4A93K

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a93K00
5C3EC 4KMUA 5IYBC 3DXJA 3S16C 5FJ8K 4A3CK 3GTOK 3GTMC 1TWCC 4MEYA 4BBRC 4YFXA 5M5WK 2PPBA 2NVTC 2R7ZC 3HOUC 3PO2K 3HOWC 4OIOA 3HOVK 4Y7NK 3S2HK 4XSZA 3HOVC 3S1RC 2PA8D 4XLNA 4AYBL 2R7ZK 5C4XC 3S1RK 1TWCK 4Q5SA 4G7ZA 3HOWK 1HQMA 3H3VD 1WCMC 1TWGK 4BBRK 3S15C 3GTMK 3EQLA 4YFKA 4NOIA 1I3QC 4G7HA 3M3YK 2PMZL 4X6AC 5C44K 3S16K 1K83C 2E2IK 2NVXK 2NVQK 4Y52K 5C3EK 3S1NC 1I6HC 3M4OC 1K83K 2E2IC 2JA8C 4BXXC 2Y0SL 1R9TC 1I3QK 4JK1A 4C2MK 3S1NK 2WAQD 2YU9K 5IP7K 1TWGC 3HKZD 4BY1C 3GTLC 3GTQC 2E2JC 3RZOC 4A3GC 2JA7C 5C4JK 5D4DA 4LJZA 4Q4ZA 3GTPC 3S1QC 3GTJC 2BE5A 3S17K 1TWHC 2WB1D 4KN7A 3PO2C 4A3CC 4LK0A 4A3GK 3GTOC 5M3FK 2A6EA 1SFOK 4LLGA 2JA6K 3S2DK 4A3IK 4A93C 4C3HK 4C3JK 1Y1WC 3I4MC 5IYCC 1I50C 2JA5C 4A3JK 1Y1VK 4AYBD 5M3MK 3I4MK 1TWAK 1YNJA 3K7AK 3WODA 5IYDK 5M5YK 3HOZK 4BY7C 5TMFA 2NVYC 3S14C 2O5JA 3FKIC 4LK1A 4ZH4A 4A3FK 4QJVA 4A3EC 4BBSK 3I4NK 4A3BK 3CQZC 4KN4A 4A3MK 4A3LC 2Y0SD 4BY7K 5FLMC 4A3DC 3PO3C 3HKZL 1TWFC 4A3KC 3GTGC 2R92C 4QIWD 5IYCK 2B63K 3HOXC 4A3IC 4A93K 4XLPA 2VUMK 3S15K 2B63C 2CW0A 5FLMK 3H0GC 2A69A 1SFOC 3RZDK 2R92K 3GTGK 1IW7A 2WB1L 1TWFK 4A3KK 4A3MC 4A3LK 1YNNA 3GTKC 4A3DK 4A3BC 1SMYA 5IP9C 2R93K 5M5XK 3HOYC 3S1MK 5C44C 3GTJK 4BBSC 4A3EK 3CQZK 2E2HC 1ZYRA 4GZYA 4A3FC 2E2HK 4G7OA 5C4JC 1I6VA 2E2JK 3RZOK 3HOYK 3S1MC 5IYDC 5IP9K 3GTKK 2R93C 3FKIK 4XSXA 2NVYK 3S14K 1I50K 2JA8K 4MQ9A 3RZDC 3HOZC 3M4OK 3H0GK 1TWAC 3K7AC 4OIRA 4BXXK 1I6HK 2PA8L 2VUMC 3S2DC 3HOXK 4YFNA 2JA6C 3M3YC 3H3VL 4QJVB 1WCMK 3PO3K 1TWHK 2PMZD 3GTPK 3S1QK 5C4XK 1BDFA 3S17C 4QIWL 3I4NC 2O5IA 4Y7NC 2JA7K 1XPPA 2NVTK 4BY1K 4OINA 3GTLK 2WAQL 2YU9C 3GTQK 4OIPA 3HOUK 3S2HC 2A6HA 1R9TK 4YG2A 2A68A 5IYBK 5IP7C 1Y1VC 4A3JC 4MEXA 2NVXC 2JA5K 2NVQC 4Y52C 1Y1WK 4X6AK 4C3IK 5TMCA 4OIQA
chains in the Genus database with same CATH superfamily
3QX3A 3DXJA 5FJ8K 4MEYA 1VGXA 3S15K 2PHCB 3GEHA 2NVTC 4A3CK 3HOVK 1JOEA 4XSZA 4WJ4A 3HOVC 3S1RK 4G7ZA 1WQHA 1HQMA 3H3VD 1WCMC 1TWGK 4BBRK 4WILA 3M3YK 1VLOA 3S16K 1K83C 1ZVUA 2EBBA 2E2IK 2NVQK 3V4GA 2RH6A 3M4OC 5IOQA 2JA8C 1O24A 1R9TC 2V6TA 4C2MK 3GTLC 4P5BA 3Q3QA 4LJZA 4M1XA 4KN7A 1R9TA 2NVYA 4O2DA 4GTDA 1JQWA 1BS2A 4A3JK 5M3MK 3K7AK 1YNJA 1F9NA 4A3FK 3OEPA 1J6WA 2ZUFA 4A3EC 1UV7A 2XCQA 3SZZA 3BUEA 3SZYA 2Y0SD 4BY7K 4A3DC 3H0GA 1XXCA 3HOXC 1IS1A 2VUMK 3H0GC 1SFOC 1TWFK 2R93K 4XCHA 1AB4A 1ISEA 3GTJK 4C45A 4BBSC 2E2HC 4GZYA 2E2HK 2R92A 2E2JK 1O27A 1HI9A 5IYDC 3GTMA 3FKIK 3HOZC 5JVOA 3H0GK 3K7AC 5TJ3A 3HOXK 4GT9A 1ZBSA 3H3VL 2PMZD 3GTPK 3TFIA 1WSRA 5EGHA 4Y7NC 2JA7K 2JA5A 3S2HC 2YU9C 1XZQA 3JSTA 5IYBK 4C3IC 4C3IK 3GSIA 4BLBA 5HL8A 4OIQA 5C3EC 2D6FC 4KMUA 3GTMC 4BBRC 4YFXA 2R7ZC 3HOUC 2O5JA 3NUHA 4GTAA 4OIOA 2E2IA 4GTLA 4Y7NK 3BP8C 2GSOA 2PA8D 4KM9A 4AYBL 1XXBA 4Q5SA 3HOWK 4YFKA 1I3QC 1O29A 2PMZL 4Y52K 3S1NC 1I6HC 1J98A 1YX2A 3HXAA 1WQFA 4FM9A 4LQYA 3N0CA 5IP7K 2YU9K 3GTQC 1VRQC 2E2JC 2Y3PA 3LAJA 2JA7C 1XZQB 3S1QC 1F7UA 3T00A 2BE5A 3GTJC 1TWHC 3PO2C 4LK0A 4A3GK 5M3FK 2A6EA 1SFOK 2JA6A 2ZUEA 3AQOA 4PAAA 4RMFA 4C3HK 4GTBA 4C3JK 5IYCC 2JA5C 1Y1VK 1WOSA 5M5YK 4BY7C 3S14C 2NVYC 1DD5A 2FQOA 4BBSK 1V5VA 3L4JA 5EGEA 1Y1WA 1BJTA 5CHPA 4A3LC 1F7VA 3PO3C 3HKZL 1XZPA 1IQ0A 3GDZA 2B63K 4A3IC 4A93K 4XLPA 2B63C 1EFWA 2R7ZA 4KMAA 2R92K 1IW7A 4KB2A 4A3KK 3A8KA 1YNNA 1O26A 5IP9C 5M5XK 3CQZA 2JH3A 3HOYC 4A3EK 1ZYRA 3IPJA 2W7VA 4WJ3M 3G4CA 1L0WA 5C4JC 3RZOK 4BLAA 3HOYK 3L4KA 3GTKK 3GTJA 2NVYK 3GTKA 2JA8K 3RZDC 1PJ7A 2PA8L 3TFHA 1WQGA 4C3HC 1DCHA 4ILDA 4QJVB 1O2BA 3GTOA 3GEIA 1TWCA 1F93A 2NVTK 3GTLK 2WAQL 4OIPA 4C2MC 1R9TK 1TWGA 4YG2A 2A68A 3TFJA 1Y1VC 2JA5K 5TMCA 1ZXOA 2E2HA 3AD9C 3GTOK 1TWCC 1SFOA 3PO2K 2R93A 3HOWC 1O2FB 4XLNA 5C4XC 2GAHC 1TWCK 3N3YA 1K83A 3GTMK 3GTPA 4G7HA 1USMA 4G0WA 5C44K 3CAGA 5C3EK 4GFQA 2Y0SL 1I3QK 4JK1A 2WAQD 4BY1C 1TWFA 3RZOC 5C4JK 1IE0A 1WORA 3VA7A 4KASA 2B63A 2WB1D 3N0BA 2FQTA 2GSNA 5JFEA 4AH6A 2KWAA 4A3IK 4A93C 2V6UA 1Y1WC 3I4MC 4AYBD 1TWAK 3HOZK 1EI6A 3FKIC 3AD7C 1O28A 2NVXA 3MMLB 1BGWA 3I4NK 4A3BK 3GEEA 3GIRA 4KN4A 4A3MK 1EQRA 3T02A 5FLMC 1TWFC 3GTGC 3T01A 5IYCK 1USOA 4C3JC 1PJ6A 1ZQ1C 1IBAA 4GTCA 3GTGA 2A69A 3FOFA 1YCLA 2WB1L 1TWHA 3GTGK 4A3LK 4A3GC 4DDQA 4A3DK 3S1MK 3AH5A 4GTFA 3G4AA 3S1MC 1WIHA 2R93C 1I50K 4MQ9A 4BXXK 1X31C 1I6HK 1TWAC 4OIRA 2VUMC 3S2DC 5IORA 1INNA 2JA6C 3GTLA 2V6SA 3LAPA 3BP3A 4BKWA 1Y1VA 3A8JA 1TWHK 4KB4A 1O25A 3S1QK 4QIWL 3I4NC 1DCOA 2O5IA 3HOUK 4OINA 1G51A 3GTQK 2A6HA 4P9SA 3GTQA 3FKIA 4A3JC 2NVXC 4Y52C 1Y1WK 3I4MK 4X6AK 5IYBC 3S16C 5L46A 1VH2A 1WOOA 1WOPA 3S0XA 5M5WK 1C0AA 2PPBA 3S2HK 4G0VA 2CFAA 3S1RC 4KATA 2R7ZK 1I3QA 1B4AA 2XCOA 1RU0A 4PABA 2RGRA 3S15C 3EQLA 4NOIA 4X6AC 2NVXK 4P5AA 4BXXC 1K83K 2ZFZA 3ERED 2E2IC 1GE9A 1TWGC 3HKZD 1JVIA 3AD8C 2GAGC 5D4DA 4FZBA 4Q4ZA 3GTPC 1EH1A 3S17K 4A3CC 3GTOC 1KQ4A 2JA6K 4LLGA 4KARA 3S2DK 3AQPA 5IOSA 3A8IA 1I50C 4GTEA 2XCRB 5IYDK 3WODA 1VJEA 1WCMA 5TMFA 2P5MA 1B4BA 4KDDA 4LK1A 4ZH4A 4QJVA 1IL2A 5E68A 3CQZC 1WSVA 4KMDA 4G0UA 4A3KC 3TTGA 4QIWD 2R92C 3LPXA 2CW0A 5FLMK 3RZDK 2YU9A 5IOTA 4A3MC 1EK8A 3GTKC 1I50A 4A3BC 1SMYA 3FOEA 4KAWX 3ADAC 3CQZK 4KM8A 3OREA 4A3FC 4G7OA 1I6VA 4LR2A 1PJ5A 5IP9K 1XXAA 1O2AA 4XSXA 3S14K 3M4OK 1J6XA 2GSUA 1DCPA 4LOWA 2P8TA 4YFNA 3M3YC 2CFAB 4J3NA 2JA7A 1WCMK 3PO3K 1J6VA 5C4XK 1BDFA 3S17C 2VUMA 1XPPA 1TWAA 4BY1K 4KMHA 1XZPB 5CJ9A 3OPFA 3FHZA 5IP7C 4MEXA 2NVQC 4KC6A 5C44C 3S1NK
chains in the Genus database with same CATH topology
5C3EC 4KMUA 5IYBC 3DXJA 3S16C 5FJ8K 4A3CK 3GTOK 3GTMC 1TWCC 4MEYA 4BBRC 4YFXA 5M5WK 2PPBA 2NVTC 2R7ZC 3HOUC 3PO2K 3HOWC 4OIOA 3HOVK 4Y7NK 3S2HK 4XSZA 3HOVC 3S1RC 2PA8D 4XLNA 4AYBL 2R7ZK 5C4XC 3S1RK 1TWCK 4Q5SA 4G7ZA 3HOWK 1HQMA 3H3VD 1WCMC 1TWGK 4BBRK 3S15C 3GTMK 3EQLA 4YFKA 4NOIA 1I3QC 4G7HA 3M3YK 2PMZL 4X6AC 5C44K 3S16K 1K83C 2E2IK 2NVXK 2NVQK 4Y52K 5C3EK 3S1NC 1I6HC 3M4OC 1K83K 2E2IC 2JA8C 4BXXC 2Y0SL 1R9TC 1I3QK 4JK1A 4C2MK 3S1NK 2WAQD 2YU9K 5IP7K 1TWGC 3HKZD 4BY1C 3GTLC 3GTQC 2E2JC 3RZOC 4A3GC 2JA7C 5C4JK 5D4DA 4LJZA 4Q4ZA 3GTPC 3S1QC 3GTJC 2BE5A 3S17K 1TWHC 2WB1D 4KN7A 3PO2C 4A3CC 4LK0A 4A3GK 3GTOC 5M3FK 2A6EA 1SFOK 4LLGA 2JA6K 3S2DK 4A3IK 4A93C 4C3HK 4C3JK 1Y1WC 3I4MC 5IYCC 1I50C 2JA5C 4A3JK 1Y1VK 4AYBD 5M3MK 3I4MK 1TWAK 1YNJA 3K7AK 3WODA 5IYDK 5M5YK 3HOZK 4BY7C 5TMFA 2NVYC 3S14C 2O5JA 3FKIC 4LK1A 4ZH4A 4A3FK 4QJVA 4A3EC 4BBSK 3I4NK 4A3BK 3CQZC 4KN4A 4A3MK 4A3LC 2Y0SD 4BY7K 5FLMC 4A3DC 3PO3C 3HKZL 1TWFC 4A3KC 3GTGC 2R92C 4QIWD 5IYCK 2B63K 3HOXC 4A3IC 4A93K 4XLPA 2VUMK 3S15K 2B63C 2CW0A 5FLMK 3H0GC 2A69A 1SFOC 3RZDK 2R92K 3GTGK 1IW7A 2WB1L 1TWFK 4A3KK 4A3MC 4A3LK 1YNNA 3GTKC 4A3DK 4A3BC 1SMYA 5IP9C 2R93K 5M5XK 3HOYC 3S1MK 5C44C 3GTJK 4BBSC 4A3EK 3CQZK 2E2HC 1ZYRA 4GZYA 4A3FC 2E2HK 4G7OA 5C4JC 1I6VA 2E2JK 3RZOK 3HOYK 3S1MC 5IYDC 5IP9K 3GTKK 2R93C 3FKIK 4XSXA 2NVYK 3S14K 1I50K 2JA8K 4MQ9A 3RZDC 3HOZC 3M4OK 3H0GK 1TWAC 3K7AC 4OIRA 4BXXK 1I6HK 2PA8L 2VUMC 3S2DC 3HOXK 4YFNA 2JA6C 3M3YC 3H3VL 4QJVB 1WCMK 3PO3K 1TWHK 2PMZD 3GTPK 3S1QK 5C4XK 1BDFA 3S17C 4QIWL 3I4NC 2O5IA 4Y7NC 2JA7K 1XPPA 2NVTK 4BY1K 4OINA 3GTLK 2WAQL 2YU9C 3GTQK 4OIPA 3HOUK 3S2HC 2A6HA 1R9TK 4YG2A 2A68A 5IYBK 5IP7C 1Y1VC 4A3JC 4MEXA 2NVXC 2JA5K 2NVQC 4Y52C 1Y1WK 4X6AK 4C3IK 5TMCA 4OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E C;  4KMU A;  5IYB C;  3DXJ A;  3S16 C;  5FJ8 K;  4A3C K;  3GTO K;  3GTM C;  1TWC C;  4MEY A;  4BBR C;  4YFX A;  5M5W K;  2PPB A;  2NVT C;  2R7Z C;  3HOU C;  3PO2 K;  3HOW C;  4OIO A;  3HOV K;  4Y7N K;  3S2H K;  4XSZ A;  3HOV C;  3S1R C;  2PA8 D;  4XLN A;  4AYB L;  2R7Z K;  5C4X C;  3S1R K;  1TWC K;  4Q5S A;  4G7Z A;  3HOW K;  1HQM A;  3H3V D;  1WCM C;  1TWG K;  4BBR K;  3S15 C;  3GTM K;  3EQL A;  4YFK A;  4NOI A;  1I3Q C;  4G7H A;  3M3Y K;  2PMZ L;  4X6A C;  5C44 K;  3S16 K;  1K83 C;  2E2I K;  2NVX K;  2NVQ K;  4Y52 K;  5C3E K;  3S1N C;  1I6H C;  3M4O C;  1K83 K;  2E2I C;  2JA8 C;  4BXX C;  2Y0S L;  1R9T C;  1I3Q K;  4JK1 A;  4C2M K;  3S1N K;  2WAQ D;  2YU9 K;  5IP7 K;  1TWG C;  3HKZ D;  4BY1 C;  3GTL C;  3GTQ C;  2E2J C;  3RZO C;  4A3G C;  2JA7 C;  5C4J K;  5D4D A;  4LJZ A;  4Q4Z A;  3GTP C;  3S1Q C;  3GTJ C;  2BE5 A;  3S17 K;  1TWH C;  2WB1 D;  4KN7 A;  3PO2 C;  4A3C C;  4LK0 A;  4A3G K;  3GTO C;  5M3F K;  2A6E A;  1SFO K;  4LLG A;  2JA6 K;  3S2D K;  4A3I K;  4A93 C;  4C3H K;  4C3J K;  1Y1W C;  3I4M C;  5IYC C;  1I50 C;  2JA5 C;  4A3J K;  1Y1V K;  4AYB D;  5M3M K;  3I4M K;  1TWA K;  1YNJ A;  3K7A K;  3WOD A;  5IYD K;  5M5Y K;  3HOZ K;  4BY7 C;  5TMF A;  2NVY C;  3S14 C;  2O5J A;  3FKI C;  4LK1 A;  4ZH4 A;  4A3F K;  4QJV A;  4A3E C;  4BBS K;  3I4N K;  4A3B K;  3CQZ C;  4KN4 A;  4A3M K;  4A3L C;  2Y0S D;  4BY7 K;  5FLM C;  4A3D C;  3PO3 C;  3HKZ L;  1TWF C;  4A3K C;  3GTG C;  2R92 C;  4QIW D;  5IYC K;  2B63 K;  3HOX C;  4A3I C;  4A93 K;  4XLP A;  2VUM K;  3S15 K;  2B63 C;  2CW0 A;  5FLM K;  3H0G C;  2A69 A;  1SFO C;  3RZD K;  2R92 K;  3GTG K;  1IW7 A;  2WB1 L;  1TWF K;  4A3K K;  4A3M C;  4A3L K;  1YNN A;  3GTK C;  4A3D K;  4A3B C;  1SMY A;  5IP9 C;  2R93 K;  5M5X K;  3HOY C;  3S1M K;  5C44 C;  3GTJ K;  4BBS C;  4A3E K;  3CQZ K;  2E2H C;  1ZYR A;  4GZY A;  4A3F C;  2E2H K;  4G7O A;  5C4J C;  1I6V A;  2E2J K;  3RZO K;  3HOY K;  3S1M C;  5IYD C;  5IP9 K;  3GTK K;  2R93 C;  3FKI K;  4XSX A;  2NVY K;  3S14 K;  1I50 K;  2JA8 K;  4MQ9 A;  3RZD C;  3HOZ C;  3M4O K;  3H0G K;  1TWA C;  3K7A C;  4OIR A;  4BXX K;  1I6H K;  2PA8 L;  2VUM C;  3S2D C;  3HOX K;  4YFN A;  2JA6 C;  3M3Y C;  3H3V L;  4QJV B;  1WCM K;  3PO3 K;  1TWH K;  2PMZ D;  3GTP K;  3S1Q K;  5C4X K;  1BDF A;  3S17 C;  4QIW L;  3I4N C;  2O5I A;  4Y7N C;  2JA7 K;  1XPP A;  2NVT K;  4BY1 K;  4OIN A;  3GTL K;  2WAQ L;  2YU9 C;  3GTQ K;  4OIP A;  3HOU K;  3S2H C;  2A6H A;  1R9T K;  4YG2 A;  2A68 A;  5IYB K;  5IP7 C;  1Y1V C;  4A3J C;  4MEX A;  2NVX C;  2JA5 K;  2NVQ C;  4Y52 C;  1Y1W K;  4X6A K;  4C3I K;  5TMC A;  4OIQ A; 
#chains in the Genus database with same CATH topology
 3QX3 A;  3DXJ A;  5FJ8 K;  4MEY A;  1VGX A;  3S15 K;  2PHC B;  3GEH A;  2NVT C;  4A3C K;  3HOV K;  1JOE A;  4XSZ A;  4WJ4 A;  3HOV C;  3S1R K;  4G7Z A;  1WQH A;  1HQM A;  3H3V D;  1WCM C;  1TWG K;  4BBR K;  4WIL A;  3M3Y K;  1VLO A;  3S16 K;  1K83 C;  1ZVU A;  2EBB A;  2E2I K;  2NVQ K;  3V4G A;  2RH6 A;  3M4O C;  5IOQ A;  2JA8 C;  1O24 A;  1R9T C;  2V6T A;  4C2M K;  3GTL C;  4P5B A;  3Q3Q A;  4LJZ A;  4M1X A;  4KN7 A;  1R9T A;  2NVY A;  4O2D A;  4GTD A;  1JQW A;  1BS2 A;  4A3J K;  5M3M K;  3K7A K;  1YNJ A;  1F9N A;  4A3F K;  3OEP A;  1J6W A;  2ZUF A;  4A3E C;  1UV7 A;  2XCQ A;  3SZZ A;  3BUE A;  3SZY A;  2Y0S D;  4BY7 K;  4A3D C;  3H0G A;  1XXC A;  3HOX C;  1IS1 A;  2VUM K;  3H0G C;  1SFO C;  1TWF K;  2R93 K;  4XCH A;  1AB4 A;  1ISE A;  3GTJ K;  4C45 A;  4BBS C;  2E2H C;  4GZY A;  2E2H K;  2R92 A;  2E2J K;  1O27 A;  1HI9 A;  5IYD C;  3GTM A;  3FKI K;  3HOZ C;  5JVO A;  3H0G K;  3K7A C;  5TJ3 A;  3HOX K;  4GT9 A;  1ZBS A;  3H3V L;  2PMZ D;  3GTP K;  3TFI A;  1WSR A;  5EGH A;  4Y7N C;  2JA7 K;  2JA5 A;  3S2H C;  2YU9 C;  1XZQ A;  3JST A;  5IYB K;  4C3I C;  4C3I K;  3GSI A;  4BLB A;  5HL8 A;  4OIQ A;  5C3E C;  2D6F C;  4KMU A;  3GTM C;  4BBR C;  4YFX A;  2R7Z C;  3HOU C;  2O5J A;  3NUH A;  4GTA A;  4OIO A;  2E2I A;  4GTL A;  4Y7N K;  3BP8 C;  2GSO A;  2PA8 D;  4KM9 A;  4AYB L;  1XXB A;  4Q5S A;  3HOW K;  4YFK A;  1I3Q C;  1O29 A;  2PMZ L;  4Y52 K;  3S1N C;  1I6H C;  1J98 A;  1YX2 A;  3HXA A;  1WQF A;  4FM9 A;  4LQY A;  3N0C A;  5IP7 K;  2YU9 K;  3GTQ C;  1VRQ C;  2E2J C;  2Y3P A;  3LAJ A;  2JA7 C;  1XZQ B;  3S1Q C;  1F7U A;  3T00 A;  2BE5 A;  3GTJ C;  1TWH C;  3PO2 C;  4LK0 A;  4A3G K;  5M3F K;  2A6E A;  1SFO K;  2JA6 A;  2ZUE A;  3AQO A;  4PAA A;  4RMF A;  4C3H K;  4GTB A;  4C3J K;  5IYC C;  2JA5 C;  1Y1V K;  1WOS A;  5M5Y K;  4BY7 C;  3S14 C;  2NVY C;  1DD5 A;  2FQO A;  4BBS K;  1V5V A;  3L4J A;  5EGE A;  1Y1W A;  1BJT A;  5CHP A;  4A3L C;  1F7V A;  3PO3 C;  3HKZ L;  1XZP A;  1IQ0 A;  3GDZ A;  2B63 K;  4A3I C;  4A93 K;  4XLP A;  2B63 C;  1EFW A;  2R7Z A;  4KMA A;  2R92 K;  1IW7 A;  4KB2 A;  4A3K K;  3A8K A;  1YNN A;  1O26 A;  5IP9 C;  5M5X K;  3CQZ A;  2JH3 A;  3HOY C;  4A3E K;  1ZYR A;  3IPJ A;  2W7V A;  4WJ3 M;  3G4C A;  1L0W A;  5C4J C;  3RZO K;  4BLA A;  3HOY K;  3L4K A;  3GTK K;  3GTJ A;  2NVY K;  3GTK A;  2JA8 K;  3RZD C;  1PJ7 A;  2PA8 L;  3TFH A;  1WQG A;  4C3H C;  1DCH A;  4ILD A;  4QJV B;  1O2B A;  3GTO A;  3GEI A;  1TWC A;  1F93 A;  2NVT K;  3GTL K;  2WAQ L;  4OIP A;  4C2M C;  1R9T K;  1TWG A;  4YG2 A;  2A68 A;  3TFJ A;  1Y1V C;  2JA5 K;  5TMC A;  1ZXO A;  2E2H A;  3AD9 C;  3GTO K;  1TWC C;  1SFO A;  3PO2 K;  2R93 A;  3HOW C;  1O2F B;  4XLN A;  5C4X C;  2GAH C;  1TWC K;  3N3Y A;  1K83 A;  3GTM K;  3GTP A;  4G7H A;  1USM A;  4G0W A;  5C44 K;  3CAG A;  5C3E K;  4GFQ A;  2Y0S L;  1I3Q K;  4JK1 A;  2WAQ D;  4BY1 C;  1TWF A;  3RZO C;  5C4J K;  1IE0 A;  1WOR A;  3VA7 A;  4KAS A;  2B63 A;  2WB1 D;  3N0B A;  2FQT A;  2GSN A;  5JFE A;  4AH6 A;  2KWA A;  4A3I K;  4A93 C;  2V6U A;  1Y1W C;  3I4M C;  4AYB D;  1TWA K;  3HOZ K;  1EI6 A;  3FKI C;  3AD7 C;  1O28 A;  2NVX A;  3MML B;  1BGW A;  3I4N K;  4A3B K;  3GEE A;  3GIR A;  4KN4 A;  4A3M K;  1EQR A;  3T02 A;  5FLM C;  1TWF C;  3GTG C;  3T01 A;  5IYC K;  1USO A;  4C3J C;  1PJ6 A;  1ZQ1 C;  1IBA A;  4GTC A;  3GTG A;  2A69 A;  3FOF A;  1YCL A;  2WB1 L;  1TWH A;  3GTG K;  4A3L K;  4A3G C;  4DDQ A;  4A3D K;  3S1M K;  3AH5 A;  4GTF A;  3G4A A;  3S1M C;  1WIH A;  2R93 C;  1I50 K;  4MQ9 A;  4BXX K;  1X31 C;  1I6H K;  1TWA C;  4OIR A;  2VUM C;  3S2D C;  5IOR A;  1INN A;  2JA6 C;  3GTL A;  2V6S A;  3LAP A;  3BP3 A;  4BKW A;  1Y1V A;  3A8J A;  1TWH K;  4KB4 A;  1O25 A;  3S1Q K;  4QIW L;  3I4N C;  1DCO A;  2O5I A;  3HOU K;  4OIN A;  1G51 A;  3GTQ K;  2A6H A;  4P9S A;  3GTQ A;  3FKI A;  4A3J C;  2NVX C;  4Y52 C;  1Y1W K;  3I4M K;  4X6A K;  5IYB C;  3S16 C;  5L46 A;  1VH2 A;  1WOO A;  1WOP A;  3S0X A;  5M5W K;  1C0A A;  2PPB A;  3S2H K;  4G0V A;  2CFA A;  3S1R C;  4KAT A;  2R7Z K;  1I3Q A;  1B4A A;  2XCO A;  1RU0 A;  4PAB A;  2RGR A;  3S15 C;  3EQL A;  4NOI A;  4X6A C;  2NVX K;  4P5A A;  4BXX C;  1K83 K;  2ZFZ A;  3ERE D;  2E2I C;  1GE9 A;  1TWG C;  3HKZ D;  1JVI A;  3AD8 C;  2GAG C;  5D4D A;  4FZB A;  4Q4Z A;  3GTP C;  1EH1 A;  3S17 K;  4A3C C;  3GTO C;  1KQ4 A;  2JA6 K;  4LLG A;  4KAR A;  3S2D K;  3AQP A;  5IOS A;  3A8I A;  1I50 C;  4GTE A;  2XCR B;  5IYD K;  3WOD A;  1VJE A;  1WCM A;  5TMF A;  2P5M A;  1B4B A;  4KDD A;  4LK1 A;  4ZH4 A;  4QJV A;  1IL2 A;  5E68 A;  3CQZ C;  1WSV A;  4KMD A;  4G0U A;  4A3K C;  3TTG A;  4QIW D;  2R92 C;  3LPX A;  2CW0 A;  5FLM K;  3RZD K;  2YU9 A;  5IOT A;  4A3M C;  1EK8 A;  3GTK C;  1I50 A;  4A3B C;  1SMY A;  3FOE A;  4KAW X;  3ADA C;  3CQZ K;  4KM8 A;  3ORE A;  4A3F C;  4G7O A;  1I6V A;  4LR2 A;  1PJ5 A;  5IP9 K;  1XXA A;  1O2A A;  4XSX A;  3S14 K;  3M4O K;  1J6X A;  2GSU A;  1DCP A;  4LOW A;  2P8T A;  4YFN A;  3M3Y C;  2CFA B;  4J3N A;  2JA7 A;  1WCM K;  3PO3 K;  1J6V A;  5C4X K;  1BDF A;  3S17 C;  2VUM A;  1XPP A;  1TWA A;  4BY1 K;  4KMH A;  1XZP B;  5CJ9 A;  3OPF A;  3FHZ A;  5IP7 C;  4MEX A;  2NVQ C;  4KC6 A;  5C44 C;  3S1N K; 
#chains in the Genus database with same CATH homology
 5C3E C;  4KMU A;  5IYB C;  3DXJ A;  3S16 C;  5FJ8 K;  4A3C K;  3GTO K;  3GTM C;  1TWC C;  4MEY A;  4BBR C;  4YFX A;  5M5W K;  2PPB A;  2NVT C;  2R7Z C;  3HOU C;  3PO2 K;  3HOW C;  4OIO A;  3HOV K;  4Y7N K;  3S2H K;  4XSZ A;  3HOV C;  3S1R C;  2PA8 D;  4XLN A;  4AYB L;  2R7Z K;  5C4X C;  3S1R K;  1TWC K;  4Q5S A;  4G7Z A;  3HOW K;  1HQM A;  3H3V D;  1WCM C;  1TWG K;  4BBR K;  3S15 C;  3GTM K;  3EQL A;  4YFK A;  4NOI A;  1I3Q C;  4G7H A;  3M3Y K;  2PMZ L;  4X6A C;  5C44 K;  3S16 K;  1K83 C;  2E2I K;  2NVX K;  2NVQ K;  4Y52 K;  5C3E K;  3S1N C;  1I6H C;  3M4O C;  1K83 K;  2E2I C;  2JA8 C;  4BXX C;  2Y0S L;  1R9T C;  1I3Q K;  4JK1 A;  4C2M K;  3S1N K;  2WAQ D;  2YU9 K;  5IP7 K;  1TWG C;  3HKZ D;  4BY1 C;  3GTL C;  3GTQ C;  2E2J C;  3RZO C;  4A3G C;  2JA7 C;  5C4J K;  5D4D A;  4LJZ A;  4Q4Z A;  3GTP C;  3S1Q C;  3GTJ C;  2BE5 A;  3S17 K;  1TWH C;  2WB1 D;  4KN7 A;  3PO2 C;  4A3C C;  4LK0 A;  4A3G K;  3GTO C;  5M3F K;  2A6E A;  1SFO K;  4LLG A;  2JA6 K;  3S2D K;  4A3I K;  4A93 C;  4C3H K;  4C3J K;  1Y1W C;  3I4M C;  5IYC C;  1I50 C;  2JA5 C;  4A3J K;  1Y1V K;  4AYB D;  5M3M K;  3I4M K;  1TWA K;  1YNJ A;  3K7A K;  3WOD A;  5IYD K;  5M5Y K;  3HOZ K;  4BY7 C;  5TMF A;  2NVY C;  3S14 C;  2O5J A;  3FKI C;  4LK1 A;  4ZH4 A;  4A3F K;  4QJV A;  4A3E C;  4BBS K;  3I4N K;  4A3B K;  3CQZ C;  4KN4 A;  4A3M K;  4A3L C;  2Y0S D;  4BY7 K;  5FLM C;  4A3D C;  3PO3 C;  3HKZ L;  1TWF C;  4A3K C;  3GTG C;  2R92 C;  4QIW D;  5IYC K;  2B63 K;  3HOX C;  4A3I C;  4A93 K;  4XLP A;  2VUM K;  3S15 K;  2B63 C;  2CW0 A;  5FLM K;  3H0G C;  2A69 A;  1SFO C;  3RZD K;  2R92 K;  3GTG K;  1IW7 A;  2WB1 L;  1TWF K;  4A3K K;  4A3M C;  4A3L K;  1YNN A;  3GTK C;  4A3D K;  4A3B C;  1SMY A;  5IP9 C;  2R93 K;  5M5X K;  3HOY C;  3S1M K;  5C44 C;  3GTJ K;  4BBS C;  4A3E K;  3CQZ K;  2E2H C;  1ZYR A;  4GZY A;  4A3F C;  2E2H K;  4G7O A;  5C4J C;  1I6V A;  2E2J K;  3RZO K;  3HOY K;  3S1M C;  5IYD C;  5IP9 K;  3GTK K;  2R93 C;  3FKI K;  4XSX A;  2NVY K;  3S14 K;  1I50 K;  2JA8 K;  4MQ9 A;  3RZD C;  3HOZ C;  3M4O K;  3H0G K;  1TWA C;  3K7A C;  4OIR A;  4BXX K;  1I6H K;  2PA8 L;  2VUM C;  3S2D C;  3HOX K;  4YFN A;  2JA6 C;  3M3Y C;  3H3V L;  4QJV B;  1WCM K;  3PO3 K;  1TWH K;  2PMZ D;  3GTP K;  3S1Q K;  5C4X K;  1BDF A;  3S17 C;  4QIW L;  3I4N C;  2O5I A;  4Y7N C;  2JA7 K;  1XPP A;  2NVT K;  4BY1 K;  4OIN A;  3GTL K;  2WAQ L;  2YU9 C;  3GTQ K;  4OIP A;  3HOU K;  3S2H C;  2A6H A;  1R9T K;  4YG2 A;  2A68 A;  5IYB K;  5IP7 C;  1Y1V C;  4A3J C;  4MEX A;  2NVX C;  2JA5 K;  2NVQ C;  4Y52 C;  1Y1W K;  4X6A K;  4C3I K;  5TMC A;  4OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...