1O27A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and brdump at 2.3 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 75
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o27A00
3N3YA 4GTFA 4KASA 4GTDA 4GTEA 5IOTA 4KARA 5CHPA 4FZBA 3N0BA 1O27A 5JFEA 1O2BA 1O24A 5IOSA 4GTLA 1O2AA 4GT9A 4P5AA 4GTBA 4P5BA 3AH5A 2CFAA 3G4AA 4GTCA 5IORA 1KQ4A 1O26A 1O29A 4GTAA 3N0CA 1O28A 3G4CA 1O25A 4KATA 5IOQA 2CFAB
chains in the Genus database with same CATH superfamily
3PO3C 4YFXA 1Y1VC 3H0GK 5D4DA 1BJTA 2E2HK 5IP7C 4A3BK 4A3LC 5HL8A 5CHPA 1O2BA 4DDQA 3FHZA 1J6VA 1ZBSA 1DD5A 4KMDA 2KWAA 3A8KA 3IPJA 4A3MC 3GTMC 4A3CC 3TTGA 3HOXC 2PMZL 3TFIA 4JK1A 2JA8C 4AH6A 3GTJK 1VRQC 5CJ9A 1J6XA 5FLMC 1B4AA 5IOTA 4LK1A 2NVYC 4G7OA 1TWFC 1EH1A 3GIRA 3TFJA 3S1RC 3RZOK 3PO2C 4LOWA 3M3YC 4GTLA 2NVTC 3GTPA 1IBAA 3MMLB 1SFOA 4M1XA 4C3IC 1F7UA 4NOIA 2PA8L 2R7ZK 2V6SA 3BP3A 4PABA 1KQ4A 4G0UA 3N0CA 5E68A 4ZH4A 1O25A 2P8TA 5TMCA 4BBRC 5IP9K 1I3QA 3GTKK 4A3FK 1RU0A 4LQYA 1R9TA 2YU9A 4Y52C 3ERED 1XZPB 2ZUFA 4LR2A 4A3GC 5IYDK 4BLBA 3GTOA 5IYBK 1TWGA 1V5VA 4KC6A 3CAGA 1J6WA 3M4OK 3A8IA 4ILDA 3S1NK 4GTCA 3I4NC 3HOWC 1K83A 3I4MK 4AYBD 3CQZA 4A3EC 2V6TA 4XSZA 3AD8C 4A3KC 3GTPC 1Y1WA 1HQMA 5TMFA 5TJ3A 1SFOC 2E2IK 4MQ9A 2O5JA 1GE9A 1VGXA 3N0BA 3H0GA 4J3NA 4G0WA 4C3JC 3HOYK 2B63K 4A93K 2BE5A 2XCRB 4KM9A 1I3QC 1WOOA 4YFNA 4BBSK 1F9NA 2WB1L 2YU9C 3HOZK 5FJ8K 1XZPA 3FKIK 3GTOC 1TWGC 3RZDC 3S2HK 3GTJA 1JVIA 1JOEA 4BY7C 3S1QC 5JVOA 1WOPA 1YNNA 1K83C 3FOFA 2JA6A 1PJ6A 2NVXK 2R92A 3CQZC 3S1MK 1I50K 1TWFA 4XSXA 1PJ7A 3OEPA 1XZQA 1BDFA 1Y1WC 3S15K 5M3MK 3A8JA 2VUMK 3H0GC 3V4GA 1ZYRA 4QJVA 1IQ0A 2A6EA 4A3BC 4BLAA 4A3DK 3GTKA 1AB4A 3K7AK 5JFEA 4C45A 3S14C 4BXXK 2XCOA 3GTLK 3GTQK 2JA5A 4G7HA 1X31C 3GTJC 4YFKA 3H3VD 3GTGA 1WCMK 2WAQD 4KASA 3T00A 1DCOA 3PO3K 1Y1VK 2JA6C 3RZOC 3SZYA 5IP7K 2GAGC 2R92C 4A3LK 3HKZD 5EGHA 3QX3A 1VLOA 1PJ5A 4LK0A 1WSRA 2Y0SL 1XXBA 3ADAC 4BKWA 4C2MK 1F93A 2CW0A 3HXAA 4KB2A 4LLGA 2B63A 3WODA 3HOXK 1VJEA 1YX2A 4P9SA 5IP9C 3GTKC 4A3FC 1TWAA 2CFAB 1TWCK 1F7VA 4GTEA 2GSOA 2PMZD 3OREA 2EBBA 2JA5C 5C44C 2NVYK 1ZVUA 1O27A 3FOEA 3S1RK 3PO2K 3GTGC 1BGWA 4AYBL 2NVTK 3M4OC 4Q5SA 4QIWD 4GFQA 3OPFA 1IE0A 4KMAA 4OIRA 4C3IK 1EK8A 2NVXA 5IOQA 1IW7A 3GEHA 2PA8D 3L4KA 3L4JA 2JA7A 1USOA 1XZQB 4WJ4A 4G0VA 3HOYC 2B63C 1O24A 1XPPA 4A3IC 4A3GK 2E2HA 4QJVB 4X6AC 2E2JK 5C4XC 4OINA 2W7VA 1TWAC 3S16C 2CFAA 1JQWA 3AQOA 1DCPA 1TWHK 4GZYA 3I4NK 3HOWK 3GTLA 5C4JK 2ZFZA 3AD9C 4KMUA 4BY1C 3EQLA 3JSTA 3T01A 3HOVC 1USMA 3GTPK 1WQFA 3AD7C 1IL2A 1I6HC 2GAHC 4XCHA 1HI9A 2NVXC 3GEIA 3SZZA 4GTBA 1B4BA 4KB4A 1VH2A 5C3EK 1WSVA 4FM9A 2NVQK 4PAAA 1I3QK 5IORA 5IYCK 1R9TK 2YU9K 2JA7C 2VUMC 4OIQA 5M5WK 2R7ZA 3AQPA 4KM8A 3HOUK 2E2HC 3GTOK 3BUEA 3S2DK 3RZDK 3K7AC 4KARA 3VA7A 1I6VA 2GSNA 3GEEA 2R93K 4BXXC 4BY7K 1O2AA 4C3HK 1XXAA 3GTLC 1K83K 4A3JK 4Y7NK 3GDZA 3G4AA 3CQZK 2RGRA 1O26A 3S17K 3DXJA 1BS2A 3GSIA 1C0AA 4G7ZA 5IOSA 2E2IA 2O5IA 3S14K 4C2MC 2R7ZC 2ZUEA 2GSUA 4MEXA 2FQTA 2Y3PA 4A3MK 2A69A 5EGEA 3GTMK 4A3CK 1WOSA 2JH3A 1TWCC 2JA8K 4YG2A 1TWHA 4QIWL 1J98A 1XXCA 4KN7A 3FKIA 2JA6K 5IYDC 5FLMK 1ZQ1C 5IYBC 2R92K 1WQHA 4OIPA 1TWFK 2PPBA 4KDDA 3TFHA 3M3YK 1INNA 3S1NC 3NUHA 4KAWX 3T02A 3I4MC 4KATA 5M3FK 1I50A 4RMFA 2Y0SD 3N3YA 4GTFA 4BBRK 2E2IC 1YNJA 2VUMA 4Y52K 2V6UA 2E2JC 2JA5K 5C44K 4GT9A 4O2DA 4WILA 4P5AA 4A93C 3GTGK 3AH5A 2R93A 1IS1A 4BBSC 1DCHA 2PHCB 3HOZC 1TWHC 1WIHA 3Q3QA 1UV7A 5M5XK 2A6HA 1O29A 5C4JC 3FKIC 1WQGA 3GTQA 1G51A 3S2HC 4XLPA 4GTDA 2D6FC 1ISEA 4A3EK 1WCMA 4FZBA 1EFWA 1EQRA 4LJZA 4A3KK 1SFOK 1L0WA 1YCLA 3BP8C 1Y1VA 4KN4A 5C3EC 4A3IK 4P5BA 5C4XK 2P5MA 4KMHA 2NVQC 4X6AK 3S1MC 1I50C 4C3JK 5IYCC 1TWAK 1R9TC 3S16K 3S15C 4GTAA 3HOUC 4XLNA 1O28A 3G4CA 3S2DC 4A3DC 3GTMA 4Q4ZA 4BY1K 4WJ3M 1TWGK 3LPXA 2R93C 2WB1D 3HOVK 4C3HC 1WORA 1TWCA 3H3VL 4MEYA 2A68A 1ZXOA 4A3JC 4Y7NC 1O2FB 1I6HK 3S1QK 3LAJA 2WAQL 2XCQA 3GTQC 2NVYA 3S0XA 3LAPA 2FQOA 1SMYA 3HKZL 5M5YK 1WCMC 3S17C 2RH6A 2JA7K 1EI6A 5L46A 1Y1WK 4OIOA
chains in the Genus database with same CATH topology
1TWHA 3GTJA 1XXCA 3L4KA 1BJTA 3L4JA 2JA7A 3FKIA 5CHPA 4G0VA 5JVOA 1WQHA 1O2BA 1O24A 4DDQA 2E2HA 3FHZA 3FOFA 1ZBSA 1DD5A 4KMDA 4KDDA 2JA6A 2KWAA 2R92A 2CFAA 3NUHA 3AQOA 4KAWX 1TWFA 3OEPA 3GTLA 4KATA 1I50A 3V4GA 2ZFZA 3N3YA 4GTFA 4BLAA 5CJ9A 1B4AA 5IOTA 2VUMA 3GTKA 1AB4A 1EH1A 1WQFA 5JFEA 4GTLA 4GT9A 4P5AA 4GTBA 3GTPA 1B4BA 3MMLB 1SFOA 4M1XA 4KB4A 4C3IC 3AH5A 2R93A 1IS1A 4FM9A 2XCOA 2PHCB 2JA5A 3Q3QA 1WIHA 5IORA 1KQ4A 4G0UA 3GTGA 1O29A 3N0CA 1WQGA 1O25A 3GTQA 2R7ZA 3AQPA 4KM8A 1I3QA 4KASA 4GTDA 4LQYA 3BUEA 1R9TA 2YU9A 1ISEA 3ERED 4KARA 3VA7A 1WCMA 2GSNA 4FZBA 4LR2A 5EGHA 3QX3A 4BLBA 3GTOA 1TWGA 1O2AA 1Y1VA 4KC6A 1XXAA 4P5BA 2P5MA 3CAGA 4KMHA 1XXBA 4BKWA 4ILDA 3G4AA 4KB2A 2B63A 4GTCA 2RGRA 1K83A 1O26A 4GTAA 1O28A 3G4CA 1TWAA 2CFAB 3CQZA 3GTMA 4GTEA 2GSOA 1Y1WA 5TJ3A 3LPXA 3OREA 1GE9A 3N0BA 3H0GA 1TWCA 4J3NA 4C3HC 4G0WA 1ZVUA 1O27A 3FOEA 1ZXOA 5IOSA 1BGWA 2E2IA 3LAJA 4C3JC 4C2MC 4GFQA 2XCQA 3OPFA 4KMAA 2NVYA 2XCRB 4KM9A 2GSUA 2Y3PA 3S0XA 1F9NA 3LAPA 5EGEA 1EK8A 2NVXA 2JH3A 2RH6A 5IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3Y A;  4GTF A;  4KAS A;  4GTD A;  4GTE A;  5IOT A;  4KAR A;  5CHP A;  4FZB A;  3N0B A;  1O27 A;  5JFE A;  1O2B A;  1O24 A;  5IOS A;  4GTL A;  1O2A A;  4GT9 A;  4P5A A;  4GTB A;  4P5B A;  3AH5 A;  2CFA A;  3G4A A;  4GTC A;  5IOR A;  1KQ4 A;  1O26 A;  1O29 A;  4GTA A;  3N0C A;  1O28 A;  3G4C A;  1O25 A;  4KAT A;  5IOQ A;  2CFA B; 
#chains in the Genus database with same CATH topology
 3PO3 C;  4YFX A;  1Y1V C;  3H0G K;  5D4D A;  1BJT A;  2E2H K;  5IP7 C;  4A3B K;  4A3L C;  5HL8 A;  5CHP A;  1O2B A;  4DDQ A;  3FHZ A;  1J6V A;  1ZBS A;  1DD5 A;  4KMD A;  2KWA A;  3A8K A;  3IPJ A;  4A3M C;  3GTM C;  4A3C C;  3TTG A;  3HOX C;  2PMZ L;  3TFI A;  4JK1 A;  2JA8 C;  4AH6 A;  3GTJ K;  1VRQ C;  5CJ9 A;  1J6X A;  5FLM C;  1B4A A;  5IOT A;  4LK1 A;  2NVY C;  4G7O A;  1TWF C;  1EH1 A;  3GIR A;  3TFJ A;  3S1R C;  3RZO K;  3PO2 C;  4LOW A;  3M3Y C;  4GTL A;  2NVT C;  3GTP A;  1IBA A;  3MML B;  1SFO A;  4M1X A;  4C3I C;  1F7U A;  4NOI A;  2PA8 L;  2R7Z K;  2V6S A;  3BP3 A;  4PAB A;  1KQ4 A;  4G0U A;  3N0C A;  5E68 A;  4ZH4 A;  1O25 A;  2P8T A;  5TMC A;  4BBR C;  5IP9 K;  1I3Q A;  3GTK K;  4A3F K;  1RU0 A;  4LQY A;  1R9T A;  2YU9 A;  4Y52 C;  3ERE D;  1XZP B;  2ZUF A;  4LR2 A;  4A3G C;  5IYD K;  4BLB A;  3GTO A;  5IYB K;  1TWG A;  1V5V A;  4KC6 A;  3CAG A;  1J6W A;  3M4O K;  3A8I A;  4ILD A;  3S1N K;  4GTC A;  3I4N C;  3HOW C;  1K83 A;  3I4M K;  4AYB D;  3CQZ A;  4A3E C;  2V6T A;  4XSZ A;  3AD8 C;  4A3K C;  3GTP C;  1Y1W A;  1HQM A;  5TMF A;  5TJ3 A;  1SFO C;  2E2I K;  4MQ9 A;  2O5J A;  1GE9 A;  1VGX A;  3N0B A;  3H0G A;  4J3N A;  4G0W A;  4C3J C;  3HOY K;  2B63 K;  4A93 K;  2BE5 A;  2XCR B;  4KM9 A;  1I3Q C;  1WOO A;  4YFN A;  4BBS K;  1F9N A;  2WB1 L;  2YU9 C;  3HOZ K;  5FJ8 K;  1XZP A;  3FKI K;  3GTO C;  1TWG C;  3RZD C;  3S2H K;  3GTJ A;  1JVI A;  1JOE A;  4BY7 C;  3S1Q C;  5JVO A;  1WOP A;  1YNN A;  1K83 C;  3FOF A;  2JA6 A;  1PJ6 A;  2NVX K;  2R92 A;  3CQZ C;  3S1M K;  1I50 K;  1TWF A;  4XSX A;  1PJ7 A;  3OEP A;  1XZQ A;  1BDF A;  1Y1W C;  3S15 K;  5M3M K;  3A8J A;  2VUM K;  3H0G C;  3V4G A;  1ZYR A;  4QJV A;  1IQ0 A;  2A6E A;  4A3B C;  4BLA A;  4A3D K;  3GTK A;  1AB4 A;  3K7A K;  5JFE A;  4C45 A;  3S14 C;  4BXX K;  2XCO A;  3GTL K;  3GTQ K;  2JA5 A;  4G7H A;  1X31 C;  3GTJ C;  4YFK A;  3H3V D;  3GTG A;  1WCM K;  2WAQ D;  4KAS A;  3T00 A;  1DCO A;  3PO3 K;  1Y1V K;  2JA6 C;  3RZO C;  3SZY A;  5IP7 K;  2GAG C;  2R92 C;  4A3L K;  3HKZ D;  5EGH A;  3QX3 A;  1VLO A;  1PJ5 A;  4LK0 A;  1WSR A;  2Y0S L;  1XXB A;  3ADA C;  4BKW A;  4C2M K;  1F93 A;  2CW0 A;  3HXA A;  4KB2 A;  4LLG A;  2B63 A;  3WOD A;  3HOX K;  1VJE A;  1YX2 A;  4P9S A;  5IP9 C;  3GTK C;  4A3F C;  1TWA A;  2CFA B;  1TWC K;  1F7V A;  4GTE A;  2GSO A;  2PMZ D;  3ORE A;  2EBB A;  2JA5 C;  5C44 C;  2NVY K;  1ZVU A;  1O27 A;  3FOE A;  3S1R K;  3PO2 K;  3GTG C;  1BGW A;  4AYB L;  2NVT K;  3M4O C;  4Q5S A;  4QIW D;  4GFQ A;  3OPF A;  1IE0 A;  4KMA A;  4OIR A;  4C3I K;  1EK8 A;  2NVX A;  5IOQ A;  1IW7 A;  3GEH A;  2PA8 D;  3L4K A;  3L4J A;  2JA7 A;  1USO A;  1XZQ B;  4WJ4 A;  4G0V A;  3HOY C;  2B63 C;  1O24 A;  1XPP A;  4A3I C;  4A3G K;  2E2H A;  4QJV B;  4X6A C;  2E2J K;  5C4X C;  4OIN A;  2W7V A;  1TWA C;  3S16 C;  2CFA A;  1JQW A;  3AQO A;  1DCP A;  1TWH K;  4GZY A;  3I4N K;  3HOW K;  3GTL A;  5C4J K;  2ZFZ A;  3AD9 C;  4KMU A;  4BY1 C;  3EQL A;  3JST A;  3T01 A;  3HOV C;  1USM A;  3GTP K;  1WQF A;  3AD7 C;  1IL2 A;  1I6H C;  2GAH C;  4XCH A;  1HI9 A;  2NVX C;  3GEI A;  3SZZ A;  4GTB A;  1B4B A;  4KB4 A;  1VH2 A;  5C3E K;  1WSV A;  4FM9 A;  2NVQ K;  4PAA A;  1I3Q K;  5IOR A;  5IYC K;  1R9T K;  2YU9 K;  2JA7 C;  2VUM C;  4OIQ A;  5M5W K;  2R7Z A;  3AQP A;  4KM8 A;  3HOU K;  2E2H C;  3GTO K;  3BUE A;  3S2D K;  3RZD K;  3K7A C;  4KAR A;  3VA7 A;  1I6V A;  2GSN A;  3GEE A;  2R93 K;  4BXX C;  4BY7 K;  1O2A A;  4C3H K;  1XXA A;  3GTL C;  1K83 K;  4A3J K;  4Y7N K;  3GDZ A;  3G4A A;  3CQZ K;  2RGR A;  1O26 A;  3S17 K;  3DXJ A;  1BS2 A;  3GSI A;  1C0A A;  4G7Z A;  5IOS A;  2E2I A;  2O5I A;  3S14 K;  4C2M C;  2R7Z C;  2ZUE A;  2GSU A;  4MEX A;  2FQT A;  2Y3P A;  4A3M K;  2A69 A;  5EGE A;  3GTM K;  4A3C K;  1WOS A;  2JH3 A;  1TWC C;  2JA8 K;  4YG2 A;  1TWH A;  4QIW L;  1J98 A;  1XXC A;  4KN7 A;  3FKI A;  2JA6 K;  5IYD C;  5FLM K;  1ZQ1 C;  5IYB C;  2R92 K;  1WQH A;  4OIP A;  1TWF K;  2PPB A;  4KDD A;  3TFH A;  3M3Y K;  1INN A;  3S1N C;  3NUH A;  4KAW X;  3T02 A;  3I4M C;  4KAT A;  5M3F K;  1I50 A;  4RMF A;  2Y0S D;  3N3Y A;  4GTF A;  4BBR K;  2E2I C;  1YNJ A;  2VUM A;  4Y52 K;  2V6U A;  2E2J C;  2JA5 K;  5C44 K;  4GT9 A;  4O2D A;  4WIL A;  4P5A A;  4A93 C;  3GTG K;  3AH5 A;  2R93 A;  1IS1 A;  4BBS C;  1DCH A;  2PHC B;  3HOZ C;  1TWH C;  1WIH A;  3Q3Q A;  1UV7 A;  5M5X K;  2A6H A;  1O29 A;  5C4J C;  3FKI C;  1WQG A;  3GTQ A;  1G51 A;  3S2H C;  4XLP A;  4GTD A;  2D6F C;  1ISE A;  4A3E K;  1WCM A;  4FZB A;  1EFW A;  1EQR A;  4LJZ A;  4A3K K;  1SFO K;  1L0W A;  1YCL A;  3BP8 C;  1Y1V A;  4KN4 A;  5C3E C;  4A3I K;  4P5B A;  5C4X K;  2P5M A;  4KMH A;  2NVQ C;  4X6A K;  3S1M C;  1I50 C;  4C3J K;  5IYC C;  1TWA K;  1R9T C;  3S16 K;  3S15 C;  4GTA A;  3HOU C;  4XLN A;  1O28 A;  3G4C A;  3S2D C;  4A3D C;  3GTM A;  4Q4Z A;  4BY1 K;  4WJ3 M;  1TWG K;  3LPX A;  2R93 C;  2WB1 D;  3HOV K;  4C3H C;  1WOR A;  1TWC A;  3H3V L;  4MEY A;  2A68 A;  1ZXO A;  4A3J C;  4Y7N C;  1O2F B;  1I6H K;  3S1Q K;  3LAJ A;  2WAQ L;  2XCQ A;  3GTQ C;  2NVY A;  3S0X A;  3LAP A;  2FQO A;  1SMY A;  3HKZ L;  5M5Y K;  1WCM C;  3S17 C;  2RH6 A;  2JA7 K;  1EI6 A;  5L46 A;  1Y1W K;  4OIO A; 
#chains in the Genus database with same CATH homology
 1TWH A;  3GTJ A;  1XXC A;  3L4K A;  1BJT A;  3L4J A;  2JA7 A;  3FKI A;  5CHP A;  4G0V A;  5JVO A;  1WQH A;  1O2B A;  1O24 A;  4DDQ A;  2E2H A;  3FHZ A;  3FOF A;  1ZBS A;  1DD5 A;  4KMD A;  4KDD A;  2JA6 A;  2KWA A;  2R92 A;  2CFA A;  3NUH A;  3AQO A;  4KAW X;  1TWF A;  3OEP A;  3GTL A;  4KAT A;  1I50 A;  3V4G A;  2ZFZ A;  3N3Y A;  4GTF A;  4BLA A;  5CJ9 A;  1B4A A;  5IOT A;  2VUM A;  3GTK A;  1AB4 A;  1EH1 A;  1WQF A;  5JFE A;  4GTL A;  4GT9 A;  4P5A A;  4GTB A;  3GTP A;  1B4B A;  3MML B;  1SFO A;  4M1X A;  4KB4 A;  4C3I C;  3AH5 A;  2R93 A;  1IS1 A;  4FM9 A;  2XCO A;  2PHC B;  2JA5 A;  3Q3Q A;  1WIH A;  5IOR A;  1KQ4 A;  4G0U A;  3GTG A;  1O29 A;  3N0C A;  1WQG A;  1O25 A;  3GTQ A;  2R7Z A;  3AQP A;  4KM8 A;  1I3Q A;  4KAS A;  4GTD A;  4LQY A;  3BUE A;  1R9T A;  2YU9 A;  1ISE A;  3ERE D;  4KAR A;  3VA7 A;  1WCM A;  2GSN A;  4FZB A;  4LR2 A;  5EGH A;  3QX3 A;  4BLB A;  3GTO A;  1TWG A;  1O2A A;  1Y1V A;  4KC6 A;  1XXA A;  4P5B A;  2P5M A;  3CAG A;  4KMH A;  1XXB A;  4BKW A;  4ILD A;  3G4A A;  4KB2 A;  2B63 A;  4GTC A;  2RGR A;  1K83 A;  1O26 A;  4GTA A;  1O28 A;  3G4C A;  1TWA A;  2CFA B;  3CQZ A;  3GTM A;  4GTE A;  2GSO A;  1Y1W A;  5TJ3 A;  3LPX A;  3ORE A;  1GE9 A;  3N0B A;  3H0G A;  1TWC A;  4J3N A;  4C3H C;  4G0W A;  1ZVU A;  1O27 A;  3FOE A;  1ZXO A;  5IOS A;  1BGW A;  2E2I A;  3LAJ A;  4C3J C;  4C2M C;  4GFQ A;  2XCQ A;  3OPF A;  4KMA A;  2NVY A;  2XCR B;  4KM9 A;  2GSU A;  2Y3P A;  3S0X A;  1F9N A;  3LAP A;  5EGE A;  1EK8 A;  2NVX A;  2JH3 A;  2RH6 A;  5IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...