEA 3GTOA 4A3DC 4WJ4A 3GTMA 1TWCC 1G51A 3IPJA 4OIQA 1XPPA 5JFEA 4KASA 1IQ0A 2FQOA 1SMYA 4WILA 3BP3A 2JA7K 3I4MC 3GTOC 2VUMA 2E2IK 3GTMC 1EFWA 2YU9K 3DXJA 5IYDC 1V5VA 3PO3K 2A6EA 1C0AA 1EI6A 4LK0A 1YCLA 2JA5A 1TWGA 4BY7K 3GTJK 4BKWA 1TWFK 4GTCA 4KB4A 1I3QK 2PMZD 4KN7A 2KWAA 3TTGA 4C3JK 5JVOA 3M4OC 1B4AA 1DCHA 2PHCB 3LPXA 3FOFA 3HOVK 1VGXA 1TWGC 4MEYA 5FLMK 1ZBSA 3SZZA 1YNNA 2PPBA 1ZXOA 3HOWC 1INNA 3H0GA 1F7VA 3A8IA 3H3VD 4OIOA 4KAWX 4BY1C 1BJTA 5EGHA 1Y1WK 4A3FK 2E2JK 3EQLA 1WOPA 5C4XC 1EK8A 5D4DA 3S16C 2E2IA 1UV7A 3HOUC 3CQZA 3H0GC 4OIRA 2Y0SD 1VRQC 2BE5A 1Y1VA 3HOZC 2ZUFA 4FM9A 3GTJA 2JH3A 5C4JK 3S0XA 1SFOK 2E2IC 3PO2K 2GSNA 4G7OA 1O2FB 3CQZC 3L4KA 2GSUA 4AYBL 4G7HA 3GEIA 2Y3PA 1Y1VC 4BBRK 4QJVA 1GE9A 1IBAA 4J3NA 3GTGA 4BY7C 3GTJC 4Y7NC 2WB1L 4C2MC 4A3JK 4M1XA 1L0WA 5IYCK 3T00A 3TFIA 3GSIA 3GEHA 5E68A 2ZUEA 5TMFA 3FOEA 3GTGC 1USMA 3GTQK 4BLAA 4P9SA 4A3CK 4YFNA 4XLPA 4Q4ZA 3S17K 1WQGA 5IOSA 5M5YK 1R9TK 1TWAK 3S2DC 2NVQK 4A3GK 4YFXA 4KM8A 4LQYA 1KQ4A 1TWCA 3OPFA 2GSOA 5M5XK 2E2JC 1I6HK 4BXXK 1VLOA 4JK1A 1SFOA 2WAQL 3S1QK 4DDQA 2XCOA 4GTAA 4KMHA 3GEEA 4BBSK 5C44K 1SFOC 4QIWL 3PO2C 1XXBA 2NVYK 1ZYRA 2O5IA 1O24A 4G7ZA 3AQOA 3S15K 4BBRC 4MEXA 3OREA 4PAAA 4A93K 4GTDA 2PMZL 1DCPA 2R92K 5IORA 3S1RK 5IYCC 2B63K 1XZQB 3FKIK 4A3KC 5IP9K 3A8JA 4A3MK 3N0BA 1XZPA 1AB4A 3V4GA 3S2HC 4BLBA 3GTKA 4LR2A 2NVQC 1USOA 2NVTC 3Q3QA 4A3GC 4XSZA 3GTLA 4GTLA 3HKZL 3S14K 1WOOA 2A6HA 3I4NK 2O5JA 3RZDC 3H3VL 4YG2A 4KMDA 1IW7A 1JOEA 4QJVB 1O2AA 3HXAA 3GTKC 1I6HC 3M3YK 4BXXC 3NUHA 4NOIA 2JA7A 3BUEA 3S1QC 2NVYA 3GTLC 4Y52K 5IP7K 1YNJA 5IOQA 2NVXK 2PA8L 5C3EK 1XZQA 4C45A 4X6AK 3HOXK 1XXCA 5L46A 2YU9A 3S1MK 4C3IK 2W7VA 4BBSC 3S1NK 5C44C 2GAGC 2JA7C 4A3EK 3CAGA 2NVYC 5M3FK 1I50K 1WQHA 3LAPA 3SZYA 1TWFA 1XXAA 1I3QA 3FKIA 2CW0A 4GTEA 1JQWA 1ZVUA 1PJ6A 2YU9C 1K83K 3PO3C 4PABA 1F7UA 4XCHA 4A3IK 2JA6K 3GTPK 1EH1A 4KB2A 3S1RC 2V6SA 1TWFC 2B63C 1BS2A 1I3QC 3FKIC 4C3JC 3QX3A 3T01A 3K7AK 3AD8C 5HL8A 2P8TA 3HOVC 1O29A 3GTOK 1O2BA 1WSRA 1DD5A 5FLMC 3GTMK 4LOWA 3A8KA 5CJ9A 1Y1WA 1JVIA 4AYBD 3G4AA 3I4NC 1HI9A 3TFHA 5CHPA 3T02A 1O28A 3FHZA 2WB1D 2VUMK 4GT9A 1RU0A 3M3YC 1I6VA 2R7ZK 4A3BK 1IE0A 2ZFZA 1BDFA 3M4OK 1Y1WC 4A3FC 1I50A 1WCMK 4KC6A 3GDZA 5C3EC 1X31C 2CFAA 4X6AC 4KMAA 2JA5K 3HOXC 2RGRA 3RZOK 3S1MC 1K83A 4C3IC 1XZPB 3S1NC 2JA6A 5M5WK 4A3EC 3GTPA 1I50C 4MQ9A 5C4JC 4LJZA 1B4BA 1K83C 3N0CA 5TJ3A 1WORA 4ILDA 4LLGA 4BY1K 3OEPA 2JA6C 3GTPC 5C4XK 3S16K 3GTQA 2WAQD 1DCOA 4A3JC 3HOYK 3HOUK 3K7AC 1R9TA 3AD9C 3H0GK 4KATA 1TWAA 1WIHA 4WJ3M 4G0WA 5TMCA 3HOZK 1ISEA 1J6VA 4P5BA 1WQFA 4QIWD 3GTQC 2R7ZA 4A3CC 4FZBA 2RH6A 3S17C 1R9TC 3CQZK 1WCMA 3AQPA 4C3HK 1TWAC 4GTBA 2GAHC 5M3MK 4A3LK 1O25A 3L4JA 1Y1VK 4KARA 4GTFA 4Y7NK 2VUMC 4GZYA 2R7ZC 4C2MK 4A3BC 4KM9A 2V6TA 1O26A 2EBBA 1WCMC 1J6XA 2R93K 1PJ7A 2JA5C 1TWHK 3RZOC 3GTGK 4GFQA 3MMLB 3GIRA 2Y0SL 1IL2A 1IS1A 3AH5A 1VJEA 3S2DK 4YFKA 3HKZD 2R92A 5FJ8K 2B63A 2D6FC 1ZQ1C 3S15C 2A68A 3VA7A 1J98A 2E2HK 4A93C 3JSTA 5IYBK 1WOSA 2V6UA 5IOTA 2R92C 3HOYC 2JA8K 4A3DK 2PA8D 1TWCK 2CFAB 1O27A 5IP9C 3LAJA 4A3MC 4G0UA 1YX2A 4Q5SA 2A69A 3I4MK 1F93A 4OINA 1HQMA 3BP8C 4C3HC 5IYBC 3N3YA 4A3LC 2R93A 2XCRB 5IYDK 1TWHA 3TFJA 3S14C 2NVXA 2XCQA 4A3KK 4ZH4A 2R93C 4Y52C 5IP7C 1TWHC 4XSXA 2NVXC 1J6WA 1WSVA 4AH6A 1PJ5A 3S2HK 1TWGK 4KMUA 3ADAC 2E2HA 2NVTK 2FQTA 4O2DA 3RZDK 4KDDA 4G0VA 3HOWK 1BGWA 1EQRA 4XLNA 4P5AA 3ERED 4KN4A 3GTKK 2P5MA 4OIPA 4LK1A 2E2HC 3WODA 3AD7C 4A3IC 1VH2A 3GTLK 1F9NA 3G4CA
chains in the Genus database with same CATH topology
2NVYC 5M3FK 1I50K 2JA8C 4A3DC 4Y7NK 2VUMC 3GTGC 4GZYA 3GTQK 2CW0A 2R7ZC 1TWCC 4C2MK 4A3BC 4A3CK 4YFNA 4XLPA 4Q4ZA 4OIQA 3S17K 1XPPA 2YU9C 5M5YK 1R9TK 1K83K 1WCMC 1TWAK 3S2DC 1SMYA 2NVQK 3PO3C 4A3GK 4YFXA 4A3IK 2JA7K 2JA7C 2JA6K 2R93K 3I4MC 2JA5C 3GTPK 1TWHK 3RZOC 3S1RC 3GTOC 3GTGK 1TWFC 2E2IK 2B63C 1I3QC 3FKIC 3GTMC 2Y0SL 3K7AK 2YU9K 5M5XK 2E2JC 3DXJA 5IYDC 4BXXK 4JK1A 1I6HK 3S2DK 3PO3K 2A6EA 4YFKA 2WAQL 3HKZD 4LK0A 3HOVC 3S1QK 3GTOK 4BY7K 3GTJK 5FJ8K 1TWFK 1I3QK 5FLMC 2PMZD 4KN7A 4C3JK 3GTMK 3S15C 2A68A 3M4OC 4AYBD 2E2HK 4BBSK 5C44K 3I4NC 1SFOC 4QIWL 4A93C 5IYBK 3HOVK 3PO2C 2R92C 2NVYK 2JA8K 3HOYC 4A3DK 2PA8D 1TWGC 2WB1D 2VUMK 1ZYRA 4MEYA 1I6VA 1TWCK 5FLMK 2O5IA 2R7ZK 4G7ZA 3M3YC 4A3BK 5IP9C 1BDFA 3S15K 3M4OK 1Y1WC 4A3FC 4A3MC 4BBRC 1WCMK 4MEXA 1YNNA 2PPBA 4Q5SA 5C3EC 4A93K 2A69A 2PMZL 2R92K 3HOWC 3I4MK 4X6AC 2JA5K 4OINA 3HOXC 3S1MC 3RZOK 3S1RK 5IYCC 1HQMA 2B63K 3FKIK 4A3KC 3H3VD 4OIOA 5IP9K 3S1NC 4BY1C 4A3LC 5M5WK 1Y1WK 4A3FK 2E2JK 3EQLA 4A3EC 4A3MK 5IYDK 3S14C 1I50C 4MQ9A 5C4XC 5D4DA 5C4JC 3S16C 4LJZA 3HOUC 3S2HC 1K83C 3H0GC 4OIRA 4LLGA 4A3KK 2NVQC 2Y0SD 4ZH4A 4BY1K 2NVTC 4A3GC 2BE5A 4XSZA 2JA6C 3HKZL 3HOZC 2R93C 3S14K 4Y52C 5IP7C 3GTPC 1TWHC 5C4XK 4XSXA 2NVXC 3S16K 5C4JK 2A6HA 2WAQD 1SFOK 2E2IC 3RZDC 3I4NK 3H3VL 3PO2K 4YG2A 2O5JA 4A3JC 3HOYK 3HOUK 4G7OA 1IW7A 3K7AC 4QJVB 3S2HK 1TWGK 3CQZC 3H0GK 4KMUA 3GTKC 1I6HC 3M3YK 4BXXC 4AYBL 4NOIA 4G7HA 2NVTK 5TMCA 3HOZK 3GTLC 3S1QC 1Y1VC 4BBRK 4QJVA 5IP7K 4Y52K 1YNJA 2NVXK 4BY7C 2PA8L 3GTJC 5C3EK 4Y7NC 2WB1L 4QIWD 3RZDK 3GTQC 3HOWK 4A3CC 4A3JK 4XLNA 4X6AK 3HOXK 3S1MK 3S17C 4KN4A 5IYCK 4C3IK 3CQZK 1R9TC 3GTKK 4OIPA 4LK1A 4C3HK 1TWAC 2E2HC 4BBSC 3WODA 3S1NK 5M3MK 5C44C 4A3LK 4A3IC 5IYBC 3GTLK 4A3EK 5TMFA 1Y1VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY C;  5M3F K;  1I50 K;  2JA8 C;  4A3D C;  4Y7N K;  2VUM C;  3GTG C;  4GZY A;  3GTQ K;  2CW0 A;  2R7Z C;  1TWC C;  4C2M K;  4A3B C;  4A3C K;  4YFN A;  4XLP A;  4Q4Z A;  4OIQ A;  3S17 K;  1XPP A;  2YU9 C;  5M5Y K;  1R9T K;  1K83 K;  1WCM C;  1TWA K;  3S2D C;  1SMY A;  2NVQ K;  3PO3 C;  4A3G K;  4YFX A;  4A3I K;  2JA7 K;  2JA7 C;  2JA6 K;  2R93 K;  3I4M C;  2JA5 C;  3GTP K;  1TWH K;  3RZO C;  3S1R C;  3GTO C;  3GTG K;  1TWF C;  2E2I K;  2B63 C;  1I3Q C;  3FKI C;  3GTM C;  2Y0S L;  3K7A K;  2YU9 K;  5M5X K;  2E2J C;  3DXJ A;  5IYD C;  4BXX K;  4JK1 A;  1I6H K;  3S2D K;  3PO3 K;  2A6E A;  4YFK A;  2WAQ L;  3HKZ D;  4LK0 A;  3HOV C;  3S1Q K;  3GTO K;  4BY7 K;  3GTJ K;  5FJ8 K;  1TWF K;  1I3Q K;  5FLM C;  2PMZ D;  4KN7 A;  4C3J K;  3GTM K;  3S15 C;  2A68 A;  3M4O C;  4AYB D;  2E2H K;  4BBS K;  5C44 K;  3I4N C;  1SFO C;  4QIW L;  4A93 C;  5IYB K;  3HOV K;  3PO2 C;  2R92 C;  2NVY K;  2JA8 K;  3HOY C;  4A3D K;  2PA8 D;  1TWG C;  2WB1 D;  2VUM K;  1ZYR A;  4MEY A;  1I6V A;  1TWC K;  5FLM K;  2O5I A;  2R7Z K;  4G7Z A;  3M3Y C;  4A3B K;  5IP9 C;  1BDF A;  3S15 K;  3M4O K;  1Y1W C;  4A3F C;  4A3M C;  4BBR C;  1WCM K;  4MEX A;  1YNN A;  2PPB A;  4Q5S A;  5C3E C;  4A93 K;  2A69 A;  2PMZ L;  2R92 K;  3HOW C;  3I4M K;  4X6A C;  2JA5 K;  4OIN A;  3HOX C;  3S1M C;  3RZO K;  3S1R K;  5IYC C;  1HQM A;  2B63 K;  3FKI K;  4A3K C;  3H3V D;  4OIO A;  5IP9 K;  3S1N C;  4BY1 C;  4A3L C;  5M5W K;  1Y1W K;  4A3F K;  2E2J K;  3EQL A;  4A3E C;  4A3M K;  5IYD K;  3S14 C;  1I50 C;  4MQ9 A;  5C4X C;  5D4D A;  5C4J C;  3S16 C;  4LJZ A;  3HOU C;  3S2H C;  1K83 C;  3H0G C;  4OIR A;  4LLG A;  4A3K K;  2NVQ C;  2Y0S D;  4ZH4 A;  4BY1 K;  2NVT C;  4A3G C;  2BE5 A;  4XSZ A;  2JA6 C;  3HKZ L;  3HOZ C;  2R93 C;  3S14 K;  4Y52 C;  5IP7 C;  3GTP C;  1TWH C;  5C4X K;  4XSX A;  2NVX C;  3S16 K;  5C4J K;  2A6H A;  2WAQ D;  1SFO K;  2E2I C;  3RZD C;  3I4N K;  3H3V L;  3PO2 K;  4YG2 A;  2O5J A;  4A3J C;  3HOY K;  3HOU K;  4G7O A;  1IW7 A;  3K7A C;  4QJV B;  3S2H K;  1TWG K;  3CQZ C;  3H0G K;  4KMU A;  3GTK C;  1I6H C;  3M3Y K;  4BXX C;  4AYB L;  4NOI A;  4G7H A;  2NVT K;  5TMC A;  3HOZ K;  3GTL C;  3S1Q C;  1Y1V C;  4BBR K;  4QJV A;  5IP7 K;  4Y52 K;  1YNJ A;  2NVX K;  4BY7 C;  2PA8 L;  3GTJ C;  5C3E K;  4Y7N C;  2WB1 L;  4QIW D;  3RZD K;  3GTQ C;  3HOW K;  4A3C C;  4A3J K;  4XLN A;  4X6A K;  3HOX K;  3S1M K;  3S17 C;  4KN4 A;  5IYC K;  4C3I K;  3CQZ K;  1R9T C;  3GTK K;  4OIP A;  4LK1 A;  4C3H K;  1TWA C;  2E2H C;  4BBS C;  3WOD A;  3S1N K;  5M3M K;  5C44 C;  4A3L K;  4A3I C;  5IYB C;  3GTL K;  4A3E K;  5TMF A;  1Y1V K; 
#chains in the Genus database with same CATH topology
 4RMF A;  2JA8 C;  5EGE A;  3GTO A;  4A3D C;  4WJ4 A;  3GTM A;  1TWC C;  1G51 A;  3IPJ A;  4OIQ A;  1XPP A;  5JFE A;  4KAS A;  1IQ0 A;  2FQO A;  1SMY A;  4WIL A;  3BP3 A;  2JA7 K;  3I4M C;  3GTO C;  2VUM A;  2E2I K;  3GTM C;  1EFW A;  2YU9 K;  3DXJ A;  5IYD C;  1V5V A;  3PO3 K;  2A6E A;  1C0A A;  1EI6 A;  4LK0 A;  1YCL A;  2JA5 A;  1TWG A;  4BY7 K;  3GTJ K;  4BKW A;  1TWF K;  4GTC A;  4KB4 A;  1I3Q K;  2PMZ D;  4KN7 A;  2KWA A;  3TTG A;  4C3J K;  5JVO A;  3M4O C;  1B4A A;  1DCH A;  2PHC B;  3LPX A;  3FOF A;  3HOV K;  1VGX A;  1TWG C;  4MEY A;  5FLM K;  1ZBS A;  3SZZ A;  1YNN A;  2PPB A;  1ZXO A;  3HOW C;  1INN A;  3H0G A;  1F7V A;  3A8I A;  3H3V D;  4OIO A;  4KAW X;  4BY1 C;  1BJT A;  5EGH A;  1Y1W K;  4A3F K;  2E2J K;  3EQL A;  1WOP A;  5C4X C;  1EK8 A;  5D4D A;  3S16 C;  2E2I A;  1UV7 A;  3HOU C;  3CQZ A;  3H0G C;  4OIR A;  2Y0S D;  1VRQ C;  2BE5 A;  1Y1V A;  3HOZ C;  2ZUF A;  4FM9 A;  3GTJ A;  2JH3 A;  5C4J K;  3S0X A;  1SFO K;  2E2I C;  3PO2 K;  2GSN A;  4G7O A;  1O2F B;  3CQZ C;  3L4K A;  2GSU A;  4AYB L;  4G7H A;  3GEI A;  2Y3P A;  1Y1V C;  4BBR K;  4QJV A;  1GE9 A;  1IBA A;  4J3N A;  3GTG A;  4BY7 C;  3GTJ C;  4Y7N C;  2WB1 L;  4C2M C;  4A3J K;  4M1X A;  1L0W A;  5IYC K;  3T00 A;  3TFI A;  3GSI A;  3GEH A;  5E68 A;  2ZUE A;  5TMF A;  3FOE A;  3GTG C;  1USM A;  3GTQ K;  4BLA A;  4P9S A;  4A3C K;  4YFN A;  4XLP A;  4Q4Z A;  3S17 K;  1WQG A;  5IOS A;  5M5Y K;  1R9T K;  1TWA K;  3S2D C;  2NVQ K;  4A3G K;  4YFX A;  4KM8 A;  4LQY A;  1KQ4 A;  1TWC A;  3OPF A;  2GSO A;  5M5X K;  2E2J C;  1I6H K;  4BXX K;  1VLO A;  4JK1 A;  1SFO A;  2WAQ L;  3S1Q K;  4DDQ A;  2XCO A;  4GTA A;  4KMH A;  3GEE A;  4BBS K;  5C44 K;  1SFO C;  4QIW L;  3PO2 C;  1XXB A;  2NVY K;  1ZYR A;  2O5I A;  1O24 A;  4G7Z A;  3AQO A;  3S15 K;  4BBR C;  4MEX A;  3ORE A;  4PAA A;  4A93 K;  4GTD A;  2PMZ L;  1DCP A;  2R92 K;  5IOR A;  3S1R K;  5IYC C;  2B63 K;  1XZQ B;  3FKI K;  4A3K C;  5IP9 K;  3A8J A;  4A3M K;  3N0B A;  1XZP A;  1AB4 A;  3V4G A;  3S2H C;  4BLB A;  3GTK A;  4LR2 A;  2NVQ C;  1USO A;  2NVT C;  3Q3Q A;  4A3G C;  4XSZ A;  3GTL A;  4GTL A;  3HKZ L;  3S14 K;  1WOO A;  2A6H A;  3I4N K;  2O5J A;  3RZD C;  3H3V L;  4YG2 A;  4KMD A;  1IW7 A;  1JOE A;  4QJV B;  1O2A A;  3HXA A;  3GTK C;  1I6H C;  3M3Y K;  4BXX C;  3NUH A;  4NOI A;  2JA7 A;  3BUE A;  3S1Q C;  2NVY A;  3GTL C;  4Y52 K;  5IP7 K;  1YNJ A;  5IOQ A;  2NVX K;  2PA8 L;  5C3E K;  1XZQ A;  4C45 A;  4X6A K;  3HOX K;  1XXC A;  5L46 A;  2YU9 A;  3S1M K;  4C3I K;  2W7V A;  4BBS C;  3S1N K;  5C44 C;  2GAG C;  2JA7 C;  4A3E K;  3CAG A;  2NVY C;  5M3F K;  1I50 K;  1WQH A;  3LAP A;  3SZY A;  1TWF A;  1XXA A;  1I3Q A;  3FKI A;  2CW0 A;  4GTE A;  1JQW A;  1ZVU A;  1PJ6 A;  2YU9 C;  1K83 K;  3PO3 C;  4PAB A;  1F7U A;  4XCH A;  4A3I K;  2JA6 K;  3GTP K;  1EH1 A;  4KB2 A;  3S1R C;  2V6S A;  1TWF C;  2B63 C;  1BS2 A;  1I3Q C;  3FKI C;  4C3J C;  3QX3 A;  3T01 A;  3K7A K;  3AD8 C;  5HL8 A;  2P8T A;  3HOV C;  1O29 A;  3GTO K;  1O2B A;  1WSR A;  1DD5 A;  5FLM C;  3GTM K;  4LOW A;  3A8K A;  5CJ9 A;  1Y1W A;  1JVI A;  4AYB D;  3G4A A;  3I4N C;  1HI9 A;  3TFH A;  5CHP A;  3T02 A;  1O28 A;  3FHZ A;  2WB1 D;  2VUM K;  4GT9 A;  1RU0 A;  3M3Y C;  1I6V A;  2R7Z K;  4A3B K;  1IE0 A;  2ZFZ A;  1BDF A;  3M4O K;  1Y1W C;  4A3F C;  1I50 A;  1WCM K;  4KC6 A;  3GDZ A;  5C3E C;  1X31 C;  2CFA A;  4X6A C;  4KMA A;  2JA5 K;  3HOX C;  2RGR A;  3RZO K;  3S1M C;  1K83 A;  4C3I C;  1XZP B;  3S1N C;  2JA6 A;  5M5W K;  4A3E C;  3GTP A;  1I50 C;  4MQ9 A;  5C4J C;  4LJZ A;  1B4B A;  1K83 C;  3N0C A;  5TJ3 A;  1WOR A;  4ILD A;  4LLG A;  4BY1 K;  3OEP A;  2JA6 C;  3GTP C;  5C4X K;  3S16 K;  3GTQ A;  2WAQ D;  1DCO A;  4A3J C;  3HOY K;  3HOU K;  3K7A C;  1R9T A;  3AD9 C;  3H0G K;  4KAT A;  1TWA A;  1WIH A;  4WJ3 M;  4G0W A;  5TMC A;  3HOZ K;  1ISE A;  1J6V A;  4P5B A;  1WQF A;  4QIW D;  3GTQ C;  2R7Z A;  4A3C C;  4FZB A;  2RH6 A;  3S17 C;  1R9T C;  3CQZ K;  1WCM A;  3AQP A;  4C3H K;  1TWA C;  4GTB A;  2GAH C;  5M3M K;  4A3L K;  1O25 A;  3L4J A;  1Y1V K;  4KAR A;  4GTF A;  4Y7N K;  2VUM C;  4GZY A;  2R7Z C;  4C2M K;  4A3B C;  4KM9 A;  2V6T A;  1O26 A;  2EBB A;  1WCM C;  1J6X A;  2R93 K;  1PJ7 A;  2JA5 C;  1TWH K;  3RZO C;  3GTG K;  4GFQ A;  3MML B;  3GIR A;  2Y0S L;  1IL2 A;  1IS1 A;  3AH5 A;  1VJE A;  3S2D K;  4YFK A;  3HKZ D;  2R92 A;  5FJ8 K;  2B63 A;  2D6F C;  1ZQ1 C;  3S15 C;  2A68 A;  3VA7 A;  1J98 A;  2E2H K;  4A93 C;  3JST A;  5IYB K;  1WOS A;  2V6U A;  5IOT A;  2R92 C;  3HOY C;  2JA8 K;  4A3D K;  2PA8 D;  1TWC K;  2CFA B;  1O27 A;  5IP9 C;  3LAJ A;  4A3M C;  4G0U A;  1YX2 A;  4Q5S A;  2A69 A;  3I4M K;  1F93 A;  4OIN A;  1HQM A;  3BP8 C;  4C3H C;  5IYB C;  3N3Y A;  4A3L C;  2R93 A;  2XCR B;  5IYD K;  1TWH A;  3TFJ A;  3S14 C;  2NVX A;  2XCQ A;  4A3K K;  4ZH4 A;  2R93 C;  4Y52 C;  5IP7 C;  1TWH C;  4XSX A;  2NVX C;  1J6W A;  1WSV A;  4AH6 A;  1PJ5 A;  3S2H K;  1TWG K;  4KMU A;  3ADA C;  2E2H A;  2NVT K;  2FQT A;  4O2D A;  3RZD K;  4KDD A;  4G0V A;  3HOW K;  1BGW A;  1EQR A;  4XLN A;  4P5A A;  3ERE D;  4KN4 A;  3GTK K;  2P5M A;  4OIP A;  4LK1 A;  2E2H C;  3WOD A;  3AD7 C;  4A3I C;  1VH2 A;  3GTL K;  1F9N A;  3G4C A; 
#chains in the Genus database with same CATH homology
 2NVY C;  5M3F K;  1I50 K;  2JA8 C;  4A3D C;  4Y7N K;  2VUM C;  3GTG C;  4GZY A;  3GTQ K;  2CW0 A;  2R7Z C;  1TWC C;  4C2M K;  4A3B C;  4A3C K;  4YFN A;  4XLP A;  4Q4Z A;  4OIQ A;  3S17 K;  1XPP A;  2YU9 C;  5M5Y K;  1R9T K;  1K83 K;  1WCM C;  1TWA K;  3S2D C;  1SMY A;  2NVQ K;  3PO3 C;  4A3G K;  4YFX A;  4A3I K;  2JA7 K;  2JA7 C;  2JA6 K;  2R93 K;  3I4M C;  2JA5 C;  3GTP K;  1TWH K;  3RZO C;  3S1R C;  3GTO C;  3GTG K;  1TWF C;  2E2I K;  2B63 C;  1I3Q C;  3FKI C;  3GTM C;  2Y0S L;  3K7A K;  2YU9 K;  5M5X K;  2E2J C;  3DXJ A;  5IYD C;  4BXX K;  4JK1 A;  1I6H K;  3S2D K;  3PO3 K;  2A6E A;  4YFK A;  2WAQ L;  3HKZ D;  4LK0 A;  3HOV C;  3S1Q K;  3GTO K;  4BY7 K;  3GTJ K;  5FJ8 K;  1TWF K;  1I3Q K;  5FLM C;  2PMZ D;  4KN7 A;  4C3J K;  3GTM K;  3S15 C;  2A68 A;  3M4O C;  4AYB D;  2E2H K;  4BBS K;  5C44 K;  3I4N C;  1SFO C;  4QIW L;  4A93 C;  5IYB K;  3HOV K;  3PO2 C;  2R92 C;  2NVY K;  2JA8 K;  3HOY C;  4A3D K;  2PA8 D;  1TWG C;  2WB1 D;  2VUM K;  1ZYR A;  4MEY A;  1I6V A;  1TWC K;  5FLM K;  2O5I A;  2R7Z K;  4G7Z A;  3M3Y C;  4A3B K;  5IP9 C;  1BDF A;  3S15 K;  3M4O K;  1Y1W C;  4A3F C;  4A3M C;  4BBR C;  1WCM K;  4MEX A;  1YNN A;  2PPB A;  4Q5S A;  5C3E C;  4A93 K;  2A69 A;  2PMZ L;  2R92 K;  3HOW C;  3I4M K;  4X6A C;  2JA5 K;  4OIN A;  3HOX C;  3S1M C;  3RZO K;  3S1R K;  5IYC C;  1HQM A;  2B63 K;  3FKI K;  4A3K C;  3H3V D;  4OIO A;  5IP9 K;  3S1N C;  4BY1 C;  4A3L C;  5M5W K;  1Y1W K;  4A3F K;  2E2J K;  3EQL A;  4A3E C;  4A3M K;  5IYD K;  3S14 C;  1I50 C;  4MQ9 A;  5C4X C;  5D4D A;  5C4J C;  3S16 C;  4LJZ A;  3HOU C;  3S2H C;  1K83 C;  3H0G C;  4OIR A;  4LLG A;  4A3K K;  2NVQ C;  2Y0S D;  4ZH4 A;  4BY1 K;  2NVT C;  4A3G C;  2BE5 A;  4XSZ A;  2JA6 C;  3HKZ L;  3HOZ C;  2R93 C;  3S14 K;  4Y52 C;  5IP7 C;  3GTP C;  1TWH C;  5C4X K;  4XSX A;  2NVX C;  3S16 K;  5C4J K;  2A6H A;  2WAQ D;  1SFO K;  2E2I C;  3RZD C;  3I4N K;  3H3V L;  3PO2 K;  4YG2 A;  2O5J A;  4A3J C;  3HOY K;  3HOU K;  4G7O A;  1IW7 A;  3K7A C;  4QJV B;  3S2H K;  1TWG K;  3CQZ C;  3H0G K;  4KMU A;  3GTK C;  1I6H C;  3M3Y K;  4BXX C;  4AYB L;  4NOI A;  4G7H A;  2NVT K;  5TMC A;  3HOZ K;  3GTL C;  3S1Q C;  1Y1V C;  4BBR K;  4QJV A;  5IP7 K;  4Y52 K;  1YNJ A;  2NVX K;  4BY7 C;  2PA8 L;  3GTJ C;  5C3E K;  4Y7N C;  2WB1 L;  4QIW D;  3RZD K;  3GTQ C;  3HOW K;  4A3C C;  4A3J K;  4XLN A;  4X6A K;  3HOX K;  3S1M K;  3S17 C;  4KN4 A;  5IYC K;  4C3I K;  3CQZ K;  1R9T C;  3GTK K;  4OIP A;  4LK1 A;  4C3H K;  1TWA C;  2E2H C;  4BBS C;  3WOD A;  3S1N K;  5M3M K;  5C44 C;  4A3L K;  4A3I C;  5IYB C;  3GTL K;  4A3E K;  5TMF A;  1Y1V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...