1O27A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and brdump at 2.3 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
total genus 75
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o27A00
5JFEA 1KQ4A 4P5AA 4KARA 4KASA 4P5BA 1O26A 4KATA 5IOSA 4GTBA 4GT9A 4GTAA 4GTFA 2CFAB 5CHPA 1O2AA 1O2BA 4GTEA 3N0CA 2CFAA 4FZBA 3N0BA 1O25A 5IOTA 3G4CA 1O24A 3AH5A 4GTDA 5IORA 5IOQA 1O29A 4GTLA 1O28A 3G4AA 3N3YA 4GTCA 1O27A
chains in the Genus database with same CATH superfamily
3I4MC 3S1NC 3H3VD 5IYDC 5FLMK 4Y52C 2E2IA 3GTMK 5TMCA 2R7ZK 2O5JA 1O2FB 4LK1A 4KMDA 3K7AK 3HOZK 1TWCK 1O2AA 4G0WA 3A8IA 2JA5C 4AYBL 1O25A 1ZQ1C 1IQ0A 3H0GK 1UV7A 1SMYA 3FKIC 4XLPA 1WOSA 3S2DC 1VGXA 1WOOA 1TWFK 3GTPK 4G0VA 4C3JC 4GTAA 4WJ3M 3HOXK 4MEXA 1R9TA 5FLMC 3GTMC 4A3GK 3AQPA 2R7ZC 4A93C 3PO2K 2JA6A 5D4DA 3K7AC 3HOZC 1EK8A 2E2IC 1WQHA 4BXXC 3FOFA 2R93C 1IE0A 2W7VA 3GEHA 2JA6K 4C2MK 1AB4A 2NVTC 4BY7C 1V5VA 4P5BA 1HQMA 2JH3A 2PPBA 1J98A 4ILDA 3GDZA 1K83A 1F93A 4M1XA 4MQ9A 5IP7C 2B63K 1K83K 2ZUFA 3HOXC 2A6HA 4A3GC 3HOWC 1VLOA 1X31C 1IL2A 1USMA 3S14C 4QIWD 1R9TC 1TWGK 2Y3PA 5C4XC 4BBRC 1J6VA 3V4GA 1WSRA 2JA6C 3CQZK 1XPPA 1TWHA 4GTBA 4GT9A 2XCOA 2E2HA 2XCQA 1YNJA 2PMZL 4A3IK 3AD7C 1GE9A 3OPFA 3GTOK 4X6AC 3GTJA 4BBSK 2E2JC 3M4OC 1WOPA 2JA8C 3S2HC 3S1MK 1JQWA 4WJ4A 3GTLA 2NVYA 1K83C 5IYBK 2FQOA 3EQLA 3GTLK 4KN4A 2V6TA 3L4KA 2GSUA 5M3MK 5FJ8K 3M3YC 3RZOK 3HOUC 5EGEA 3A8JA 4A3JK 2WB1D 2PA8L 4A3DC 5M3FK 4KB2A 4A3LK 1L0WA 5HL8A 2YU9A 4YFKA 3WODA 1WCMK 4A3CC 5IOQA 2WAQL 1Y1VK 2E2HC 1ZVUA 3GTJC 3HOYK 2KWAA 2GAGC 1TWCA 3S0XA 4A3EC 1USOA 1DCHA 3I4NC 1I50A 3GTLC 5C44K 2D6FC 2CW0A 3H0GA 3S1QK 2NVYC 2GSOA 2NVQK 1I50K 3GTQK 1I6HC 5M5XK 1C0AA 5CJ9A 1RU0A 4A3FC 1O29A 5C3EC 3S16K 4GTLA 1TWFA 3S1RC 3GTPA 1O27A 4A3MK 2RGRA 4YG2A 1DCOA 4A3BC 2YU9C 4KMAA 3S17K 4GTEA 1B4BA 3T00A 3H3VL 1ZYRA 4KMHA 4G7ZA 1ISEA 1YCLA 1TWAK 5C44C 3JSTA 1TWCC 3S15K 2R92K 1WQGA 1I50C 3G4AA 4Q4ZA 3H0GC 1IW7A 1YNNA 1B4AA 1XZPB 3S16C 3LAJA 4LLGA 4Y7NK 2B63A 2A68A 3HKZD 1EI6A 3GTGA 1I3QK 1XXAA 1TWFC 5M5WK 1XZQA 3GTPC 4JK1A 4C3IK 4LK0A 4O2DA 4XLNA 3GTGK 1TWGA 4LR2A 3SZZA 4GFQA 5L46A 3PO2C 1SFOK 3CQZA 4J3NA 1F9NA 1G51A 3S15C 4G7OA 2R92C 4KATA 1EFWA 1BJTA 4C2MC 3GTOA 5C4JK 5E68A 2NVXK 3RZDK 4FZBA 4BLAA 4Y7NC 4KM8A 4OIOA 2BE5A 3HOVK 2Y0SD 4XSXA 4Q5SA 2B63C 4BLBA 3GTGC 1BS2A 5IP9K 4QIWL 1TWGC 1O2BA 4BY1K 1IBAA 3LAPA 2ZUEA 3N0BA 1J6XA 1WCMA 3CQZC 4KMUA 4KB4A 4C45A 3AH5A 2R93K 1Y1VA 3LPXA 3I4MK 4A3IC 4Y52K 3GTOC 4BBSC 3N3YA 4OINA 1Y1WA 3S1MC 1VH2A 1ZXOA 2V6SA 4AYBD 1Y1WK 3GIRA 5IYBC 1PJ6A 4ZH4A 4QJVA 5CHPA 1YX2A 1EH1A 3GTQA 5IP9C 4KN7A 3RZOC 4XSZA 2EBBA 3S2DK 4A3JC 4KM9A 3AD9C 2A69A 3NUHA 1DD5A 4YFXA 4C3JK 4LQYA 1I6VA 3TFHA 4A3LC 3CAGA 2P8TA 1KQ4A 1JOEA 4PABA 3TFIA 1PJ7A 1WCMC 1XXCA 5IOSA 4A93K 1Y1VC 3GSIA 1DCPA 3FOEA 2E2IK 4BXXK 3HOYC 3N0CA 1TWAA 2CFAA 4G7HA 4WILA 1Y1WC 3AD8C 2R92A 4BKWA 2NVTK 4BY7K 4YFNA 2V6UA 3T01A 3S1QC 1INNA 2NVQC 3OEPA 4RMFA 3ERED 1O28A 4KDDA 3A8KA 3GTQC 1WIHA 5IP7K 4OIQA 1PJ5A 1I3QA 4KC6A 1F7VA 4A3KK 4DDQA 5M5YK 3GTKA 4A3MC 3HOWK 1IS1A 3S14K 5IOTA 3G4CA 1R9TK 2GSNA 3SZYA 2O5IA 3GTKK 5C4XK 4BBRK 3GEIA 1SFOA 3S17C 3BUEA 1WQFA 3ADAC 1TWAC 2PHCB 4NOIA 3Q3QA 4KARA 2P5MA 4KASA 2PMZD 4P5AA 5JVOA 1ZBSA 4X6AK 2NVXA 2E2JK 3BP3A 4C3HK 3M4OK 4QJVB 4OIRA 2JA8K 3S2HK 1VRQC 3VA7A 4A3KC 4AH6A 3HKZL 5IYCK 4P9SA 4KAWX 1I3QC 4LJZA 5TJ3A 3M3YK 4GZYA 3PO3K 3HOUK 4C3IC 3GTKC 4GTCA 2VUMA 4LOWA 2PA8D 4A3DK 3TTGA 4PAAA 2VUMK 1SFOC 5TMFA 4GTFA 2CFAB 3QX3A 1VJEA 2ZFZA 2R93A 4A3CK 2JA7A 1TWHK 1BGWA 2WAQD 4C3HC 2A6EA 2E2HK 2GAHC 4GTDA 5C4JC 4G0UA 2JA7K 3MMLB 3GTJK 1WORA 2NVXC 3RZDC 3S1NK 5IYDK 4A3EK 3DXJA 2JA5A 1XXBA 3I4NK 2XCRB 5IYCC 5JFEA 4FM9A 3HOVC 2FQTA 2NVYK 1O26A 2Y0SL 3PO3C 2JA5K 1XZPA 3BP8C 4OIPA 3FKIA 3OREA 1I6HK 2RH6A 3FHZA 3IPJA 1J6WA 1HI9A 1BDFA 3L4JA 1XZQB 4A3FK 1F7UA 5C3EK 3FKIK 3AQOA 2VUMC 3TFJA 1O24A 3S1RK 3T02A 4MEYA 3GEEA 1TWHC 4BY1C 1WSVA 5IORA 4XCHA 1EQRA 2WB1L 3GTMA 1JVIA 4A3BK 2YU9K 2R7ZA 5EGHA 2JA7C 3HXAA
chains in the Genus database with same CATH topology
1F9NA 1WIHA 3L4KA 2E2IA 2GSUA 4KATA 1BJTA 4KC6A 4C2MC 5EGEA 1I3QA 3GTOA 4KMDA 4DDQA 1O2AA 3GTKA 4G0WA 4FZBA 1IS1A 4KB2A 1O25A 4BLAA 4KM8A 3G4CA 5IOTA 2GSNA 2YU9A 1SFOA 5IOQA 3BUEA 1WQFA 1ZVUA 4BLBA 2PHCB 4P5AA 3Q3QA 4KARA 2P5MA 4KASA 5JVOA 2KWAA 1ZBSA 1TWCA 2NVXA 4G0VA 4C3JC 3S0XA 4GTAA 1I50A 1R9TA 1O2BA 3H0GA 3VA7A 3LAPA 3AQPA 2GSOA 3N0BA 1WCMA 4KB4A 2JA6A 3AH5A 1Y1VA 1EK8A 3LPXA 1WQHA 5CJ9A 3FOFA 4KAWX 5TJ3A 1O29A 4GTLA 1TWFA 3N3YA 4C3IC 3GTPA 1AB4A 4GTCA 1O27A 2VUMA 1Y1WA 2RGRA 4P5BA 1ZXOA 2JH3A 4ILDA 4GTFA 2CFAB 3QX3A 1K83A 4KMAA 4M1XA 4GTEA 5CHPA 1EH1A 1B4BA 2ZFZA 3GTQA 2R93A 2JA7A 1BGWA 4C3HC 4KMHA 1ISEA 4GTDA 4G0UA 3MMLB 4KM9A 3NUHA 1DD5A 4LQYA 2JA5A 1WQGA 3G4AA 1XXBA 2XCRB 3CAGA 2Y3PA 5JFEA 1KQ4A 4FM9A 3V4GA 1XXCA 1O26A 1B4AA 5IOSA 3LAJA 1TWHA 4GTBA 4GT9A 3FKIA 3FOEA 2B63A 2XCOA 3OREA 2E2HA 2XCQA 2RH6A 3FHZA 3N0CA 1TWAA 2CFAA 3L4JA 3OPFA 3GTGA 1XXAA 1GE9A 3GTJA 3AQOA 1O24A 2R92A 4BKWA 5IORA 1TWGA 3GTLA 4LR2A 2NVYA 3GTMA 3OEPA 4GFQA 3ERED 1O28A 4KDDA 2R7ZA 3CQZA 5EGHA 4J3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFE A;  1KQ4 A;  4P5A A;  4KAR A;  4KAS A;  4P5B A;  1O26 A;  4KAT A;  5IOS A;  4GTB A;  4GT9 A;  4GTA A;  4GTF A;  2CFA B;  5CHP A;  1O2A A;  1O2B A;  4GTE A;  3N0C A;  2CFA A;  4FZB A;  3N0B A;  1O25 A;  5IOT A;  3G4C A;  1O24 A;  3AH5 A;  4GTD A;  5IOR A;  5IOQ A;  1O29 A;  4GTL A;  1O28 A;  3G4A A;  3N3Y A;  4GTC A;  1O27 A; 
#chains in the Genus database with same CATH topology
 3I4M C;  3S1N C;  3H3V D;  5IYD C;  5FLM K;  4Y52 C;  2E2I A;  3GTM K;  5TMC A;  2R7Z K;  2O5J A;  1O2F B;  4LK1 A;  4KMD A;  3K7A K;  3HOZ K;  1TWC K;  1O2A A;  4G0W A;  3A8I A;  2JA5 C;  4AYB L;  1O25 A;  1ZQ1 C;  1IQ0 A;  3H0G K;  1UV7 A;  1SMY A;  3FKI C;  4XLP A;  1WOS A;  3S2D C;  1VGX A;  1WOO A;  1TWF K;  3GTP K;  4G0V A;  4C3J C;  4GTA A;  4WJ3 M;  3HOX K;  4MEX A;  1R9T A;  5FLM C;  3GTM C;  4A3G K;  3AQP A;  2R7Z C;  4A93 C;  3PO2 K;  2JA6 A;  5D4D A;  3K7A C;  3HOZ C;  1EK8 A;  2E2I C;  1WQH A;  4BXX C;  3FOF A;  2R93 C;  1IE0 A;  2W7V A;  3GEH A;  2JA6 K;  4C2M K;  1AB4 A;  2NVT C;  4BY7 C;  1V5V A;  4P5B A;  1HQM A;  2JH3 A;  2PPB A;  1J98 A;  4ILD A;  3GDZ A;  1K83 A;  1F93 A;  4M1X A;  4MQ9 A;  5IP7 C;  2B63 K;  1K83 K;  2ZUF A;  3HOX C;  2A6H A;  4A3G C;  3HOW C;  1VLO A;  1X31 C;  1IL2 A;  1USM A;  3S14 C;  4QIW D;  1R9T C;  1TWG K;  2Y3P A;  5C4X C;  4BBR C;  1J6V A;  3V4G A;  1WSR A;  2JA6 C;  3CQZ K;  1XPP A;  1TWH A;  4GTB A;  4GT9 A;  2XCO A;  2E2H A;  2XCQ A;  1YNJ A;  2PMZ L;  4A3I K;  3AD7 C;  1GE9 A;  3OPF A;  3GTO K;  4X6A C;  3GTJ A;  4BBS K;  2E2J C;  3M4O C;  1WOP A;  2JA8 C;  3S2H C;  3S1M K;  1JQW A;  4WJ4 A;  3GTL A;  2NVY A;  1K83 C;  5IYB K;  2FQO A;  3EQL A;  3GTL K;  4KN4 A;  2V6T A;  3L4K A;  2GSU A;  5M3M K;  5FJ8 K;  3M3Y C;  3RZO K;  3HOU C;  5EGE A;  3A8J A;  4A3J K;  2WB1 D;  2PA8 L;  4A3D C;  5M3F K;  4KB2 A;  4A3L K;  1L0W A;  5HL8 A;  2YU9 A;  4YFK A;  3WOD A;  1WCM K;  4A3C C;  5IOQ A;  2WAQ L;  1Y1V K;  2E2H C;  1ZVU A;  3GTJ C;  3HOY K;  2KWA A;  2GAG C;  1TWC A;  3S0X A;  4A3E C;  1USO A;  1DCH A;  3I4N C;  1I50 A;  3GTL C;  5C44 K;  2D6F C;  2CW0 A;  3H0G A;  3S1Q K;  2NVY C;  2GSO A;  2NVQ K;  1I50 K;  3GTQ K;  1I6H C;  5M5X K;  1C0A A;  5CJ9 A;  1RU0 A;  4A3F C;  1O29 A;  5C3E C;  3S16 K;  4GTL A;  1TWF A;  3S1R C;  3GTP A;  1O27 A;  4A3M K;  2RGR A;  4YG2 A;  1DCO A;  4A3B C;  2YU9 C;  4KMA A;  3S17 K;  4GTE A;  1B4B A;  3T00 A;  3H3V L;  1ZYR A;  4KMH A;  4G7Z A;  1ISE A;  1YCL A;  1TWA K;  5C44 C;  3JST A;  1TWC C;  3S15 K;  2R92 K;  1WQG A;  1I50 C;  3G4A A;  4Q4Z A;  3H0G C;  1IW7 A;  1YNN A;  1B4A A;  1XZP B;  3S16 C;  3LAJ A;  4LLG A;  4Y7N K;  2B63 A;  2A68 A;  3HKZ D;  1EI6 A;  3GTG A;  1I3Q K;  1XXA A;  1TWF C;  5M5W K;  1XZQ A;  3GTP C;  4JK1 A;  4C3I K;  4LK0 A;  4O2D A;  4XLN A;  3GTG K;  1TWG A;  4LR2 A;  3SZZ A;  4GFQ A;  5L46 A;  3PO2 C;  1SFO K;  3CQZ A;  4J3N A;  1F9N A;  1G51 A;  3S15 C;  4G7O A;  2R92 C;  4KAT A;  1EFW A;  1BJT A;  4C2M C;  3GTO A;  5C4J K;  5E68 A;  2NVX K;  3RZD K;  4FZB A;  4BLA A;  4Y7N C;  4KM8 A;  4OIO A;  2BE5 A;  3HOV K;  2Y0S D;  4XSX A;  4Q5S A;  2B63 C;  4BLB A;  3GTG C;  1BS2 A;  5IP9 K;  4QIW L;  1TWG C;  1O2B A;  4BY1 K;  1IBA A;  3LAP A;  2ZUE A;  3N0B A;  1J6X A;  1WCM A;  3CQZ C;  4KMU A;  4KB4 A;  4C45 A;  3AH5 A;  2R93 K;  1Y1V A;  3LPX A;  3I4M K;  4A3I C;  4Y52 K;  3GTO C;  4BBS C;  3N3Y A;  4OIN A;  1Y1W A;  3S1M C;  1VH2 A;  1ZXO A;  2V6S A;  4AYB D;  1Y1W K;  3GIR A;  5IYB C;  1PJ6 A;  4ZH4 A;  4QJV A;  5CHP A;  1YX2 A;  1EH1 A;  3GTQ A;  5IP9 C;  4KN7 A;  3RZO C;  4XSZ A;  2EBB A;  3S2D K;  4A3J C;  4KM9 A;  3AD9 C;  2A69 A;  3NUH A;  1DD5 A;  4YFX A;  4C3J K;  4LQY A;  1I6V A;  3TFH A;  4A3L C;  3CAG A;  2P8T A;  1KQ4 A;  1JOE A;  4PAB A;  3TFI A;  1PJ7 A;  1WCM C;  1XXC A;  5IOS A;  4A93 K;  1Y1V C;  3GSI A;  1DCP A;  3FOE A;  2E2I K;  4BXX K;  3HOY C;  3N0C A;  1TWA A;  2CFA A;  4G7H A;  4WIL A;  1Y1W C;  3AD8 C;  2R92 A;  4BKW A;  2NVT K;  4BY7 K;  4YFN A;  2V6U A;  3T01 A;  3S1Q C;  1INN A;  2NVQ C;  3OEP A;  4RMF A;  3ERE D;  1O28 A;  4KDD A;  3A8K A;  3GTQ C;  1WIH A;  5IP7 K;  4OIQ A;  1PJ5 A;  1I3Q A;  4KC6 A;  1F7V A;  4A3K K;  4DDQ A;  5M5Y K;  3GTK A;  4A3M C;  3HOW K;  1IS1 A;  3S14 K;  5IOT A;  3G4C A;  1R9T K;  2GSN A;  3SZY A;  2O5I A;  3GTK K;  5C4X K;  4BBR K;  3GEI A;  1SFO A;  3S17 C;  3BUE A;  1WQF A;  3ADA C;  1TWA C;  2PHC B;  4NOI A;  3Q3Q A;  4KAR A;  2P5M A;  4KAS A;  2PMZ D;  4P5A A;  5JVO A;  1ZBS A;  4X6A K;  2NVX A;  2E2J K;  3BP3 A;  4C3H K;  3M4O K;  4QJV B;  4OIR A;  2JA8 K;  3S2H K;  1VRQ C;  3VA7 A;  4A3K C;  4AH6 A;  3HKZ L;  5IYC K;  4P9S A;  4KAW X;  1I3Q C;  4LJZ A;  5TJ3 A;  3M3Y K;  4GZY A;  3PO3 K;  3HOU K;  4C3I C;  3GTK C;  4GTC A;  2VUM A;  4LOW A;  2PA8 D;  4A3D K;  3TTG A;  4PAA A;  2VUM K;  1SFO C;  5TMF A;  4GTF A;  2CFA B;  3QX3 A;  1VJE A;  2ZFZ A;  2R93 A;  4A3C K;  2JA7 A;  1TWH K;  1BGW A;  2WAQ D;  4C3H C;  2A6E A;  2E2H K;  2GAH C;  4GTD A;  5C4J C;  4G0U A;  2JA7 K;  3MML B;  3GTJ K;  1WOR A;  2NVX C;  3RZD C;  3S1N K;  5IYD K;  4A3E K;  3DXJ A;  2JA5 A;  1XXB A;  3I4N K;  2XCR B;  5IYC C;  5JFE A;  4FM9 A;  3HOV C;  2FQT A;  2NVY K;  1O26 A;  2Y0S L;  3PO3 C;  2JA5 K;  1XZP A;  3BP8 C;  4OIP A;  3FKI A;  3ORE A;  1I6H K;  2RH6 A;  3FHZ A;  3IPJ A;  1J6W A;  1HI9 A;  1BDF A;  3L4J A;  1XZQ B;  4A3F K;  1F7U A;  5C3E K;  3FKI K;  3AQO A;  2VUM C;  3TFJ A;  1O24 A;  3S1R K;  3T02 A;  4MEY A;  3GEE A;  1TWH C;  4BY1 C;  1WSV A;  5IOR A;  4XCH A;  1EQR A;  2WB1 L;  3GTM A;  1JVI A;  4A3B K;  2YU9 K;  2R7Z A;  5EGH A;  2JA7 C;  3HXA A; 
#chains in the Genus database with same CATH homology
 1F9N A;  1WIH A;  3L4K A;  2E2I A;  2GSU A;  4KAT A;  1BJT A;  4KC6 A;  4C2M C;  5EGE A;  1I3Q A;  3GTO A;  4KMD A;  4DDQ A;  1O2A A;  3GTK A;  4G0W A;  4FZB A;  1IS1 A;  4KB2 A;  1O25 A;  4BLA A;  4KM8 A;  3G4C A;  5IOT A;  2GSN A;  2YU9 A;  1SFO A;  5IOQ A;  3BUE A;  1WQF A;  1ZVU A;  4BLB A;  2PHC B;  4P5A A;  3Q3Q A;  4KAR A;  2P5M A;  4KAS A;  5JVO A;  2KWA A;  1ZBS A;  1TWC A;  2NVX A;  4G0V A;  4C3J C;  3S0X A;  4GTA A;  1I50 A;  1R9T A;  1O2B A;  3H0G A;  3VA7 A;  3LAP A;  3AQP A;  2GSO A;  3N0B A;  1WCM A;  4KB4 A;  2JA6 A;  3AH5 A;  1Y1V A;  1EK8 A;  3LPX A;  1WQH A;  5CJ9 A;  3FOF A;  4KAW X;  5TJ3 A;  1O29 A;  4GTL A;  1TWF A;  3N3Y A;  4C3I C;  3GTP A;  1AB4 A;  4GTC A;  1O27 A;  2VUM A;  1Y1W A;  2RGR A;  4P5B A;  1ZXO A;  2JH3 A;  4ILD A;  4GTF A;  2CFA B;  3QX3 A;  1K83 A;  4KMA A;  4M1X A;  4GTE A;  5CHP A;  1EH1 A;  1B4B A;  2ZFZ A;  3GTQ A;  2R93 A;  2JA7 A;  1BGW A;  4C3H C;  4KMH A;  1ISE A;  4GTD A;  4G0U A;  3MML B;  4KM9 A;  3NUH A;  1DD5 A;  4LQY A;  2JA5 A;  1WQG A;  3G4A A;  1XXB A;  2XCR B;  3CAG A;  2Y3P A;  5JFE A;  1KQ4 A;  4FM9 A;  3V4G A;  1XXC A;  1O26 A;  1B4A A;  5IOS A;  3LAJ A;  1TWH A;  4GTB A;  4GT9 A;  3FKI A;  3FOE A;  2B63 A;  2XCO A;  3ORE A;  2E2H A;  2XCQ A;  2RH6 A;  3FHZ A;  3N0C A;  1TWA A;  2CFA A;  3L4J A;  3OPF A;  3GTG A;  1XXA A;  1GE9 A;  3GTJ A;  3AQO A;  1O24 A;  2R92 A;  4BKW A;  5IOR A;  1TWG A;  3GTL A;  4LR2 A;  2NVY A;  3GTM A;  3OEP A;  4GFQ A;  3ERE D;  1O28 A;  4KDD A;  2R7Z A;  3CQZ A;  5EGH A;  4J3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...