1O27A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and brdump at 2.3 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 75
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o27A00
5CHPA 4GTCA 4FZBA 3N3YA 5IOSA 4KASA 3G4AA 1O24A 1O27A 1O28A 1KQ4A 4GTFA 3N0BA 5IOTA 1O26A 4GTBA 1O29A 4GTEA 1O25A 4GTAA 4P5BA 3N0CA 5IOQA 3AH5A 5JFEA 4KARA 4GTDA 2CFAA 3G4CA 4GTLA 4P5AA 1O2BA 4KATA 1O2AA 5IORA 2CFAB 4GT9A
chains in the Genus database with same CATH superfamily
4A3FK 1I6HC 5IYCK 2E2HA 1BJTA 3S1QK 3NUHA 4BY1K 4BXXC 2JA5A 1O27A 3BP3A 4GTBA 1O29A 3GIRA 3SZYA 4KM8A 3HOXK 4A3CK 4BLAA 3H0GK 2NVTK 3GTOA 2FQOA 1TWGC 4KMUA 3FOFA 1XZPB 3HOWK 3AQOA 1J6VA 1WCMA 4G7OA 5CHPA 2O5IA 1I3QK 2E2JC 1F7UA 3LAJA 1I50K 1SMYA 3G4AA 5FLMK 2GSUA 4OIPA 2VUMC 3M4OK 2JA7A 2Y3PA 4G0UA 5D4DA 1Y1WA 1YX2A 4XLNA 2P8TA 3GTPA 1VH2A 4XSZA 1XXCA 2JA6A 1PJ7A 1USMA 3S15C 2P5MA 4BXXK 2PMZL 3GTLC 1XXBA 3JSTA 1WIHA 4Y52C 3OEPA 4KMAA 2V6TA 2NVQC 2E2HK 2JA5K 3S16K 4NOIA 5C44C 3S1MK 1TWAA 1WOOA 4AYBL 4C3HC 4A3EC 1TWHA 3GTOK 3I4NK 3ADAC 4A3GC 1TWAC 4GTDA 4YFKA 4FM9A 1K83C 1BGWA 3AD9C 2B63C 1WOPA 5HL8A 1WCMK 1IS1A 2CFAB 2E2IC 2R7ZC 4A3JK 1ZYRA 2R92A 3GTMC 2JA7K 4WJ4A 1Y1WK 4A93C 4KMDA 2RGRA 3PO3K 4A3MK 2NVXC 3GTPK 4BBSK 4C45A 3SZZA 2JA6K 2A69A 4P5BA 5JFEA 2WAQL 4A3FC 5IYCC 2PMZD 5M3MK 3H0GA 4BY1C 4BKWA 1F93A 1PJ5A 2RH6A 4G7ZA 4KC6A 4GT9A 4GZYA 3V4GA 3HOXC 4A3CC 3H0GC 1VLOA 2NVTC 4A3BK 1TWAK 1X31C 1DCPA 4KN7A 4Y7NK 2ZUFA 1TWHK 5IOTA 3HOWC 4GTEA 4JK1A 2V6UA 5C3EK 4BBRK 1YNNA 3WODA 4G0VA 1HI9A 1I3QC 5IP7K 3EQLA 1I50C 1XZQA 1EI6A 5FLMC 4C3JK 4KMHA 4P5AA 2A6HA 3M4OC 4P9SA 2R92K 2XCRB 1ZVUA 3T01A 1TWCA 3GTJA 2Y0SL 5M5YK 1Y1VA 4PABA 2YU9A 2NVYA 2WAQD 1XXAA 2E2HC 3I4MK 5IOQA 2JA5C 4KN4A 3S16C 2YU9C 1IQ0A 5CJ9A 3S1MC 3S1RK 1WSRA 4KATA 4OIRA 3GTKA 3IPJA 3Q3QA 3GTOC 3S17K 4A3LK 3I4NC 4C2MK 5EGEA 1DCHA 1I6VA 1EFWA 1O28A 4ILDA 1KQ4A 3N0BA 1WCMC 2WB1L 1G51A 4X6AK 4A3KK 4MEYA 1O2FB 4A3JC 3S2DK 3G4CA 2JA7C 1WSVA 4YFNA 1Y1WC 1VGXA 3PO3C 4A3MC 3GTPC 3T00A 4BBSC 1IW7A 4G7HA 2JA6C 1V5VA 1TWCK 3GTJK 1F7VA 2Y0SD 1Y1VK 2YU9K 4MEXA 1USOA 1L0WA 2NVYK 3GEIA 4A3DK 1O25A 1ISEA 1VRQC 4KARA 4OIQA 4KB2A 2XCQA 4A3BC 3FHZA 3GSIA 4DDQA 4Y7NC 3GTKK 5TJ3A 1O2BA 3HOVK 3ERED 1TWHC 3S14K 1O2AA 5C3EC 4BBRC 3HOYK 4QIWL 3AD7C 5IP7C 3GTGA 1WQFA 4C3JC 2WB1D 3RZOK 1R9TA 3A8IA 5C4XC 4A3IK 5M5XK 4Q4ZA 2R92C 3HOZK 5M3FK 4QJVB 4C3IK 3CQZK 3GTQA 2A6EA 3AD8C 1DCOA 1JQWA 5E68A 5EGHA 1DD5A 3I4MC 4BY7K 3S1RC 4AYBD 3MMLB 4LK0A 1TWFA 2GSNA 2KWAA 4YG2A 3S17C 3OREA 4A3LC 4C2MC 3M3YK 4LK1A 4OIOA 2D6FC 3HXAA 4WILA 3TFHA 1XZQB 5C4XK 4A3KC 2GAHC 4X6AC 4QIWD 1WORA 1EH1A 3GTGK 3S2DC 4LJZA 3DXJA 3T02A 5IOSA 3FOEA 3FKIA 1BDFA 1SFOA 1R9TK 4GFQA 3S2HK 1B4BA 3GDZA 2O5JA 3GTQK 1TWCC 3GTJC 1Y1VC 1HQMA 2PPBA 3S1NC 4G0WA 1WQGA 5IP9K 3BUEA 2NVYC 4A3DC 2R93A 3K7AK 3A8KA 2JA8K 4LOWA 4WJ3M 1F9NA 1JOEA 3H3VL 4KASA 3RZDK 2R93C 1TWGA 3S0XA 3GTKC 1TWFK 1EQRA 4GTFA 3HOVC 5IYDK 3S14C 4GTAA 1WQHA 2CW0A 3HOUK 3HOYC 1GE9A 1XZPA 2GSOA 5M5WK 3PO2K 5C4JK 4RMFA 5IYBK 3RZOC 3CQZA 2VUMA 1IE0A 4A3IC 4KAWX 3HOZC 3FKIK 3N3YA 1SFOK 4C3IC 2PA8L 3CQZC 3S1NK 2W7VA 3VA7A 2ZFZA 3GTLA 3AQPA 4M1XA 3L4KA 1I6HK 2EBBA 4GTLA 3A8JA 4BY7C 4LQYA 2R93K 4LR2A 4AH6A 1ZBSA 3TFJA 4KM9A 1J6XA 3H3VD 5FJ8K 3M3YC 1TWGK 1J98A 1K83A 1C0AA 2B63A 3GEHA 3HKZL 4BLBA 4LLGA 4XSXA 1XPPA 1ZXOA 3QX3A 2E2JK 2R7ZA 2E2IA 4PAAA 3GTGC 2CFAA 4J3NA 3GTMA 2VUMK 1BS2A 1IBAA 1R9TC 4MQ9A 4ZH4A 3S2HC 3LPXA 1IL2A 1RU0A 2NVXA 4KB4A 3GTQC 2PA8D 3S15K 1J6WA 1O24A 4Q5SA 3GTLK 4XLPA 1AB4A 4QJVA 4Y52K 5JVOA 2GAGC 5IP9C 3TFIA 4OINA 1O26A 2V6SA 3K7AC 3L4JA 2NVQK 1ZQ1C 3LAPA 3N0CA 3AH5A 2JA8C 1VJEA 5C44K 3S1QC 3RZDC 1YCLA 1B4AA 2ZUEA 1TWFC 3OPFA 1EK8A 4O2DA 1INNA 4C3HK 4KDDA 5IYDC 4A3EK 4YFXA 3HOUC 4GTCA 2XCOA 4FZBA 4A3GK 2BE5A 3CAGA 3PO2C 1K83K 3TTGA 1UV7A 1I3QA 5C4JC 2B63K 3HKZD 1I50A 5IYBC 2FQTA 5TMCA 1WOSA 2JH3A 3BP8C 2E2IK 2R7ZK 3GEEA 1YNJA 2A68A 3GTMK 3FKIC 1PJ6A 1SFOC 5TMFA 2PHCB 4A93K 5L46A 4XCHA 2NVXK 5IORA 1JVIA
chains in the Genus database with same CATH topology
3V4GA 4KAWX 3N3YA 2E2HA 1BJTA 4C3IC 3NUHA 3GTGA 2JA5A 1O27A 1WQFA 4C3JC 5IOTA 4GTBA 2ZFZA 3VA7A 1R9TA 1O29A 3AQPA 4GTEA 3GTLA 4KM8A 4M1XA 4BLAA 3L4KA 4G0VA 3GTOA 3GTQA 4GTLA 4LQYA 4KMHA 4P5AA 4LR2A 3FOFA 3AQOA 1ZBSA 1WCMA 5CHPA 4KM9A 5EGHA 2XCRB 1DD5A 3LAJA 1ZVUA 1TWCA 3G4AA 3GTJA 2GSUA 1Y1VA 1K83A 2JA7A 2YU9A 2B63A 4BLBA 2Y3PA 4G0UA 1Y1WA 3MMLB 1ZXOA 1TWFA 2NVYA 2GSNA 3QX3A 1XXAA 2KWAA 3GTPA 2R7ZA 2E2IA 1XXCA 5IOQA 3OREA 2JA6A 4C2MC 2CFAA 2P5MA 4J3NA 5CJ9A 3GTMA 1XXBA 1WIHA 3OEPA 4KATA 3LPXA 4KMAA 3GTKA 3Q3QA 2NVXA 4KB4A 1EH1A 5EGEA 5IOSA 3FOEA 3FKIA 1O24A 1SFOA 1O28A 1TWAA 1AB4A 4GFQA 4ILDA 1KQ4A 5JVOA 3N0BA 1B4BA 1O26A 4C3HC 3L4JA 1TWHA 3LAPA 3N0CA 3AH5A 4GTDA 4FM9A 3G4CA 1BGWA 4G0WA 1WQGA 1B4AA 3BUEA 1IS1A 3OPFA 1EK8A 2R93A 2CFAB 4KDDA 4GTCA 2XCOA 4FZBA 2R92A 1F9NA 3CAGA 1I3QA 4KASA 1I50A 1TWGA 3S0XA 4GTFA 4KMDA 2RGRA 2JH3A 1O25A 1WQHA 4GTAA 1ISEA 1GE9A 4P5BA 5JFEA 2GSOA 4KARA 4KB2A 2XCQA 3H0GA 3FHZA 4BKWA 4DDQA 2RH6A 2PHCB 4KC6A 5TJ3A 1O2BA 3CQZA 2VUMA 3ERED 1O2AA 5IORA 4GT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHP A;  4GTC A;  4FZB A;  3N3Y A;  5IOS A;  4KAS A;  3G4A A;  1O24 A;  1O27 A;  1O28 A;  1KQ4 A;  4GTF A;  3N0B A;  5IOT A;  1O26 A;  4GTB A;  1O29 A;  4GTE A;  1O25 A;  4GTA A;  4P5B A;  3N0C A;  5IOQ A;  3AH5 A;  5JFE A;  4KAR A;  4GTD A;  2CFA A;  3G4C A;  4GTL A;  4P5A A;  1O2B A;  4KAT A;  1O2A A;  5IOR A;  2CFA B;  4GT9 A; 
#chains in the Genus database with same CATH topology
 4A3F K;  1I6H C;  5IYC K;  2E2H A;  1BJT A;  3S1Q K;  3NUH A;  4BY1 K;  4BXX C;  2JA5 A;  1O27 A;  3BP3 A;  4GTB A;  1O29 A;  3GIR A;  3SZY A;  4KM8 A;  3HOX K;  4A3C K;  4BLA A;  3H0G K;  2NVT K;  3GTO A;  2FQO A;  1TWG C;  4KMU A;  3FOF A;  1XZP B;  3HOW K;  3AQO A;  1J6V A;  1WCM A;  4G7O A;  5CHP A;  2O5I A;  1I3Q K;  2E2J C;  1F7U A;  3LAJ A;  1I50 K;  1SMY A;  3G4A A;  5FLM K;  2GSU A;  4OIP A;  2VUM C;  3M4O K;  2JA7 A;  2Y3P A;  4G0U A;  5D4D A;  1Y1W A;  1YX2 A;  4XLN A;  2P8T A;  3GTP A;  1VH2 A;  4XSZ A;  1XXC A;  2JA6 A;  1PJ7 A;  1USM A;  3S15 C;  2P5M A;  4BXX K;  2PMZ L;  3GTL C;  1XXB A;  3JST A;  1WIH A;  4Y52 C;  3OEP A;  4KMA A;  2V6T A;  2NVQ C;  2E2H K;  2JA5 K;  3S16 K;  4NOI A;  5C44 C;  3S1M K;  1TWA A;  1WOO A;  4AYB L;  4C3H C;  4A3E C;  1TWH A;  3GTO K;  3I4N K;  3ADA C;  4A3G C;  1TWA C;  4GTD A;  4YFK A;  4FM9 A;  1K83 C;  1BGW A;  3AD9 C;  2B63 C;  1WOP A;  5HL8 A;  1WCM K;  1IS1 A;  2CFA B;  2E2I C;  2R7Z C;  4A3J K;  1ZYR A;  2R92 A;  3GTM C;  2JA7 K;  4WJ4 A;  1Y1W K;  4A93 C;  4KMD A;  2RGR A;  3PO3 K;  4A3M K;  2NVX C;  3GTP K;  4BBS K;  4C45 A;  3SZZ A;  2JA6 K;  2A69 A;  4P5B A;  5JFE A;  2WAQ L;  4A3F C;  5IYC C;  2PMZ D;  5M3M K;  3H0G A;  4BY1 C;  4BKW A;  1F93 A;  1PJ5 A;  2RH6 A;  4G7Z A;  4KC6 A;  4GT9 A;  4GZY A;  3V4G A;  3HOX C;  4A3C C;  3H0G C;  1VLO A;  2NVT C;  4A3B K;  1TWA K;  1X31 C;  1DCP A;  4KN7 A;  4Y7N K;  2ZUF A;  1TWH K;  5IOT A;  3HOW C;  4GTE A;  4JK1 A;  2V6U A;  5C3E K;  4BBR K;  1YNN A;  3WOD A;  4G0V A;  1HI9 A;  1I3Q C;  5IP7 K;  3EQL A;  1I50 C;  1XZQ A;  1EI6 A;  5FLM C;  4C3J K;  4KMH A;  4P5A A;  2A6H A;  3M4O C;  4P9S A;  2R92 K;  2XCR B;  1ZVU A;  3T01 A;  1TWC A;  3GTJ A;  2Y0S L;  5M5Y K;  1Y1V A;  4PAB A;  2YU9 A;  2NVY A;  2WAQ D;  1XXA A;  2E2H C;  3I4M K;  5IOQ A;  2JA5 C;  4KN4 A;  3S16 C;  2YU9 C;  1IQ0 A;  5CJ9 A;  3S1M C;  3S1R K;  1WSR A;  4KAT A;  4OIR A;  3GTK A;  3IPJ A;  3Q3Q A;  3GTO C;  3S17 K;  4A3L K;  3I4N C;  4C2M K;  5EGE A;  1DCH A;  1I6V A;  1EFW A;  1O28 A;  4ILD A;  1KQ4 A;  3N0B A;  1WCM C;  2WB1 L;  1G51 A;  4X6A K;  4A3K K;  4MEY A;  1O2F B;  4A3J C;  3S2D K;  3G4C A;  2JA7 C;  1WSV A;  4YFN A;  1Y1W C;  1VGX A;  3PO3 C;  4A3M C;  3GTP C;  3T00 A;  4BBS C;  1IW7 A;  4G7H A;  2JA6 C;  1V5V A;  1TWC K;  3GTJ K;  1F7V A;  2Y0S D;  1Y1V K;  2YU9 K;  4MEX A;  1USO A;  1L0W A;  2NVY K;  3GEI A;  4A3D K;  1O25 A;  1ISE A;  1VRQ C;  4KAR A;  4OIQ A;  4KB2 A;  2XCQ A;  4A3B C;  3FHZ A;  3GSI A;  4DDQ A;  4Y7N C;  3GTK K;  5TJ3 A;  1O2B A;  3HOV K;  3ERE D;  1TWH C;  3S14 K;  1O2A A;  5C3E C;  4BBR C;  3HOY K;  4QIW L;  3AD7 C;  5IP7 C;  3GTG A;  1WQF A;  4C3J C;  2WB1 D;  3RZO K;  1R9T A;  3A8I A;  5C4X C;  4A3I K;  5M5X K;  4Q4Z A;  2R92 C;  3HOZ K;  5M3F K;  4QJV B;  4C3I K;  3CQZ K;  3GTQ A;  2A6E A;  3AD8 C;  1DCO A;  1JQW A;  5E68 A;  5EGH A;  1DD5 A;  3I4M C;  4BY7 K;  3S1R C;  4AYB D;  3MML B;  4LK0 A;  1TWF A;  2GSN A;  2KWA A;  4YG2 A;  3S17 C;  3ORE A;  4A3L C;  4C2M C;  3M3Y K;  4LK1 A;  4OIO A;  2D6F C;  3HXA A;  4WIL A;  3TFH A;  1XZQ B;  5C4X K;  4A3K C;  2GAH C;  4X6A C;  4QIW D;  1WOR A;  1EH1 A;  3GTG K;  3S2D C;  4LJZ A;  3DXJ A;  3T02 A;  5IOS A;  3FOE A;  3FKI A;  1BDF A;  1SFO A;  1R9T K;  4GFQ A;  3S2H K;  1B4B A;  3GDZ A;  2O5J A;  3GTQ K;  1TWC C;  3GTJ C;  1Y1V C;  1HQM A;  2PPB A;  3S1N C;  4G0W A;  1WQG A;  5IP9 K;  3BUE A;  2NVY C;  4A3D C;  2R93 A;  3K7A K;  3A8K A;  2JA8 K;  4LOW A;  4WJ3 M;  1F9N A;  1JOE A;  3H3V L;  4KAS A;  3RZD K;  2R93 C;  1TWG A;  3S0X A;  3GTK C;  1TWF K;  1EQR A;  4GTF A;  3HOV C;  5IYD K;  3S14 C;  4GTA A;  1WQH A;  2CW0 A;  3HOU K;  3HOY C;  1GE9 A;  1XZP A;  2GSO A;  5M5W K;  3PO2 K;  5C4J K;  4RMF A;  5IYB K;  3RZO C;  3CQZ A;  2VUM A;  1IE0 A;  4A3I C;  4KAW X;  3HOZ C;  3FKI K;  3N3Y A;  1SFO K;  4C3I C;  2PA8 L;  3CQZ C;  3S1N K;  2W7V A;  3VA7 A;  2ZFZ A;  3GTL A;  3AQP A;  4M1X A;  3L4K A;  1I6H K;  2EBB A;  4GTL A;  3A8J A;  4BY7 C;  4LQY A;  2R93 K;  4LR2 A;  4AH6 A;  1ZBS A;  3TFJ A;  4KM9 A;  1J6X A;  3H3V D;  5FJ8 K;  3M3Y C;  1TWG K;  1J98 A;  1K83 A;  1C0A A;  2B63 A;  3GEH A;  3HKZ L;  4BLB A;  4LLG A;  4XSX A;  1XPP A;  1ZXO A;  3QX3 A;  2E2J K;  2R7Z A;  2E2I A;  4PAA A;  3GTG C;  2CFA A;  4J3N A;  3GTM A;  2VUM K;  1BS2 A;  1IBA A;  1R9T C;  4MQ9 A;  4ZH4 A;  3S2H C;  3LPX A;  1IL2 A;  1RU0 A;  2NVX A;  4KB4 A;  3GTQ C;  2PA8 D;  3S15 K;  1J6W A;  1O24 A;  4Q5S A;  3GTL K;  4XLP A;  1AB4 A;  4QJV A;  4Y52 K;  5JVO A;  2GAG C;  5IP9 C;  3TFI A;  4OIN A;  1O26 A;  2V6S A;  3K7A C;  3L4J A;  2NVQ K;  1ZQ1 C;  3LAP A;  3N0C A;  3AH5 A;  2JA8 C;  1VJE A;  5C44 K;  3S1Q C;  3RZD C;  1YCL A;  1B4A A;  2ZUE A;  1TWF C;  3OPF A;  1EK8 A;  4O2D A;  1INN A;  4C3H K;  4KDD A;  5IYD C;  4A3E K;  4YFX A;  3HOU C;  4GTC A;  2XCO A;  4FZB A;  4A3G K;  2BE5 A;  3CAG A;  3PO2 C;  1K83 K;  3TTG A;  1UV7 A;  1I3Q A;  5C4J C;  2B63 K;  3HKZ D;  1I50 A;  5IYB C;  2FQT A;  5TMC A;  1WOS A;  2JH3 A;  3BP8 C;  2E2I K;  2R7Z K;  3GEE A;  1YNJ A;  2A68 A;  3GTM K;  3FKI C;  1PJ6 A;  1SFO C;  5TMF A;  2PHC B;  4A93 K;  5L46 A;  4XCH A;  2NVX K;  5IOR A;  1JVI A; 
#chains in the Genus database with same CATH homology
 3V4G A;  4KAW X;  3N3Y A;  2E2H A;  1BJT A;  4C3I C;  3NUH A;  3GTG A;  2JA5 A;  1O27 A;  1WQF A;  4C3J C;  5IOT A;  4GTB A;  2ZFZ A;  3VA7 A;  1R9T A;  1O29 A;  3AQP A;  4GTE A;  3GTL A;  4KM8 A;  4M1X A;  4BLA A;  3L4K A;  4G0V A;  3GTO A;  3GTQ A;  4GTL A;  4LQY A;  4KMH A;  4P5A A;  4LR2 A;  3FOF A;  3AQO A;  1ZBS A;  1WCM A;  5CHP A;  4KM9 A;  5EGH A;  2XCR B;  1DD5 A;  3LAJ A;  1ZVU A;  1TWC A;  3G4A A;  3GTJ A;  2GSU A;  1Y1V A;  1K83 A;  2JA7 A;  2YU9 A;  2B63 A;  4BLB A;  2Y3P A;  4G0U A;  1Y1W A;  3MML B;  1ZXO A;  1TWF A;  2NVY A;  2GSN A;  3QX3 A;  1XXA A;  2KWA A;  3GTP A;  2R7Z A;  2E2I A;  1XXC A;  5IOQ A;  3ORE A;  2JA6 A;  4C2M C;  2CFA A;  2P5M A;  4J3N A;  5CJ9 A;  3GTM A;  1XXB A;  1WIH A;  3OEP A;  4KAT A;  3LPX A;  4KMA A;  3GTK A;  3Q3Q A;  2NVX A;  4KB4 A;  1EH1 A;  5EGE A;  5IOS A;  3FOE A;  3FKI A;  1O24 A;  1SFO A;  1O28 A;  1TWA A;  1AB4 A;  4GFQ A;  4ILD A;  1KQ4 A;  5JVO A;  3N0B A;  1B4B A;  1O26 A;  4C3H C;  3L4J A;  1TWH A;  3LAP A;  3N0C A;  3AH5 A;  4GTD A;  4FM9 A;  3G4C A;  1BGW A;  4G0W A;  1WQG A;  1B4A A;  3BUE A;  1IS1 A;  3OPF A;  1EK8 A;  2R93 A;  2CFA B;  4KDD A;  4GTC A;  2XCO A;  4FZB A;  2R92 A;  1F9N A;  3CAG A;  1I3Q A;  4KAS A;  1I50 A;  1TWG A;  3S0X A;  4GTF A;  4KMD A;  2RGR A;  2JH3 A;  1O25 A;  1WQH A;  4GTA A;  1ISE A;  1GE9 A;  4P5B A;  5JFE A;  2GSO A;  4KAR A;  4KB2 A;  2XCQ A;  3H0G A;  3FHZ A;  4BKW A;  4DDQ A;  2RH6 A;  2PHC B;  4KC6 A;  5TJ3 A;  1O2B A;  3CQZ A;  2VUM A;  3ERE D;  1O2A A;  5IOR A;  4GT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...