3RZOK

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3rzoK00
4GZYA 3WODA 3S14C 4MQ9A 4A3FC 4BBSC 4A3BK 4A3CC 2YU9C 4A3IK 3HOYK 5IYDC 3GTPC 4C2MK 3HOUC 5IP9C 2R93C 2PA8L 1I50C 3PO3C 3M4OC 3S1MC 4JK1A 1I6VA 4YFXA 1SFOC 3GTQK 1Y1VC 4A3EC 3PO2K 4YFNA 2NVXC 4A93C 2JA5C 2WAQD 4BXXC 4QIWD 4X6AK 5M5WK 1Y1WC 1SMYA 3S17K 3I4MK 4A3LK 4Y7NC 4KMUA 2BE5A 3FKIK 1HQMA 2WB1D 3CQZK 4BY1K 3GTMK 3S2DC 3S15K 4QIWL 3HOZK 1TWCC 4QJVA 4A3JK 3GTLC 2B63C 2A68A 4A3MK 2E2JK 3GTOC 3S2HK 3M3YC 4BBSK 3RZDK 4A3KC 4A3DK 3S16C 4BBRC 5M5XK 2R7ZC 3H0GK 3H3VL 2PA8D 3GTPK 5IYDK 4OIOA 3EQLA 4AYBL 4LK1A 1I50K 4LK0A 4XLNA 3PO3K 3S1MK 2Y0SL 4LJZA 1SFOK 2A69A 1Y1VK 3PO2C 2NVXK 5FLMK 2JA5K 3K7AC 2CW0A 2NVYC 4A3BC 1XPPA 5TMCA 3HKZD 5IYBK 2YU9K 2NVQC 3DXJA 2VUMC 2PPBA 3HOYC 4ZH4A 5IP9K 4BY1C 5C3EC 5IP7C 5C4JK 2NVTK 3S15C 4Q5SA 3S1QC 1TWCK 3S1RC 3HOVC 2B63K 1TWHC 4A3MC 1R9TK 3GTJC 2E2JC 5M3MK 3GTOK 3RZOC 3S2HC 1Y1WK 3S1NK 3S17C 2R7ZK 4Q4ZA 4C3IK 1I3QC 3I4MC 4Y7NK 3FKIC 4OINA 3S2DK 1I6HK 4Y52C 2PMZD 4A3JC 1WCMK 3M3YK 5TMFA 4A3KK 3K7AK 4A3DC 4KN7A 4C3JK 3HOWC 2WAQL 5C3EK 1IW7A 3GTKK 4MEXA 4OIPA 2E2IC 5C4JC 4XLPA 2E2HC 2JA8K 2NVTC 2JA7K 3S1RK 3I4NC 1TWAC 2R92C 3HOVK 3S1QK 2O5JA 2WB1L 4YG2A 1TWGK 3HOXC 1K83K 4NOIA 2JA6C 2NVYK 3RZOK 5C4XC 5IYBC 2NVQK 2VUMK 4C3HK 4XSZA 5IP7K 4Y52K 3H3VD 4BY7K 1WCMC 1TWHK 1R9TC 3GTJK 4MEYA 4QJVB 4A3FK 4LLGA 4OIRA 3S1NC 4A3CK 2Y0SD 4A3IC 1I3QK 4YFKA 5D4DA 3GTGK 3HOUK 4A3GK 1I6HC 1TWFC 1ZYRA 5C44C 2O5IA 3GTKC 2R93K 2E2IK 5IYCK 5FLMC 2E2HK 2JA8C 3I4NK 2JA7C 4X6AC 1TWAK 3S14K 3GTQC 4BXXK 1YNNA 2PMZL 3HOXK 5M3FK 1K83C 2A6HA 5FJ8K 1YNJA 3HOWK 1BDFA 3CQZC 4G7OA 4KN4A 4OIQA 4G7ZA 5M5YK 3M4OK 3HKZL 2R92K 4A93K 4BY7C 4A3EK 1TWGC 2JA6K 4XSXA 3RZDC 5C4XK 3S16K 4BBRK 3H0GC 4G7HA 4AYBD 4A3LC 3GTMC 3GTGC 4A3GC 2A6EA 1TWFK 5C44K 3HOZC 5IYCC 3GTLK
chains in the Genus database with same CATH superfamily
4GZYA 2P5MA 1G51A 1IE0A 1O26A 3GTQA 3T01A 2FQTA 1O25A 1XZPA 2YU9A 4A3CC 5IOTA 3HOYK 4LOWA 2R93C 2PA8L 1V5VA 3PO2K 4AH6A 2JA5C 1F93A 1SMYA 3S17K 3SZZA 4Y7NC 3GTMK 3S15K 4A3JK 2B63C 3JSTA 2A68A 3AD9C 4A3MK 1USMA 1WQGA 3AQOA 4BBSK 2R92A 4A3KC 4A3DK 3S16C 4BBRC 5M5XK 3H3VL 1F9NA 3GIRA 4LK1A 1Y1VK 3G4AA 5FLMK 4GFQA 2CW0A 3TFHA 3HOYC 5IORA 4C3JC 3FOFA 5C3EC 3LAPA 4J3NA 1JQWA 1TWCK 4DDQA 1R9TK 2E2JC 3GTJC 5L46A 3LPXA 1HI9A 3S17C 4Q4ZA 4GTAA 1GE9A 4Y7NK 4A3JC 1L0WA 3AD7C 4A3KK 4A3DC 3K7AK 4KN7A 1XZPB 1EH1A 2E2IC 2NVTC 3S1QK 4YG2A 1K83K 4NOIA 3RZOK 2D6FC 1DCPA 3CQZA 1IL2A 4XSZA 4Y52K 4WJ3M 2V6UA 2E2HA 1R9TC 3GTJK 1JOEA 3QX3A 3HXAA 4A3IC 4YFKA 5D4DA 3HOUK 1WSRA 1ZYRA 3I4NK 4X6AC 2E2HK 2JA7C 1TWAK 4BXXK 1YNNA 5M3FK 4KB4A 1WCMA 3A8IA 4G0WA 2XCQA 1INNA 3VA7A 4KM9A 3NUHA 1BDFA 2B63A 4G7ZA 3M4OK 3HKZL 4BY7C 3G4CA 1WOOA 2NVYA 4AYBD 4A3GC 5C44K 3IPJA 4P9SA 3GTLK 3WODA 3S14C 5CHPA 2V6TA 4A3BK 2YU9C 4A3IK 1VGXA 3GEIA 3HOUC 1I3QA 1I50C 1TWCA 3A8JA 3S1MC 4JK1A 4YFXA 1SFOC 4BXXC 2NVXC 4P5BA 1R9TA 3GEEA 3LAJA 1RU0A 4KMUA 4BY1K 3FKIK 2WB1D 1Y1VA 3AH5A 4QJVA 3S2HK 2V6SA 1PJ6A 2PA8D 3FHZA 3BUEA 3L4KA 1O24A 1XXBA 1VH2A 3PO2C 2JA5K 3GTOA 3SZYA 5E68A 4A3BC 5TMCA 2YU9K 2VUMC 1BS2A 2ZFZA 3OEPA 1DCOA 3S15C 3S1RC 1O27A 2B63K 4A3MC 3GTJA 5M3MK 5JVOA 2P8TA 3S1NK 1AB4A 3FKIC 1EI6A 1I6HK 1TWAA 2PMZD 1PJ7A 1WCMK 3AQPA 1IS1A 3ERED 3ADAC 1O29A 4C3JK 5IOSA 5C3EK 1IW7A 3GTKK 4MEXA 2JA8K 1IQ0A 2O5JA 2R92C 3HOXC 1TWGK 1JVIA 2VUMK 1WOSA 3AD8C 1O2BA 4WILA 1K83A 3S1NC 2Y0SD 1WQFA 4C2MC 1I6HC 1TWFC 2E2IK 3GTQC 1YCLA 1K83C 4M1XA 3GTGA 4KC6A 5M5YK 4KARA 2R92K 4A93K 4A3EK 1TWGC 3RZDC 4KM8A 3H0GC 5CJ9A 1UV7A 4A3LC 3L4JA 2A6EA 3HOZC 4X6AK 3FOEA 4PABA 1XXAA 5IYDC 3GTPC 4C2MK 3FKIA 3GTLA 3PO3C 3M4OC 3GTQK 2PHCB 4YFNA 2WAQD 1ZXOA 4QIWD 1DD5A 1Y1WA 1Y1WC 3I4MK 4C3IC 1USOA 2BE5A 3S2DC 2ZUFA 4QIWL 5IYCC 1J6XA 3GTLC 1C0AA 3GTOC 3CAGA 4LR2A 3M3YC 3RZDK 1WIHA 1WSVA 3MMLB 2R7ZC 3H0GK 5EGHA 4OIOA 4AYBL 2GSNA 1I50K 3S1MK 2Y0SL 1SFOK 2NVXK 3H0GA 3HKZD 5TJ3A 5IYBK 2NVQC 3DXJA 2PPBA 4ZH4A 4BY1C 5C4JK 4Q5SA 4KDDA 3HOVC 1TWHC 3S2HC 2NVXA 4WJ4A 1Y1WK 1J98A 3TFIA 3I4MC 4C3IK 1I3QC 3S2DK 1KQ4A 5EGEA 3BP8C 1IBAA 1XXCA 2XCRB 3M3YK 1VRQC 4XCHA 1O2FB 3HOWC 3N0CA 1O28A 2GAHC 4OIPA 4XLPA 3S1RK 2WB1L 4RMFA 2JA6C 5IYBC 2NVQK 3A8KA 1XZQA 4KMDA 1J6WA 1WCMC 1TWHK 4G0VA 3V4GA 4KB2A 4A3FK 2JA7A 4ILDA 1I3QK 1BJTA 1DCHA 1WQHA 3GTGK 3GTKC 1B4BA 2JA8C 2XCOA 5IYCK 1EQRA 5FLMC 3OPFA 2PMZL 3HOXK 2GSUA 4O2DA 2A6HA 5FJ8K 1YNJA 1EFWA 3HOWK 3Q3QA 3GTMA 4KMAA 3CQZC 2GAGC 4KN4A 4OIQA 4BLAA 2JA6K 4XSXA 3TFJA 2VUMA 4G7HA 3GTMC 3OREA 4KASA 1TWFK 4FZBA 1ZVUA 1WOPA 4MQ9A 4A3FC 4BBSC 3GTKA 1YX2A 5IP9C 3GDZA 1I6VA 4A93C 1Y1VC 4A3EC 5HL8A 5M5WK 2GSOA 4A3LK 3BP3A 1HQMA 3CQZK 3HOZK 1TWCC 2JA6A 2E2JK 1WORA 2W7VA 1EK8A 5IOQA 3S0XA 3N3YA 2EBBA 3GTPK 5IYDK 4BKWA 3EQLA 2CFAA 4LK0A 4XLNA 3PO3K 4LJZA 1TWFA 4LQYA 2A69A 4KMHA 3K7AC 2NVYC 1XPPA 1PJ5A 1O2AA 5IP9K 3TTGA 4GTBA 5IP7C 2NVTK 4P5AA 3S1QC 4G0UA 3GTOK 2JA5A 1TWHA 3RZOC 2R7ZK 2R93A 4BLBA 4OINA 2ZUEA 1ZBSA 4Y52C 3N0BA 1J6VA 4FM9A 3GEHA 3GSIA 5TMFA 2RGRA 2JH3A 4KATA 4KAWX 4GTEA 2WAQL 4GTCA 1BGWA 1VJEA 3I4NC 5C4JC 2R7ZA 2E2HC 2JA7K 1TWAC 3HOVK 1F7VA 1ISEA 2NVYK 5C4XC 4PAAA 4C3HK 4GTLA 5IP7K 1VLOA 1XZQB 2KWAA 3H3VD 3T00A 2E2IA 4BY7K 1ZQ1C 4MEYA 4QJVB 4C45A 4LLGA 4OIRA 4A3CK 4GTDA 4GT9A 1X31C 4A3GK 3GTPA 5C44C 2O5IA 2R93K 1F7UA 2FQOA 3S14K 2Y3PA 2CFAB 4GTFA 2RH6A 3T02A 4G7OA 1TWGA 5JFEA 5C4XK 3S16K 4BBRK 4C3HC 3GTGC 1SFOA 1B4AA 1I50A
chains in the Genus database with same CATH topology
4GZYA 3WODA 3S14C 4MQ9A 4A3FC 4BBSC 4A3BK 4A3CC 2YU9C 4A3IK 3HOYK 5IYDC 3GTPC 4C2MK 3HOUC 5IP9C 2R93C 2PA8L 1I50C 3PO3C 3M4OC 3S1MC 4JK1A 1I6VA 4YFXA 1SFOC 3GTQK 1Y1VC 4A3EC 3PO2K 4YFNA 2NVXC 4A93C 2JA5C 2WAQD 4BXXC 4QIWD 4X6AK 5M5WK 1Y1WC 1SMYA 3S17K 3I4MK 4A3LK 4Y7NC 4KMUA 2BE5A 3FKIK 1HQMA 2WB1D 3CQZK 4BY1K 3GTMK 3S2DC 3S15K 4QIWL 3HOZK 1TWCC 4QJVA 4A3JK 3GTLC 2B63C 2A68A 4A3MK 2E2JK 3GTOC 3S2HK 3M3YC 4BBSK 3RZDK 4A3KC 4A3DK 3S16C 4BBRC 5M5XK 2R7ZC 3H0GK 3H3VL 2PA8D 3GTPK 5IYDK 4OIOA 3EQLA 4AYBL 4LK1A 1I50K 4LK0A 4XLNA 3PO3K 3S1MK 2Y0SL 4LJZA 1SFOK 2A69A 1Y1VK 3PO2C 2NVXK 5FLMK 2JA5K 3K7AC 2CW0A 2NVYC 4A3BC 1XPPA 5TMCA 3HKZD 5IYBK 2YU9K 2NVQC 3DXJA 2VUMC 2PPBA 3HOYC 4ZH4A 5IP9K 4BY1C 5C3EC 5IP7C 5C4JK 2NVTK 3S15C 4Q5SA 3S1QC 1TWCK 3S1RC 3HOVC 2B63K 1TWHC 4A3MC 1R9TK 3GTJC 2E2JC 5M3MK 3GTOK 3RZOC 3S2HC 1Y1WK 3S1NK 3S17C 2R7ZK 4Q4ZA 4C3IK 1I3QC 3I4MC 4Y7NK 3FKIC 4OINA 3S2DK 1I6HK 4Y52C 2PMZD 4A3JC 1WCMK 3M3YK 5TMFA 4A3KK 3K7AK 4A3DC 4KN7A 4C3JK 3HOWC 2WAQL 5C3EK 1IW7A 3GTKK 4MEXA 4OIPA 2E2IC 5C4JC 4XLPA 2E2HC 2JA8K 2NVTC 2JA7K 3S1RK 3I4NC 1TWAC 2R92C 3HOVK 3S1QK 2O5JA 2WB1L 4YG2A 1TWGK 3HOXC 1K83K 4NOIA 2JA6C 2NVYK 3RZOK 5C4XC 5IYBC 2NVQK 2VUMK 4C3HK 4XSZA 5IP7K 4Y52K 3H3VD 4BY7K 1WCMC 1TWHK 1R9TC 3GTJK 4MEYA 4QJVB 4A3FK 4LLGA 4OIRA 3S1NC 4A3CK 2Y0SD 4A3IC 1I3QK 4YFKA 5D4DA 3GTGK 3HOUK 4A3GK 1I6HC 1TWFC 1ZYRA 5C44C 2O5IA 3GTKC 2R93K 2E2IK 5IYCK 5FLMC 2E2HK 2JA8C 3I4NK 2JA7C 4X6AC 1TWAK 3S14K 3GTQC 4BXXK 1YNNA 2PMZL 3HOXK 5M3FK 1K83C 2A6HA 5FJ8K 1YNJA 3HOWK 1BDFA 3CQZC 4G7OA 4KN4A 4OIQA 4G7ZA 5M5YK 3M4OK 3HKZL 2R92K 4A93K 4BY7C 4A3EK 1TWGC 2JA6K 4XSXA 3RZDC 5C4XK 3S16K 4BBRK 3H0GC 4G7HA 4AYBD 4A3LC 3GTMC 3GTGC 4A3GC 2A6EA 1TWFK 5C44K 3HOZC 5IYCC 3GTLK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY A;  3WOD A;  3S14 C;  4MQ9 A;  4A3F C;  4BBS C;  4A3B K;  4A3C C;  2YU9 C;  4A3I K;  3HOY K;  5IYD C;  3GTP C;  4C2M K;  3HOU C;  5IP9 C;  2R93 C;  2PA8 L;  1I50 C;  3PO3 C;  3M4O C;  3S1M C;  4JK1 A;  1I6V A;  4YFX A;  1SFO C;  3GTQ K;  1Y1V C;  4A3E C;  3PO2 K;  4YFN A;  2NVX C;  4A93 C;  2JA5 C;  2WAQ D;  4BXX C;  4QIW D;  4X6A K;  5M5W K;  1Y1W C;  1SMY A;  3S17 K;  3I4M K;  4A3L K;  4Y7N C;  4KMU A;  2BE5 A;  3FKI K;  1HQM A;  2WB1 D;  3CQZ K;  4BY1 K;  3GTM K;  3S2D C;  3S15 K;  4QIW L;  3HOZ K;  1TWC C;  4QJV A;  4A3J K;  3GTL C;  2B63 C;  2A68 A;  4A3M K;  2E2J K;  3GTO C;  3S2H K;  3M3Y C;  4BBS K;  3RZD K;  4A3K C;  4A3D K;  3S16 C;  4BBR C;  5M5X K;  2R7Z C;  3H0G K;  3H3V L;  2PA8 D;  3GTP K;  5IYD K;  4OIO A;  3EQL A;  4AYB L;  4LK1 A;  1I50 K;  4LK0 A;  4XLN A;  3PO3 K;  3S1M K;  2Y0S L;  4LJZ A;  1SFO K;  2A69 A;  1Y1V K;  3PO2 C;  2NVX K;  5FLM K;  2JA5 K;  3K7A C;  2CW0 A;  2NVY C;  4A3B C;  1XPP A;  5TMC A;  3HKZ D;  5IYB K;  2YU9 K;  2NVQ C;  3DXJ A;  2VUM C;  2PPB A;  3HOY C;  4ZH4 A;  5IP9 K;  4BY1 C;  5C3E C;  5IP7 C;  5C4J K;  2NVT K;  3S15 C;  4Q5S A;  3S1Q C;  1TWC K;  3S1R C;  3HOV C;  2B63 K;  1TWH C;  4A3M C;  1R9T K;  3GTJ C;  2E2J C;  5M3M K;  3GTO K;  3RZO C;  3S2H C;  1Y1W K;  3S1N K;  3S17 C;  2R7Z K;  4Q4Z A;  4C3I K;  1I3Q C;  3I4M C;  4Y7N K;  3FKI C;  4OIN A;  3S2D K;  1I6H K;  4Y52 C;  2PMZ D;  4A3J C;  1WCM K;  3M3Y K;  5TMF A;  4A3K K;  3K7A K;  4A3D C;  4KN7 A;  4C3J K;  3HOW C;  2WAQ L;  5C3E K;  1IW7 A;  3GTK K;  4MEX A;  4OIP A;  2E2I C;  5C4J C;  4XLP A;  2E2H C;  2JA8 K;  2NVT C;  2JA7 K;  3S1R K;  3I4N C;  1TWA C;  2R92 C;  3HOV K;  3S1Q K;  2O5J A;  2WB1 L;  4YG2 A;  1TWG K;  3HOX C;  1K83 K;  4NOI A;  2JA6 C;  2NVY K;  3RZO K;  5C4X C;  5IYB C;  2NVQ K;  2VUM K;  4C3H K;  4XSZ A;  5IP7 K;  4Y52 K;  3H3V D;  4BY7 K;  1WCM C;  1TWH K;  1R9T C;  3GTJ K;  4MEY A;  4QJV B;  4A3F K;  4LLG A;  4OIR A;  3S1N C;  4A3C K;  2Y0S D;  4A3I C;  1I3Q K;  4YFK A;  5D4D A;  3GTG K;  3HOU K;  4A3G K;  1I6H C;  1TWF C;  1ZYR A;  5C44 C;  2O5I A;  3GTK C;  2R93 K;  2E2I K;  5IYC K;  5FLM C;  2E2H K;  2JA8 C;  3I4N K;  2JA7 C;  4X6A C;  1TWA K;  3S14 K;  3GTQ C;  4BXX K;  1YNN A;  2PMZ L;  3HOX K;  5M3F K;  1K83 C;  2A6H A;  5FJ8 K;  1YNJ A;  3HOW K;  1BDF A;  3CQZ C;  4G7O A;  4KN4 A;  4OIQ A;  4G7Z A;  5M5Y K;  3M4O K;  3HKZ L;  2R92 K;  4A93 K;  4BY7 C;  4A3E K;  1TWG C;  2JA6 K;  4XSX A;  3RZD C;  5C4X K;  3S16 K;  4BBR K;  3H0G C;  4G7H A;  4AYB D;  4A3L C;  3GTM C;  3GTG C;  4A3G C;  2A6E A;  1TWF K;  5C44 K;  3HOZ C;  5IYC C;  3GTL K; 
#chains in the Genus database with same CATH topology
 4GZY A;  2P5M A;  1G51 A;  1IE0 A;  1O26 A;  3GTQ A;  3T01 A;  2FQT A;  1O25 A;  1XZP A;  2YU9 A;  4A3C C;  5IOT A;  3HOY K;  4LOW A;  2R93 C;  2PA8 L;  1V5V A;  3PO2 K;  4AH6 A;  2JA5 C;  1F93 A;  1SMY A;  3S17 K;  3SZZ A;  4Y7N C;  3GTM K;  3S15 K;  4A3J K;  2B63 C;  3JST A;  2A68 A;  3AD9 C;  4A3M K;  1USM A;  1WQG A;  3AQO A;  4BBS K;  2R92 A;  4A3K C;  4A3D K;  3S16 C;  4BBR C;  5M5X K;  3H3V L;  1F9N A;  3GIR A;  4LK1 A;  1Y1V K;  3G4A A;  5FLM K;  4GFQ A;  2CW0 A;  3TFH A;  3HOY C;  5IOR A;  4C3J C;  3FOF A;  5C3E C;  3LAP A;  4J3N A;  1JQW A;  1TWC K;  4DDQ A;  1R9T K;  2E2J C;  3GTJ C;  5L46 A;  3LPX A;  1HI9 A;  3S17 C;  4Q4Z A;  4GTA A;  1GE9 A;  4Y7N K;  4A3J C;  1L0W A;  3AD7 C;  4A3K K;  4A3D C;  3K7A K;  4KN7 A;  1XZP B;  1EH1 A;  2E2I C;  2NVT C;  3S1Q K;  4YG2 A;  1K83 K;  4NOI A;  3RZO K;  2D6F C;  1DCP A;  3CQZ A;  1IL2 A;  4XSZ A;  4Y52 K;  4WJ3 M;  2V6U A;  2E2H A;  1R9T C;  3GTJ K;  1JOE A;  3QX3 A;  3HXA A;  4A3I C;  4YFK A;  5D4D A;  3HOU K;  1WSR A;  1ZYR A;  3I4N K;  4X6A C;  2E2H K;  2JA7 C;  1TWA K;  4BXX K;  1YNN A;  5M3F K;  4KB4 A;  1WCM A;  3A8I A;  4G0W A;  2XCQ A;  1INN A;  3VA7 A;  4KM9 A;  3NUH A;  1BDF A;  2B63 A;  4G7Z A;  3M4O K;  3HKZ L;  4BY7 C;  3G4C A;  1WOO A;  2NVY A;  4AYB D;  4A3G C;  5C44 K;  3IPJ A;  4P9S A;  3GTL K;  3WOD A;  3S14 C;  5CHP A;  2V6T A;  4A3B K;  2YU9 C;  4A3I K;  1VGX A;  3GEI A;  3HOU C;  1I3Q A;  1I50 C;  1TWC A;  3A8J A;  3S1M C;  4JK1 A;  4YFX A;  1SFO C;  4BXX C;  2NVX C;  4P5B A;  1R9T A;  3GEE A;  3LAJ A;  1RU0 A;  4KMU A;  4BY1 K;  3FKI K;  2WB1 D;  1Y1V A;  3AH5 A;  4QJV A;  3S2H K;  2V6S A;  1PJ6 A;  2PA8 D;  3FHZ A;  3BUE A;  3L4K A;  1O24 A;  1XXB A;  1VH2 A;  3PO2 C;  2JA5 K;  3GTO A;  3SZY A;  5E68 A;  4A3B C;  5TMC A;  2YU9 K;  2VUM C;  1BS2 A;  2ZFZ A;  3OEP A;  1DCO A;  3S15 C;  3S1R C;  1O27 A;  2B63 K;  4A3M C;  3GTJ A;  5M3M K;  5JVO A;  2P8T A;  3S1N K;  1AB4 A;  3FKI C;  1EI6 A;  1I6H K;  1TWA A;  2PMZ D;  1PJ7 A;  1WCM K;  3AQP A;  1IS1 A;  3ERE D;  3ADA C;  1O29 A;  4C3J K;  5IOS A;  5C3E K;  1IW7 A;  3GTK K;  4MEX A;  2JA8 K;  1IQ0 A;  2O5J A;  2R92 C;  3HOX C;  1TWG K;  1JVI A;  2VUM K;  1WOS A;  3AD8 C;  1O2B A;  4WIL A;  1K83 A;  3S1N C;  2Y0S D;  1WQF A;  4C2M C;  1I6H C;  1TWF C;  2E2I K;  3GTQ C;  1YCL A;  1K83 C;  4M1X A;  3GTG A;  4KC6 A;  5M5Y K;  4KAR A;  2R92 K;  4A93 K;  4A3E K;  1TWG C;  3RZD C;  4KM8 A;  3H0G C;  5CJ9 A;  1UV7 A;  4A3L C;  3L4J A;  2A6E A;  3HOZ C;  4X6A K;  3FOE A;  4PAB A;  1XXA A;  5IYD C;  3GTP C;  4C2M K;  3FKI A;  3GTL A;  3PO3 C;  3M4O C;  3GTQ K;  2PHC B;  4YFN A;  2WAQ D;  1ZXO A;  4QIW D;  1DD5 A;  1Y1W A;  1Y1W C;  3I4M K;  4C3I C;  1USO A;  2BE5 A;  3S2D C;  2ZUF A;  4QIW L;  5IYC C;  1J6X A;  3GTL C;  1C0A A;  3GTO C;  3CAG A;  4LR2 A;  3M3Y C;  3RZD K;  1WIH A;  1WSV A;  3MML B;  2R7Z C;  3H0G K;  5EGH A;  4OIO A;  4AYB L;  2GSN A;  1I50 K;  3S1M K;  2Y0S L;  1SFO K;  2NVX K;  3H0G A;  3HKZ D;  5TJ3 A;  5IYB K;  2NVQ C;  3DXJ A;  2PPB A;  4ZH4 A;  4BY1 C;  5C4J K;  4Q5S A;  4KDD A;  3HOV C;  1TWH C;  3S2H C;  2NVX A;  4WJ4 A;  1Y1W K;  1J98 A;  3TFI A;  3I4M C;  4C3I K;  1I3Q C;  3S2D K;  1KQ4 A;  5EGE A;  3BP8 C;  1IBA A;  1XXC A;  2XCR B;  3M3Y K;  1VRQ C;  4XCH A;  1O2F B;  3HOW C;  3N0C A;  1O28 A;  2GAH C;  4OIP A;  4XLP A;  3S1R K;  2WB1 L;  4RMF A;  2JA6 C;  5IYB C;  2NVQ K;  3A8K A;  1XZQ A;  4KMD A;  1J6W A;  1WCM C;  1TWH K;  4G0V A;  3V4G A;  4KB2 A;  4A3F K;  2JA7 A;  4ILD A;  1I3Q K;  1BJT A;  1DCH A;  1WQH A;  3GTG K;  3GTK C;  1B4B A;  2JA8 C;  2XCO A;  5IYC K;  1EQR A;  5FLM C;  3OPF A;  2PMZ L;  3HOX K;  2GSU A;  4O2D A;  2A6H A;  5FJ8 K;  1YNJ A;  1EFW A;  3HOW K;  3Q3Q A;  3GTM A;  4KMA A;  3CQZ C;  2GAG C;  4KN4 A;  4OIQ A;  4BLA A;  2JA6 K;  4XSX A;  3TFJ A;  2VUM A;  4G7H A;  3GTM C;  3ORE A;  4KAS A;  1TWF K;  4FZB A;  1ZVU A;  1WOP A;  4MQ9 A;  4A3F C;  4BBS C;  3GTK A;  1YX2 A;  5IP9 C;  3GDZ A;  1I6V A;  4A93 C;  1Y1V C;  4A3E C;  5HL8 A;  5M5W K;  2GSO A;  4A3L K;  3BP3 A;  1HQM A;  3CQZ K;  3HOZ K;  1TWC C;  2JA6 A;  2E2J K;  1WOR A;  2W7V A;  1EK8 A;  5IOQ A;  3S0X A;  3N3Y A;  2EBB A;  3GTP K;  5IYD K;  4BKW A;  3EQL A;  2CFA A;  4LK0 A;  4XLN A;  3PO3 K;  4LJZ A;  1TWF A;  4LQY A;  2A69 A;  4KMH A;  3K7A C;  2NVY C;  1XPP A;  1PJ5 A;  1O2A A;  5IP9 K;  3TTG A;  4GTB A;  5IP7 C;  2NVT K;  4P5A A;  3S1Q C;  4G0U A;  3GTO K;  2JA5 A;  1TWH A;  3RZO C;  2R7Z K;  2R93 A;  4BLB A;  4OIN A;  2ZUE A;  1ZBS A;  4Y52 C;  3N0B A;  1J6V A;  4FM9 A;  3GEH A;  3GSI A;  5TMF A;  2RGR A;  2JH3 A;  4KAT A;  4KAW X;  4GTE A;  2WAQ L;  4GTC A;  1BGW A;  1VJE A;  3I4N C;  5C4J C;  2R7Z A;  2E2H C;  2JA7 K;  1TWA C;  3HOV K;  1F7V A;  1ISE A;  2NVY K;  5C4X C;  4PAA A;  4C3H K;  4GTL A;  5IP7 K;  1VLO A;  1XZQ B;  2KWA A;  3H3V D;  3T00 A;  2E2I A;  4BY7 K;  1ZQ1 C;  4MEY A;  4QJV B;  4C45 A;  4LLG A;  4OIR A;  4A3C K;  4GTD A;  4GT9 A;  1X31 C;  4A3G K;  3GTP A;  5C44 C;  2O5I A;  2R93 K;  1F7U A;  2FQO A;  3S14 K;  2Y3P A;  2CFA B;  4GTF A;  2RH6 A;  3T02 A;  4G7O A;  1TWG A;  5JFE A;  5C4X K;  3S16 K;  4BBR K;  4C3H C;  3GTG C;  1SFO A;  1B4A A;  1I50 A; 
#chains in the Genus database with same CATH homology
 4GZY A;  3WOD A;  3S14 C;  4MQ9 A;  4A3F C;  4BBS C;  4A3B K;  4A3C C;  2YU9 C;  4A3I K;  3HOY K;  5IYD C;  3GTP C;  4C2M K;  3HOU C;  5IP9 C;  2R93 C;  2PA8 L;  1I50 C;  3PO3 C;  3M4O C;  3S1M C;  4JK1 A;  1I6V A;  4YFX A;  1SFO C;  3GTQ K;  1Y1V C;  4A3E C;  3PO2 K;  4YFN A;  2NVX C;  4A93 C;  2JA5 C;  2WAQ D;  4BXX C;  4QIW D;  4X6A K;  5M5W K;  1Y1W C;  1SMY A;  3S17 K;  3I4M K;  4A3L K;  4Y7N C;  4KMU A;  2BE5 A;  3FKI K;  1HQM A;  2WB1 D;  3CQZ K;  4BY1 K;  3GTM K;  3S2D C;  3S15 K;  4QIW L;  3HOZ K;  1TWC C;  4QJV A;  4A3J K;  3GTL C;  2B63 C;  2A68 A;  4A3M K;  2E2J K;  3GTO C;  3S2H K;  3M3Y C;  4BBS K;  3RZD K;  4A3K C;  4A3D K;  3S16 C;  4BBR C;  5M5X K;  2R7Z C;  3H0G K;  3H3V L;  2PA8 D;  3GTP K;  5IYD K;  4OIO A;  3EQL A;  4AYB L;  4LK1 A;  1I50 K;  4LK0 A;  4XLN A;  3PO3 K;  3S1M K;  2Y0S L;  4LJZ A;  1SFO K;  2A69 A;  1Y1V K;  3PO2 C;  2NVX K;  5FLM K;  2JA5 K;  3K7A C;  2CW0 A;  2NVY C;  4A3B C;  1XPP A;  5TMC A;  3HKZ D;  5IYB K;  2YU9 K;  2NVQ C;  3DXJ A;  2VUM C;  2PPB A;  3HOY C;  4ZH4 A;  5IP9 K;  4BY1 C;  5C3E C;  5IP7 C;  5C4J K;  2NVT K;  3S15 C;  4Q5S A;  3S1Q C;  1TWC K;  3S1R C;  3HOV C;  2B63 K;  1TWH C;  4A3M C;  1R9T K;  3GTJ C;  2E2J C;  5M3M K;  3GTO K;  3RZO C;  3S2H C;  1Y1W K;  3S1N K;  3S17 C;  2R7Z K;  4Q4Z A;  4C3I K;  1I3Q C;  3I4M C;  4Y7N K;  3FKI C;  4OIN A;  3S2D K;  1I6H K;  4Y52 C;  2PMZ D;  4A3J C;  1WCM K;  3M3Y K;  5TMF A;  4A3K K;  3K7A K;  4A3D C;  4KN7 A;  4C3J K;  3HOW C;  2WAQ L;  5C3E K;  1IW7 A;  3GTK K;  4MEX A;  4OIP A;  2E2I C;  5C4J C;  4XLP A;  2E2H C;  2JA8 K;  2NVT C;  2JA7 K;  3S1R K;  3I4N C;  1TWA C;  2R92 C;  3HOV K;  3S1Q K;  2O5J A;  2WB1 L;  4YG2 A;  1TWG K;  3HOX C;  1K83 K;  4NOI A;  2JA6 C;  2NVY K;  3RZO K;  5C4X C;  5IYB C;  2NVQ K;  2VUM K;  4C3H K;  4XSZ A;  5IP7 K;  4Y52 K;  3H3V D;  4BY7 K;  1WCM C;  1TWH K;  1R9T C;  3GTJ K;  4MEY A;  4QJV B;  4A3F K;  4LLG A;  4OIR A;  3S1N C;  4A3C K;  2Y0S D;  4A3I C;  1I3Q K;  4YFK A;  5D4D A;  3GTG K;  3HOU K;  4A3G K;  1I6H C;  1TWF C;  1ZYR A;  5C44 C;  2O5I A;  3GTK C;  2R93 K;  2E2I K;  5IYC K;  5FLM C;  2E2H K;  2JA8 C;  3I4N K;  2JA7 C;  4X6A C;  1TWA K;  3S14 K;  3GTQ C;  4BXX K;  1YNN A;  2PMZ L;  3HOX K;  5M3F K;  1K83 C;  2A6H A;  5FJ8 K;  1YNJ A;  3HOW K;  1BDF A;  3CQZ C;  4G7O A;  4KN4 A;  4OIQ A;  4G7Z A;  5M5Y K;  3M4O K;  3HKZ L;  2R92 K;  4A93 K;  4BY7 C;  4A3E K;  1TWG C;  2JA6 K;  4XSX A;  3RZD C;  5C4X K;  3S16 K;  4BBR K;  3H0G C;  4G7H A;  4AYB D;  4A3L C;  3GTM C;  3GTG C;  4A3G C;  2A6E A;  1TWF K;  5C44 K;  3HOZ C;  5IYC C;  3GTL K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...