1O27A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and brdump at 2.3 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 75
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o27A00
3N0CA 1KQ4A 1O26A 4KASA 5IORA 4KARA 3G4CA 4GT9A 1O28A 2CFAB 5CHPA 4GTDA 5IOQA 4P5BA 1O2AA 1O27A 4GTEA 4P5AA 3G4AA 2CFAA 3N3YA 5IOTA 1O2BA 1O24A 5JFEA 1O25A 3N0BA 4GTCA 5IOSA 4GTLA 4KATA 4FZBA 4GTAA 4GTFA 1O29A 3AH5A 4GTBA
chains in the Genus database with same CATH superfamily
5FLMK 4KASA 1DCOA 1TWAC 1Y1WK 4QIWD 3S1RK 2CFAB 4BBRK 4XSZA 5IYBK 4OIRA 1V5VA 5IP7K 3GSIA 3OREA 2FQOA 3TFJA 3S2DC 5IOTA 2JA7K 3GTKK 3S1NK 4G7ZA 3GTOA 1O2FB 5C44K 1K83A 4C45A 3K7AC 4A3IC 1YCLA 4A3FK 3SZZA 1Y1VC 3GTPC 4OIPA 3S1MK 3A8IA 1TWFA 1SFOA 4YFNA 5CHPA 3HKZD 3S15C 4C2MC 3HOWC 4OINA 3H3VD 4A3MC 2R93A 3I4NC 4XCHA 2Y3PA 2VUMC 5IP9K 1O24A 1UV7A 4KB2A 5IYDC 2JA7A 4GTFA 3PO2K 1TWGK 3GTOC 1WORA 3GEIA 4KARA 4C3JC 2NVTK 4Q4ZA 3GTLC 2EBBA 2JA5A 4KM8A 4Y7NC 3M3YK 3RZOC 1BJTA 3S17K 3M4OK 2XCOA 4MQ9A 2GSNA 1ZQ1C 4MEYA 3BUEA 2YU9K 3A8KA 3N0BA 1XXCA 4G7OA 3GIRA 4A3BC 5FJ8K 4A3CC 5EGHA 2KWAA 2WAQL 3N0CA 2A6HA 4AYBD 3WODA 5IORA 3HOZK 3GTMA 3GEEA 1TWCK 2NVYA 3S0XA 1WOOA 3CQZC 3L4KA 3TFHA 1IL2A 1TWFC 1SFOC 2V6TA 2NVYK 4LR2A 4XSXA 1J6WA 1WCMC 1TWHC 1I6HK 1WSVA 4GTBA 3DXJA 4KMHA 4ZH4A 2GSOA 1TWHK 3GTMK 1O28A 1JVIA 5CJ9A 3GTGK 4G0WA 2PMZD 2NVXC 4LQYA 2NVYC 3CAGA 2JA5K 3N3YA 3GTPA 4KMAA 1I3QC 4DDQA 5E68A 3LAPA 5C3EK 1USOA 1XZQA 1EI6A 3IPJA 4LK1A 4A3MK 4AH6A 4G0UA 2E2HC 3GTQC 1ZXOA 3G4CA 1GE9A 1ZBSA 4YFXA 2E2JC 1Y1VK 4J3NA 2VUMA 4QJVA 3GTGA 3LPXA 4P5BA 2E2HK 4WILA 3GTQK 2WB1D 3CQZA 3K7AK 4A3IK 2A6EA 1R9TC 3TFIA 5C4JK 1X31C 1EK8A 2E2IC 3JSTA 2BE5A 2Y0SD 2GAGC 1PJ7A 4WJ3M 3ERED 2PPBA 3GTKC 1TWGC 3GTOK 1B4BA 1ZVUA 1TWFK 4KM9A 1SFOK 2NVXK 3QX3A 1I6VA 4BBRC 4A3EC 5TMFA 5IP9C 3HOXC 5C4JC 4G7HA 3HOZC 1R9TK 1SMYA 1F7VA 1Y1WA 3G4AA 1WCMK 3L4JA 2P5MA 3GTMC 1VH2A 3NUHA 3AH5A 1KQ4A 2NVQK 2FQTA 2PHCB 2ZUEA 5M5YK 3HOXK 3HOVK 4A3EK 4QJVB 1I3QK 2JA6A 4Y52K 4C3JK 4KB4A 2XCQA 2NVTC 3AD7C 3AD8C 4LJZA 2JA5C 3GTJA 4KC6A 1TWCC 2E2IK 2YU9C 1VRQC 5TMCA 4A3CK 3S17C 4A3BK 1XZPA 1YNJA 4Y7NK 2E2JK 3M3YC 1XZQB 4KAWX 4P9SA 4A3FC 3TTGA 1PJ5A 4A3JC 2O5IA 4GZYA 1I50K 4FM9A 2CFAA 3OEPA 4XLNA 3RZDK 3T01A 2GSUA 3CQZK 4A3LK 1DCHA 5IYDK 1WOPA 3S1NC 4BY1C 1EFWA 2VUMK 2JA7C 3LAJA 3T00A 4ILDA 2YU9A 2V6UA 3GTGC 1HQMA 1BGWA 5TJ3A 1VLOA 3S1RC 5D4DA 5IOQA 4O2DA 1ISEA 1O27A 4GTEA 1VJEA 1RU0A 1BDFA 4C2MK 3GTLA 3AD9C 4NOIA 5C44C 4LLGA 4A93C 1TWGA 4A3DC 4M1XA 4KATA 3HKZL 2RGRA 1TWAA 5M5WK 4RMFA 1O26A 2ZFZA 3PO2C 2XCRB 2B63A 1JOEA 5C3EC 3HOYK 4WJ4A 2JH3A 1Y1WC 3AQPA 4GTDA 3AQOA 2Y0SL 3I4NK 1EH1A 4BBSC 2O5JA 3HOWK 3EQLA 5IP7C 1VGXA 1DD5A 2W7VA 4YFKA 2ZUFA 4X6AK 4XLPA 2JA6C 5JFEA 1IW7A 2P8TA 5IYCC 1IBAA 3H0GK 5C4XK 5M3FK 3S1MC 1WQHA 4BY7C 1WQGA 3V4GA 1BS2A 4A3KC 1IQ0A 3FKIA 2R92K 3S2HK 3I4MC 3SZYA 1I6HC 1WCMA 3S14C 3FKIK 3GTJC 3GTLK 1AB4A 3S14K 1J6XA 3A8JA 1XXAA 1R9TA 5L46A 2WAQD 3S2DK 4AYBL 4A3GK 4JK1A 3FOEA 1INNA 4BY7K 1K83C 5IYBC 1WQFA 3H0GC 4C3IK 1I50A 5IYCK 5IOSA 4GFQA 4BLBA 2RH6A 2R92A 3HOUC 3PO3C 1J98A 1O29A 2D6FC 3H0GA 4Q5SA 3T02A 4PABA 3FOFA 1YNNA 2PA8D 3HOYC 5M5XK 4KMUA 1XZPB 1HI9A 3GTQA 2E2HA 4P5AA 1EQRA 3BP8C 4MEXA 3M4OC 2JA8K 2B63K 3RZOK 3BP3A 1F9NA 1ZYRA 4A3DK 3ADAC 1USMA 3GEHA 2JA8C 3H3VL 4BXXC 4PAAA 1L0WA 1I3QA 2E2IA 3S2HC 3S16K 2NVXA 4A3KK 2R92C 4GT9A 4BKWA 4C3HC 2R7ZA 3S1QK 1TWAK 3S16C 1IS1A 1O2AA 2R7ZC 1JQWA 4BLAA 5HL8A 3S15K 3HOUK 3GTKA 4LOWA 2PA8L 3S1QC 1TWHA 5JVOA 1O25A 2A68A 1Y1VA 3GTPK 4GTLA 3Q3QA 2R93K 3RZDC 1K83K 1C0AA 2WB1L 1I50C 1TWCA 2CW0A 2R93C 4YG2A 4A93K 4KN4A 4KDDA 4KN7A 3VA7A 4KMDA 1DCPA 1PJ6A 5EGEA 2R7ZK 4OIQA 1WOSA 3PO3K 4QIWL 1XXBA 5C4XC 4C3HK 4GTCA 2JA6K 4OIOA 1J6VA 4A3GC 3MMLB 5FLMC 5M3MK 4BBSK 1WSRA 4BXXK 3FHZA 4BY1K 4Y52C 3GTJK 4A3LC 4C3IC 3HOVC 1F7UA 1YX2A 1IE0A 4G0VA 1B4AA 2B63C 2A69A 2NVQC 2GAHC 4LK0A 4A3JK 3I4MK 1F93A 1O2BA 1WIHA 3HXAA 3FKIC 2PMZL 2V6SA 4FZBA 4GTAA 4X6AC 3GDZA 3OPFA 1G51A 1XPPA
chains in the Genus database with same CATH topology
4KASA 4KMHA 2GSOA 3FOFA 1O28A 2CFAB 5CJ9A 4KAWX 4G0WA 3GTQA 2E2HA 4LQYA 3OREA 3CAGA 4P5AA 4FM9A 2CFAA 3N3YA 5IOTA 3GTPA 3OEPA 1F9NA 4KMAA 2GSUA 4DDQA 3LAPA 3GTOA 1K83A 3LAJA 1I3QA 2E2IA 4ILDA 4G0UA 2NVXA 2YU9A 1ZXOA 3G4CA 1BGWA 5TJ3A 1GE9A 4GT9A 4BKWA 4C3HC 1TWFA 1SFOA 1ZBSA 2R7ZA 4J3NA 5CHPA 2VUMA 3GTGA 5IOQA 3LPXA 4P5BA 4C2MC 1IS1A 1O2AA 1O27A 1ISEA 3CQZA 4GTEA 4BLAA 2R93A 3GTLA 2Y3PA 3GTKA 1EK8A 1O24A 1TWHA 5JVOA 1O25A 4KB2A 1TWGA 4M1XA 1Y1VA 2JA7A 4GTLA 4KATA 3Q3QA 2RGRA 1TWAA 4GTFA 3ERED 1TWCA 1B4BA 1ZVUA 1O26A 4KM9A 3QX3A 2ZFZA 4KARA 2XCRB 2B63A 4C3JC 2JA5A 2JH3A 4KM8A 3AQPA 4KDDA 4GTDA 3AQOA 3VA7A 1BJTA 4KMDA 1EH1A 2XCOA 5EGEA 1Y1WA 3G4AA 2GSNA 1DD5A 3BUEA 3L4JA 5JFEA 1XXBA 3N0BA 1XXCA 4GTCA 1WQHA 2P5MA 1WQGA 3V4GA 3FKIA 3NUHA 3AH5A 3MMLB 5EGHA 2KWAA 3N0CA 1KQ4A 5IORA 2PHCB 3FHZA 3GTMA 1WCMA 2NVYA 4C3IC 3S0XA 1AB4A 2JA6A 4KB4A 2XCQA 1B4AA 1XXAA 3L4KA 1R9TA 4G0VA 3GTJA 4LR2A 3FOEA 4KC6A 1O2BA 1WIHA 1WQFA 1I50A 5IOSA 4GFQA 4FZBA 4GTAA 2RH6A 4BLBA 2R92A 3OPFA 1O29A 4GTBA 3H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  1KQ4 A;  1O26 A;  4KAS A;  5IOR A;  4KAR A;  3G4C A;  4GT9 A;  1O28 A;  2CFA B;  5CHP A;  4GTD A;  5IOQ A;  4P5B A;  1O2A A;  1O27 A;  4GTE A;  4P5A A;  3G4A A;  2CFA A;  3N3Y A;  5IOT A;  1O2B A;  1O24 A;  5JFE A;  1O25 A;  3N0B A;  4GTC A;  5IOS A;  4GTL A;  4KAT A;  4FZB A;  4GTA A;  4GTF A;  1O29 A;  3AH5 A;  4GTB A; 
#chains in the Genus database with same CATH topology
 5FLM K;  4KAS A;  1DCO A;  1TWA C;  1Y1W K;  4QIW D;  3S1R K;  2CFA B;  4BBR K;  4XSZ A;  5IYB K;  4OIR A;  1V5V A;  5IP7 K;  3GSI A;  3ORE A;  2FQO A;  3TFJ A;  3S2D C;  5IOT A;  2JA7 K;  3GTK K;  3S1N K;  4G7Z A;  3GTO A;  1O2F B;  5C44 K;  1K83 A;  4C45 A;  3K7A C;  4A3I C;  1YCL A;  4A3F K;  3SZZ A;  1Y1V C;  3GTP C;  4OIP A;  3S1M K;  3A8I A;  1TWF A;  1SFO A;  4YFN A;  5CHP A;  3HKZ D;  3S15 C;  4C2M C;  3HOW C;  4OIN A;  3H3V D;  4A3M C;  2R93 A;  3I4N C;  4XCH A;  2Y3P A;  2VUM C;  5IP9 K;  1O24 A;  1UV7 A;  4KB2 A;  5IYD C;  2JA7 A;  4GTF A;  3PO2 K;  1TWG K;  3GTO C;  1WOR A;  3GEI A;  4KAR A;  4C3J C;  2NVT K;  4Q4Z A;  3GTL C;  2EBB A;  2JA5 A;  4KM8 A;  4Y7N C;  3M3Y K;  3RZO C;  1BJT A;  3S17 K;  3M4O K;  2XCO A;  4MQ9 A;  2GSN A;  1ZQ1 C;  4MEY A;  3BUE A;  2YU9 K;  3A8K A;  3N0B A;  1XXC A;  4G7O A;  3GIR A;  4A3B C;  5FJ8 K;  4A3C C;  5EGH A;  2KWA A;  2WAQ L;  3N0C A;  2A6H A;  4AYB D;  3WOD A;  5IOR A;  3HOZ K;  3GTM A;  3GEE A;  1TWC K;  2NVY A;  3S0X A;  1WOO A;  3CQZ C;  3L4K A;  3TFH A;  1IL2 A;  1TWF C;  1SFO C;  2V6T A;  2NVY K;  4LR2 A;  4XSX A;  1J6W A;  1WCM C;  1TWH C;  1I6H K;  1WSV A;  4GTB A;  3DXJ A;  4KMH A;  4ZH4 A;  2GSO A;  1TWH K;  3GTM K;  1O28 A;  1JVI A;  5CJ9 A;  3GTG K;  4G0W A;  2PMZ D;  2NVX C;  4LQY A;  2NVY C;  3CAG A;  2JA5 K;  3N3Y A;  3GTP A;  4KMA A;  1I3Q C;  4DDQ A;  5E68 A;  3LAP A;  5C3E K;  1USO A;  1XZQ A;  1EI6 A;  3IPJ A;  4LK1 A;  4A3M K;  4AH6 A;  4G0U A;  2E2H C;  3GTQ C;  1ZXO A;  3G4C A;  1GE9 A;  1ZBS A;  4YFX A;  2E2J C;  1Y1V K;  4J3N A;  2VUM A;  4QJV A;  3GTG A;  3LPX A;  4P5B A;  2E2H K;  4WIL A;  3GTQ K;  2WB1 D;  3CQZ A;  3K7A K;  4A3I K;  2A6E A;  1R9T C;  3TFI A;  5C4J K;  1X31 C;  1EK8 A;  2E2I C;  3JST A;  2BE5 A;  2Y0S D;  2GAG C;  1PJ7 A;  4WJ3 M;  3ERE D;  2PPB A;  3GTK C;  1TWG C;  3GTO K;  1B4B A;  1ZVU A;  1TWF K;  4KM9 A;  1SFO K;  2NVX K;  3QX3 A;  1I6V A;  4BBR C;  4A3E C;  5TMF A;  5IP9 C;  3HOX C;  5C4J C;  4G7H A;  3HOZ C;  1R9T K;  1SMY A;  1F7V A;  1Y1W A;  3G4A A;  1WCM K;  3L4J A;  2P5M A;  3GTM C;  1VH2 A;  3NUH A;  3AH5 A;  1KQ4 A;  2NVQ K;  2FQT A;  2PHC B;  2ZUE A;  5M5Y K;  3HOX K;  3HOV K;  4A3E K;  4QJV B;  1I3Q K;  2JA6 A;  4Y52 K;  4C3J K;  4KB4 A;  2XCQ A;  2NVT C;  3AD7 C;  3AD8 C;  4LJZ A;  2JA5 C;  3GTJ A;  4KC6 A;  1TWC C;  2E2I K;  2YU9 C;  1VRQ C;  5TMC A;  4A3C K;  3S17 C;  4A3B K;  1XZP A;  1YNJ A;  4Y7N K;  2E2J K;  3M3Y C;  1XZQ B;  4KAW X;  4P9S A;  4A3F C;  3TTG A;  1PJ5 A;  4A3J C;  2O5I A;  4GZY A;  1I50 K;  4FM9 A;  2CFA A;  3OEP A;  4XLN A;  3RZD K;  3T01 A;  2GSU A;  3CQZ K;  4A3L K;  1DCH A;  5IYD K;  1WOP A;  3S1N C;  4BY1 C;  1EFW A;  2VUM K;  2JA7 C;  3LAJ A;  3T00 A;  4ILD A;  2YU9 A;  2V6U A;  3GTG C;  1HQM A;  1BGW A;  5TJ3 A;  1VLO A;  3S1R C;  5D4D A;  5IOQ A;  4O2D A;  1ISE A;  1O27 A;  4GTE A;  1VJE A;  1RU0 A;  1BDF A;  4C2M K;  3GTL A;  3AD9 C;  4NOI A;  5C44 C;  4LLG A;  4A93 C;  1TWG A;  4A3D C;  4M1X A;  4KAT A;  3HKZ L;  2RGR A;  1TWA A;  5M5W K;  4RMF A;  1O26 A;  2ZFZ A;  3PO2 C;  2XCR B;  2B63 A;  1JOE A;  5C3E C;  3HOY K;  4WJ4 A;  2JH3 A;  1Y1W C;  3AQP A;  4GTD A;  3AQO A;  2Y0S L;  3I4N K;  1EH1 A;  4BBS C;  2O5J A;  3HOW K;  3EQL A;  5IP7 C;  1VGX A;  1DD5 A;  2W7V A;  4YFK A;  2ZUF A;  4X6A K;  4XLP A;  2JA6 C;  5JFE A;  1IW7 A;  2P8T A;  5IYC C;  1IBA A;  3H0G K;  5C4X K;  5M3F K;  3S1M C;  1WQH A;  4BY7 C;  1WQG A;  3V4G A;  1BS2 A;  4A3K C;  1IQ0 A;  3FKI A;  2R92 K;  3S2H K;  3I4M C;  3SZY A;  1I6H C;  1WCM A;  3S14 C;  3FKI K;  3GTJ C;  3GTL K;  1AB4 A;  3S14 K;  1J6X A;  3A8J A;  1XXA A;  1R9T A;  5L46 A;  2WAQ D;  3S2D K;  4AYB L;  4A3G K;  4JK1 A;  3FOE A;  1INN A;  4BY7 K;  1K83 C;  5IYB C;  1WQF A;  3H0G C;  4C3I K;  1I50 A;  5IYC K;  5IOS A;  4GFQ A;  4BLB A;  2RH6 A;  2R92 A;  3HOU C;  3PO3 C;  1J98 A;  1O29 A;  2D6F C;  3H0G A;  4Q5S A;  3T02 A;  4PAB A;  3FOF A;  1YNN A;  2PA8 D;  3HOY C;  5M5X K;  4KMU A;  1XZP B;  1HI9 A;  3GTQ A;  2E2H A;  4P5A A;  1EQR A;  3BP8 C;  4MEX A;  3M4O C;  2JA8 K;  2B63 K;  3RZO K;  3BP3 A;  1F9N A;  1ZYR A;  4A3D K;  3ADA C;  1USM A;  3GEH A;  2JA8 C;  3H3V L;  4BXX C;  4PAA A;  1L0W A;  1I3Q A;  2E2I A;  3S2H C;  3S16 K;  2NVX A;  4A3K K;  2R92 C;  4GT9 A;  4BKW A;  4C3H C;  2R7Z A;  3S1Q K;  1TWA K;  3S16 C;  1IS1 A;  1O2A A;  2R7Z C;  1JQW A;  4BLA A;  5HL8 A;  3S15 K;  3HOU K;  3GTK A;  4LOW A;  2PA8 L;  3S1Q C;  1TWH A;  5JVO A;  1O25 A;  2A68 A;  1Y1V A;  3GTP K;  4GTL A;  3Q3Q A;  2R93 K;  3RZD C;  1K83 K;  1C0A A;  2WB1 L;  1I50 C;  1TWC A;  2CW0 A;  2R93 C;  4YG2 A;  4A93 K;  4KN4 A;  4KDD A;  4KN7 A;  3VA7 A;  4KMD A;  1DCP A;  1PJ6 A;  5EGE A;  2R7Z K;  4OIQ A;  1WOS A;  3PO3 K;  4QIW L;  1XXB A;  5C4X C;  4C3H K;  4GTC A;  2JA6 K;  4OIO A;  1J6V A;  4A3G C;  3MML B;  5FLM C;  5M3M K;  4BBS K;  1WSR A;  4BXX K;  3FHZ A;  4BY1 K;  4Y52 C;  3GTJ K;  4A3L C;  4C3I C;  3HOV C;  1F7U A;  1YX2 A;  1IE0 A;  4G0V A;  1B4A A;  2B63 C;  2A69 A;  2NVQ C;  2GAH C;  4LK0 A;  4A3J K;  3I4M K;  1F93 A;  1O2B A;  1WIH A;  3HXA A;  3FKI C;  2PMZ L;  2V6S A;  4FZB A;  4GTA A;  4X6A C;  3GDZ A;  3OPF A;  1G51 A;  1XPP A; 
#chains in the Genus database with same CATH homology
 4KAS A;  4KMH A;  2GSO A;  3FOF A;  1O28 A;  2CFA B;  5CJ9 A;  4KAW X;  4G0W A;  3GTQ A;  2E2H A;  4LQY A;  3ORE A;  3CAG A;  4P5A A;  4FM9 A;  2CFA A;  3N3Y A;  5IOT A;  3GTP A;  3OEP A;  1F9N A;  4KMA A;  2GSU A;  4DDQ A;  3LAP A;  3GTO A;  1K83 A;  3LAJ A;  1I3Q A;  2E2I A;  4ILD A;  4G0U A;  2NVX A;  2YU9 A;  1ZXO A;  3G4C A;  1BGW A;  5TJ3 A;  1GE9 A;  4GT9 A;  4BKW A;  4C3H C;  1TWF A;  1SFO A;  1ZBS A;  2R7Z A;  4J3N A;  5CHP A;  2VUM A;  3GTG A;  5IOQ A;  3LPX A;  4P5B A;  4C2M C;  1IS1 A;  1O2A A;  1O27 A;  1ISE A;  3CQZ A;  4GTE A;  4BLA A;  2R93 A;  3GTL A;  2Y3P A;  3GTK A;  1EK8 A;  1O24 A;  1TWH A;  5JVO A;  1O25 A;  4KB2 A;  1TWG A;  4M1X A;  1Y1V A;  2JA7 A;  4GTL A;  4KAT A;  3Q3Q A;  2RGR A;  1TWA A;  4GTF A;  3ERE D;  1TWC A;  1B4B A;  1ZVU A;  1O26 A;  4KM9 A;  3QX3 A;  2ZFZ A;  4KAR A;  2XCR B;  2B63 A;  4C3J C;  2JA5 A;  2JH3 A;  4KM8 A;  3AQP A;  4KDD A;  4GTD A;  3AQO A;  3VA7 A;  1BJT A;  4KMD A;  1EH1 A;  2XCO A;  5EGE A;  1Y1W A;  3G4A A;  2GSN A;  1DD5 A;  3BUE A;  3L4J A;  5JFE A;  1XXB A;  3N0B A;  1XXC A;  4GTC A;  1WQH A;  2P5M A;  1WQG A;  3V4G A;  3FKI A;  3NUH A;  3AH5 A;  3MML B;  5EGH A;  2KWA A;  3N0C A;  1KQ4 A;  5IOR A;  2PHC B;  3FHZ A;  3GTM A;  1WCM A;  2NVY A;  4C3I C;  3S0X A;  1AB4 A;  2JA6 A;  4KB4 A;  2XCQ A;  1B4A A;  1XXA A;  3L4K A;  1R9T A;  4G0V A;  3GTJ A;  4LR2 A;  3FOE A;  4KC6 A;  1O2B A;  1WIH A;  1WQF A;  1I50 A;  5IOS A;  4GFQ A;  4FZB A;  4GTA A;  2RH6 A;  4BLB A;  2R92 A;  3OPF A;  1O29 A;  4GTB A;  3H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...