4A93K

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a93K00
2PA8L 4QJVB 2NVQC 4C3JK 3H3VD 3CQZC 1K83K 5C4XK 5M3MK 3S1RK 4KN7A 4A3LC 3RZOK 3HOXK 2A68A 3GTLK 3HOZK 4JK1A 1WCMC 4MQ9A 3S2HC 4QIWD 4A3BK 3RZDC 5TMFA 3DXJA 3S2DK 3GTMK 1Y1WK 4YFKA 2NVTC 3GTGK 2E2IK 4BBSC 3M4OK 4X6AC 2JA6C 4XSZA 2NVYK 3S1QK 4BY7K 3HOYK 5IP9K 4AYBL 1K83C 5C4XC 5C3EC 3S1RC 4A93K 3S1MK 3RZOC 4YFXA 3HOXC 3CQZK 3GTLC 1TWGK 2PMZD 3HOZC 4A3BC 4A3LK 3GTMC 5M5YK 1SMYA 5C44C 2E2IC 3RZDK 5IYBK 2R92K 3M4OC 2NVYC 2E2HC 4BY7C 4Q4ZA 3HKZL 2A69A 5IP9C 4X6AK 4XSXA 1I6VA 2WB1D 3S1MC 3GTJK 4A93C 4A3DK 3HOWK 1TWGC 3FKIK 5C3EK 4OIOA 2WAQD 4A3IK 2A6EA 4OINA 3H3VL 2E2JK 1TWCC 3M3YC 4KMUA 4C2MK 2PPBA 4A3CC 5IYBC 2R92C 4BY1C 2BE5A 4QIWL 5C44K 4G7OA 2R93C 4A3GK 4OIRA 2E2HK 2JA8K 4A3DC 3GTJC 3HOWC 1SFOK 3FKIC 4YG2A 4A3IC 1HQMA 2E2JC 2B63K 4MEYA 4A3FC 1TWCK 2PMZL 2JA5K 3M3YK 3GTOK 3S17C 4LK1A 3PO2K 4YFNA 4A3CK 2JA7K 4A3GC 4BY1K 4LK0A 1XPPA 2JA8C 3S1NK 2R93K 1SFOC 1TWFK 3K7AK 4OIQA 3H0GK 1TWHK 5M5WK 4A3JK 2B63C 4XLNA 1Y1VK 2WB1L 2NVXK 3GTPC 2JA5C 2WAQL 3GTOC 3I4MK 4C3HK 2YU9K 3HOVK 4LLGA 1YNNA 4A3FK 3PO2C 3S16C 2JA7C 3S17K 1BDFA 2VUMK 1I6HK 5IYDK 3S1NC 4NOIA 2Y0SD 1TWFC 3I4NK 5FLMK 4Y7NC 3K7AC 2O5IA 1I50K 4Y52K 3H0GC 1TWHC 5C4JK 1TWAK 4A3JC 1R9TC 1Y1VC 3EQLA 2O5JA 2CW0A 2NVXC 5M5XK 1YNJA 4Q5SA 3I4MC 5IYDC 2YU9C 3HOVC 1I3QK 5D4DA 5M3FK 2PA8D 4A3KK 3GTPK 2VUMC 1I6HC 2A6HA 3S16K 4KN4A 4A3MK 3I4NC 5IYCK 5FLMC 2R7ZC 1I50C 3GTKC 3WODA 4Y52C 5C4JC 1TWAC 4Y7NK 4BBRK 3S14K 3PO3C 1R9TK 1I3QC 4A3KC 4AYBD 4BXXK 3S15K 4LJZA 4A3EK 3HOUK 5TMCA 4OIPA 4A3MC 5IP7K 5IYCC 1ZYRA 4MEXA 3GTQK 1IW7A 2NVQK 4ZH4A 4C3IK 4GZYA 4QJVA 2R7ZK 4BBRC 3S14C 3S2DC 2Y0SL 3GTKK 4XLPA 1Y1WC 3GTGC 1WCMK 3S2HK 3PO3K 3HKZD 4G7HA 3S1QC 2NVTK 4BXXC 3S15C 3HOYC 4A3EC 3HOUC 4BBSK 3GTQC 5IP7C 2JA6K 5FJ8K 4G7ZA
chains in the Genus database with same CATH superfamily
5C4XK 4A3LC 3RZOK 4PAAA 1WCMC 3S2DK 3V4GA 4GT9A 4X6AC 3S1QK 1I3QA 4G0VA 1K83C 1C0AA 4WJ4A 3GIRA 4YFXA 2PMZD 3HOZC 4GTBA 3GTLA 1EQRA 3CAGA 5IYBK 2NVYC 2E2HC 1J98A 4A3DK 4J3NA 3S1MC 3A8JA 3GTQA 3HOWK 1J6VA 1O29A 1TWGC 3FKIK 5C3EK 4P5AA 4P5BA 3CQZA 3FHZA 2GAHC 1XXAA 4A3CC 5IOQA 2BE5A 4QIWL 2GSNA 3HXAA 1IQ0A 3GTJC 1SFOK 2JA6A 2E2JC 4MEYA 4C2MC 4G0UA 1TWCK 2JA5K 3M3YK 1O25A 2JA7K 4LQYA 5EGEA 4LK0A 1VH2A 1GE9A 3L4JA 4OIQA 5M5WK 2B63C 4XLNA 1Y1VK 2WB1L 2Y3PA 2NVXK 2WAQL 4GTCA 1YNNA 3S17K 1O2BA 3S1NC 1XZPA 4NOIA 2P5MA 3JSTA 1EK8A 2R93A 4Y52K 1R9TC 1TWHC 5C4JK 3EQLA 3OPFA 2CW0A 3AQOA 4Q5SA 3FKIA 1J6WA 5L46A 5IYDC 5D4DA 5CJ9A 2FQOA 2VUMC 3ADAC 2A6HA 3FOFA 4PABA 3I4NC 5IYCK 1I50C 3GTKC 4RMFA 3WODA 3LAPA 1XXCA 1DCHA 1SFOA 5JVOA 4BXXK 4LJZA 1WOPA 3GTPA 2JA5A 4MEXA 4A3MC 5IP7K 1IW7A 2JA7A 4C3IK 3S2DC 3N0BA 4XLPA 3PO3K 1USOA 2GSUA 1Y1VA 3S1QC 2NVXA 1JQWA 4BBSK 1F7UA 1IBAA 2NVQC 3ERED 3S1RK 1F9NA 3HOXK 2A68A 3GTLK 4A3BK 4JK1A 4MQ9A 4QIWD 3AQPA 3TFJA 1KQ4A 2NVTC 5TJ3A 3M4OK 1JOEA 1JVIA 4KATA 3A8KA 2RGRA 4AYBL 4C3JC 5C3EC 4A93K 4ILDA 1VJEA 1XZQA 3AH5A 3CQZK 3TFIA 1PJ5A 4GTEA 3GTMC 4KASA 2E2IC 2R92K 4BY7C 4Q4ZA 2A69A 5IP9C 2WB1D 4KMHA 4OIOA 2WAQD 4OINA 3G4CA 1TWCC 3M3YC 2PPBA 2PHCB 4M1XA 1BS2A 1UV7A 4O2DA 4G7OA 4A3GK 3AD7C 1VRQC 4KMDA 4YG2A 4A3IC 1IE0A 3S17C 1L0WA 4LK1A 3PO2K 2V6UA 1XPPA 4WILA 2JA8C 2R93K 4A3JK 1O27A 1V5VA 3I4MK 3GTOC 2YU9K 4LLGA 4A3FK 4GFQA 1I6HK 3LAJA 2R92A 1TWFC 1YX2A 3K7AC 2O5IA 3BP8C 3H0GC 1TWAK 1YNJA 4C3HC 3HOVC 5CHPA 1EI6A 4G0WA 5M3FK 4A3KK 3GTPK 5JFEA 3MMLB 3VA7A 4KN4A 4C3IC 2FQTA 2XCOA 5FLMC 1PJ7A 5IORA 3NUHA 3S14K 4BBRK 1I50A 3PO3C 3SZZA 2CFAB 1I3QC 5E68A 4AYBD 3S15K 3GDZA 4A3EK 1YCLA 3Q3QA 5IOSA 3GEHA 1WSRA 1WCMK 1BJTA 2ZUFA 4BLAA 3FOEA 3HOUC 3GTQC 2YU9A 4G7ZA 1XZQB 2PA8L 2ZFZA 4QJVB 3CQZC 1K83K 3S0XA 3GSIA 4KB4A 3HOZK 2R7ZA 3S2HC 4LOWA 5TMFA 1TWAA 4KARA 2XCQA 3TFHA 2JA6C 4XSZA 2NVYK 3HOYK 1WOOA 4P9SA 5C4XC 3S1MK 3RZOC 1J6XA 1B4AA 1TWGK 1WSVA 3GEIA 1WQGA 3RZDK 3GTGA 1Y1WA 3T01A 2XCRB 4XSXA 1I6VA 3GTJK 3SZYA 3H3VL 2E2JK 4C2MK 1WIHA 5IYBC 1WCMA 4C45A 5C44K 3AD9C 2R93C 4KDDA 4OIRA 4A3DC 3HOWC 1O2AA 1O26A 3FKIC 4KC6A 2V6SA 1HQMA 1K83A 2B63K 4A3FC 3GEEA 2EBBA 1IL2A 1O28A 1PJ6A 4YFNA 2V6TA 4BY1K 3S1NK 1SFOC 2NVYA 2E2HA 3T00A 1TWHK 3GTPC 2JA5C 1TWGA 3TTGA 5IYDK 4KB2A 2JA7C 1BDFA 2VUMK 1WORA 3I4NK 1I50K 1TWFA 3L4KA 2O5JA 1Y1VC 4GTFA 3GTJA 2NVXC 5M5XK 4BLBA 2PA8D 4BKWA 1XZPB 1WQHA 4XCHA 3S16K 4A3MK 4Y52C 5C4JC 4GTAA 4Y7NK 4FM9A 2B63A 1VLOA 1BGWA 4KMAA 4OIPA 5IYCC 4LR2A 2NVQK 4ZH4A 4GZYA 2R7ZK 2Y0SL 1DCOA 4WJ3M 2RH6A 1EFWA 1R9TA 1TWHA 4KM9A 2NVTK 4BXXC 3HOYC 5IP7C 5FJ8K 4C3JK 3H3VD 2VUMA 5M3MK 4KN7A 1DD5A 3GTKA 3RZDC 3DXJA 3GTMK 1Y1WK 4YFKA 5EGHA 3GTGK 2E2IK 4BBSC 1ZBSA 4BY7K 2W7VA 5IP9K 3S1RC 4GTDA 3HOXC 3GTLC 4A3BC 4A3LK 2ZUEA 3OREA 5M5YK 1SMYA 5C44C 4DDQA 3M4OC 3HKZL 3N3YA 4X6AK 1O2FB 4FZBA 4A93C 1F93A 1IS1A 4AH6A 1WOSA 4A3IK 2A6EA 2JH3A 5IOTA 4KMUA 2P8TA 2R92C 4BY1C 3OEPA 2E2HK 2JA8K 1B4BA 1DCPA 2GSOA 2PMZL 3GTOK 1AB4A 3G4AA 4A3CK 3GTMA 4A3GC 2E2IA 1ISEA 1TWFK 1USMA 1INNA 3K7AK 4GTLA 1ZQ1C 3H0GK 3A8IA 1HI9A 4KM8A 1ZVUA 1O24A 4C3HK 3HOVK 3PO2C 3S16C 1TWCA 5HL8A 3AD8C 2GAGC 2Y0SD 3BP3A 5FLMK 4Y7NC 4A3JC 3BUEA 1RU0A 3I4MC 2YU9C 4KAWX 2D6FC 1I3QK 2CFAA 1G51A 1VGXA 3QX3A 1I6HC 3N0CA 1X31C 2R7ZC 1TWAC 1F7VA 1R9TK 1WQFA 2KWAA 4A3KC 3LPXA 3IPJA 3HOUK 5TMCA 3GTQK 3GTOA 1ZYRA 4QJVA 3S14C 4BBRC 3GTKK 1ZXOA 1Y1WC 3GTGC 3S2HK 3HKZD 3H0GA 4G7HA 3S15C 4A3EC 1XXBA 3T02A 1EH1A 2JA6K
chains in the Genus database with same CATH topology
2PA8L 4QJVB 2NVQC 4C3JK 3H3VD 3CQZC 1K83K 5C4XK 5M3MK 3S1RK 4KN7A 4A3LC 3RZOK 3HOXK 2A68A 3GTLK 3HOZK 4JK1A 1WCMC 4MQ9A 3S2HC 4QIWD 4A3BK 3RZDC 5TMFA 3DXJA 3S2DK 3GTMK 1Y1WK 4YFKA 2NVTC 3GTGK 2E2IK 4BBSC 3M4OK 4X6AC 2JA6C 4XSZA 2NVYK 3S1QK 4BY7K 3HOYK 5IP9K 4AYBL 1K83C 5C4XC 5C3EC 3S1RC 4A93K 3S1MK 3RZOC 4YFXA 3HOXC 3CQZK 3GTLC 1TWGK 2PMZD 3HOZC 4A3BC 4A3LK 3GTMC 5M5YK 1SMYA 5C44C 2E2IC 3RZDK 5IYBK 2R92K 3M4OC 2NVYC 2E2HC 4BY7C 4Q4ZA 3HKZL 2A69A 5IP9C 4X6AK 4XSXA 1I6VA 2WB1D 3S1MC 3GTJK 4A93C 4A3DK 3HOWK 1TWGC 3FKIK 5C3EK 4OIOA 2WAQD 4A3IK 2A6EA 4OINA 3H3VL 2E2JK 1TWCC 3M3YC 4KMUA 4C2MK 2PPBA 4A3CC 5IYBC 2R92C 4BY1C 2BE5A 4QIWL 5C44K 4G7OA 2R93C 4A3GK 4OIRA 2E2HK 2JA8K 4A3DC 3GTJC 3HOWC 1SFOK 3FKIC 4YG2A 4A3IC 1HQMA 2E2JC 2B63K 4MEYA 4A3FC 1TWCK 2PMZL 2JA5K 3M3YK 3GTOK 3S17C 4LK1A 3PO2K 4YFNA 4A3CK 2JA7K 4A3GC 4BY1K 4LK0A 1XPPA 2JA8C 3S1NK 2R93K 1SFOC 1TWFK 3K7AK 4OIQA 3H0GK 1TWHK 5M5WK 4A3JK 2B63C 4XLNA 1Y1VK 2WB1L 2NVXK 3GTPC 2JA5C 2WAQL 3GTOC 3I4MK 4C3HK 2YU9K 3HOVK 4LLGA 1YNNA 4A3FK 3PO2C 3S16C 2JA7C 3S17K 1BDFA 2VUMK 1I6HK 5IYDK 3S1NC 4NOIA 2Y0SD 1TWFC 3I4NK 5FLMK 4Y7NC 3K7AC 2O5IA 1I50K 4Y52K 3H0GC 1TWHC 5C4JK 1TWAK 4A3JC 1R9TC 1Y1VC 3EQLA 2O5JA 2CW0A 2NVXC 5M5XK 1YNJA 4Q5SA 3I4MC 5IYDC 2YU9C 3HOVC 1I3QK 5D4DA 5M3FK 2PA8D 4A3KK 3GTPK 2VUMC 1I6HC 2A6HA 3S16K 4KN4A 4A3MK 3I4NC 5IYCK 5FLMC 2R7ZC 1I50C 3GTKC 3WODA 4Y52C 5C4JC 1TWAC 4Y7NK 4BBRK 3S14K 3PO3C 1R9TK 1I3QC 4A3KC 4AYBD 4BXXK 3S15K 4LJZA 4A3EK 3HOUK 5TMCA 4OIPA 4A3MC 5IP7K 5IYCC 1ZYRA 4MEXA 3GTQK 1IW7A 2NVQK 4ZH4A 4C3IK 4GZYA 4QJVA 2R7ZK 4BBRC 3S14C 3S2DC 2Y0SL 3GTKK 4XLPA 1Y1WC 3GTGC 1WCMK 3S2HK 3PO3K 3HKZD 4G7HA 3S1QC 2NVTK 4BXXC 3S15C 3HOYC 4A3EC 3HOUC 4BBSK 3GTQC 5IP7C 2JA6K 5FJ8K 4G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 L;  4QJV B;  2NVQ C;  4C3J K;  3H3V D;  3CQZ C;  1K83 K;  5C4X K;  5M3M K;  3S1R K;  4KN7 A;  4A3L C;  3RZO K;  3HOX K;  2A68 A;  3GTL K;  3HOZ K;  4JK1 A;  1WCM C;  4MQ9 A;  3S2H C;  4QIW D;  4A3B K;  3RZD C;  5TMF A;  3DXJ A;  3S2D K;  3GTM K;  1Y1W K;  4YFK A;  2NVT C;  3GTG K;  2E2I K;  4BBS C;  3M4O K;  4X6A C;  2JA6 C;  4XSZ A;  2NVY K;  3S1Q K;  4BY7 K;  3HOY K;  5IP9 K;  4AYB L;  1K83 C;  5C4X C;  5C3E C;  3S1R C;  4A93 K;  3S1M K;  3RZO C;  4YFX A;  3HOX C;  3CQZ K;  3GTL C;  1TWG K;  2PMZ D;  3HOZ C;  4A3B C;  4A3L K;  3GTM C;  5M5Y K;  1SMY A;  5C44 C;  2E2I C;  3RZD K;  5IYB K;  2R92 K;  3M4O C;  2NVY C;  2E2H C;  4BY7 C;  4Q4Z A;  3HKZ L;  2A69 A;  5IP9 C;  4X6A K;  4XSX A;  1I6V A;  2WB1 D;  3S1M C;  3GTJ K;  4A93 C;  4A3D K;  3HOW K;  1TWG C;  3FKI K;  5C3E K;  4OIO A;  2WAQ D;  4A3I K;  2A6E A;  4OIN A;  3H3V L;  2E2J K;  1TWC C;  3M3Y C;  4KMU A;  4C2M K;  2PPB A;  4A3C C;  5IYB C;  2R92 C;  4BY1 C;  2BE5 A;  4QIW L;  5C44 K;  4G7O A;  2R93 C;  4A3G K;  4OIR A;  2E2H K;  2JA8 K;  4A3D C;  3GTJ C;  3HOW C;  1SFO K;  3FKI C;  4YG2 A;  4A3I C;  1HQM A;  2E2J C;  2B63 K;  4MEY A;  4A3F C;  1TWC K;  2PMZ L;  2JA5 K;  3M3Y K;  3GTO K;  3S17 C;  4LK1 A;  3PO2 K;  4YFN A;  4A3C K;  2JA7 K;  4A3G C;  4BY1 K;  4LK0 A;  1XPP A;  2JA8 C;  3S1N K;  2R93 K;  1SFO C;  1TWF K;  3K7A K;  4OIQ A;  3H0G K;  1TWH K;  5M5W K;  4A3J K;  2B63 C;  4XLN A;  1Y1V K;  2WB1 L;  2NVX K;  3GTP C;  2JA5 C;  2WAQ L;  3GTO C;  3I4M K;  4C3H K;  2YU9 K;  3HOV K;  4LLG A;  1YNN A;  4A3F K;  3PO2 C;  3S16 C;  2JA7 C;  3S17 K;  1BDF A;  2VUM K;  1I6H K;  5IYD K;  3S1N C;  4NOI A;  2Y0S D;  1TWF C;  3I4N K;  5FLM K;  4Y7N C;  3K7A C;  2O5I A;  1I50 K;  4Y52 K;  3H0G C;  1TWH C;  5C4J K;  1TWA K;  4A3J C;  1R9T C;  1Y1V C;  3EQL A;  2O5J A;  2CW0 A;  2NVX C;  5M5X K;  1YNJ A;  4Q5S A;  3I4M C;  5IYD C;  2YU9 C;  3HOV C;  1I3Q K;  5D4D A;  5M3F K;  2PA8 D;  4A3K K;  3GTP K;  2VUM C;  1I6H C;  2A6H A;  3S16 K;  4KN4 A;  4A3M K;  3I4N C;  5IYC K;  5FLM C;  2R7Z C;  1I50 C;  3GTK C;  3WOD A;  4Y52 C;  5C4J C;  1TWA C;  4Y7N K;  4BBR K;  3S14 K;  3PO3 C;  1R9T K;  1I3Q C;  4A3K C;  4AYB D;  4BXX K;  3S15 K;  4LJZ A;  4A3E K;  3HOU K;  5TMC A;  4OIP A;  4A3M C;  5IP7 K;  5IYC C;  1ZYR A;  4MEX A;  3GTQ K;  1IW7 A;  2NVQ K;  4ZH4 A;  4C3I K;  4GZY A;  4QJV A;  2R7Z K;  4BBR C;  3S14 C;  3S2D C;  2Y0S L;  3GTK K;  4XLP A;  1Y1W C;  3GTG C;  1WCM K;  3S2H K;  3PO3 K;  3HKZ D;  4G7H A;  3S1Q C;  2NVT K;  4BXX C;  3S15 C;  3HOY C;  4A3E C;  3HOU C;  4BBS K;  3GTQ C;  5IP7 C;  2JA6 K;  5FJ8 K;  4G7Z A; 
#chains in the Genus database with same CATH topology
 5C4X K;  4A3L C;  3RZO K;  4PAA A;  1WCM C;  3S2D K;  3V4G A;  4GT9 A;  4X6A C;  3S1Q K;  1I3Q A;  4G0V A;  1K83 C;  1C0A A;  4WJ4 A;  3GIR A;  4YFX A;  2PMZ D;  3HOZ C;  4GTB A;  3GTL A;  1EQR A;  3CAG A;  5IYB K;  2NVY C;  2E2H C;  1J98 A;  4A3D K;  4J3N A;  3S1M C;  3A8J A;  3GTQ A;  3HOW K;  1J6V A;  1O29 A;  1TWG C;  3FKI K;  5C3E K;  4P5A A;  4P5B A;  3CQZ A;  3FHZ A;  2GAH C;  1XXA A;  4A3C C;  5IOQ A;  2BE5 A;  4QIW L;  2GSN A;  3HXA A;  1IQ0 A;  3GTJ C;  1SFO K;  2JA6 A;  2E2J C;  4MEY A;  4C2M C;  4G0U A;  1TWC K;  2JA5 K;  3M3Y K;  1O25 A;  2JA7 K;  4LQY A;  5EGE A;  4LK0 A;  1VH2 A;  1GE9 A;  3L4J A;  4OIQ A;  5M5W K;  2B63 C;  4XLN A;  1Y1V K;  2WB1 L;  2Y3P A;  2NVX K;  2WAQ L;  4GTC A;  1YNN A;  3S17 K;  1O2B A;  3S1N C;  1XZP A;  4NOI A;  2P5M A;  3JST A;  1EK8 A;  2R93 A;  4Y52 K;  1R9T C;  1TWH C;  5C4J K;  3EQL A;  3OPF A;  2CW0 A;  3AQO A;  4Q5S A;  3FKI A;  1J6W A;  5L46 A;  5IYD C;  5D4D A;  5CJ9 A;  2FQO A;  2VUM C;  3ADA C;  2A6H A;  3FOF A;  4PAB A;  3I4N C;  5IYC K;  1I50 C;  3GTK C;  4RMF A;  3WOD A;  3LAP A;  1XXC A;  1DCH A;  1SFO A;  5JVO A;  4BXX K;  4LJZ A;  1WOP A;  3GTP A;  2JA5 A;  4MEX A;  4A3M C;  5IP7 K;  1IW7 A;  2JA7 A;  4C3I K;  3S2D C;  3N0B A;  4XLP A;  3PO3 K;  1USO A;  2GSU A;  1Y1V A;  3S1Q C;  2NVX A;  1JQW A;  4BBS K;  1F7U A;  1IBA A;  2NVQ C;  3ERE D;  3S1R K;  1F9N A;  3HOX K;  2A68 A;  3GTL K;  4A3B K;  4JK1 A;  4MQ9 A;  4QIW D;  3AQP A;  3TFJ A;  1KQ4 A;  2NVT C;  5TJ3 A;  3M4O K;  1JOE A;  1JVI A;  4KAT A;  3A8K A;  2RGR A;  4AYB L;  4C3J C;  5C3E C;  4A93 K;  4ILD A;  1VJE A;  1XZQ A;  3AH5 A;  3CQZ K;  3TFI A;  1PJ5 A;  4GTE A;  3GTM C;  4KAS A;  2E2I C;  2R92 K;  4BY7 C;  4Q4Z A;  2A69 A;  5IP9 C;  2WB1 D;  4KMH A;  4OIO A;  2WAQ D;  4OIN A;  3G4C A;  1TWC C;  3M3Y C;  2PPB A;  2PHC B;  4M1X A;  1BS2 A;  1UV7 A;  4O2D A;  4G7O A;  4A3G K;  3AD7 C;  1VRQ C;  4KMD A;  4YG2 A;  4A3I C;  1IE0 A;  3S17 C;  1L0W A;  4LK1 A;  3PO2 K;  2V6U A;  1XPP A;  4WIL A;  2JA8 C;  2R93 K;  4A3J K;  1O27 A;  1V5V A;  3I4M K;  3GTO C;  2YU9 K;  4LLG A;  4A3F K;  4GFQ A;  1I6H K;  3LAJ A;  2R92 A;  1TWF C;  1YX2 A;  3K7A C;  2O5I A;  3BP8 C;  3H0G C;  1TWA K;  1YNJ A;  4C3H C;  3HOV C;  5CHP A;  1EI6 A;  4G0W A;  5M3F K;  4A3K K;  3GTP K;  5JFE A;  3MML B;  3VA7 A;  4KN4 A;  4C3I C;  2FQT A;  2XCO A;  5FLM C;  1PJ7 A;  5IOR A;  3NUH A;  3S14 K;  4BBR K;  1I50 A;  3PO3 C;  3SZZ A;  2CFA B;  1I3Q C;  5E68 A;  4AYB D;  3S15 K;  3GDZ A;  4A3E K;  1YCL A;  3Q3Q A;  5IOS A;  3GEH A;  1WSR A;  1WCM K;  1BJT A;  2ZUF A;  4BLA A;  3FOE A;  3HOU C;  3GTQ C;  2YU9 A;  4G7Z A;  1XZQ B;  2PA8 L;  2ZFZ A;  4QJV B;  3CQZ C;  1K83 K;  3S0X A;  3GSI A;  4KB4 A;  3HOZ K;  2R7Z A;  3S2H C;  4LOW A;  5TMF A;  1TWA A;  4KAR A;  2XCQ A;  3TFH A;  2JA6 C;  4XSZ A;  2NVY K;  3HOY K;  1WOO A;  4P9S A;  5C4X C;  3S1M K;  3RZO C;  1J6X A;  1B4A A;  1TWG K;  1WSV A;  3GEI A;  1WQG A;  3RZD K;  3GTG A;  1Y1W A;  3T01 A;  2XCR B;  4XSX A;  1I6V A;  3GTJ K;  3SZY A;  3H3V L;  2E2J K;  4C2M K;  1WIH A;  5IYB C;  1WCM A;  4C45 A;  5C44 K;  3AD9 C;  2R93 C;  4KDD A;  4OIR A;  4A3D C;  3HOW C;  1O2A A;  1O26 A;  3FKI C;  4KC6 A;  2V6S A;  1HQM A;  1K83 A;  2B63 K;  4A3F C;  3GEE A;  2EBB A;  1IL2 A;  1O28 A;  1PJ6 A;  4YFN A;  2V6T A;  4BY1 K;  3S1N K;  1SFO C;  2NVY A;  2E2H A;  3T00 A;  1TWH K;  3GTP C;  2JA5 C;  1TWG A;  3TTG A;  5IYD K;  4KB2 A;  2JA7 C;  1BDF A;  2VUM K;  1WOR A;  3I4N K;  1I50 K;  1TWF A;  3L4K A;  2O5J A;  1Y1V C;  4GTF A;  3GTJ A;  2NVX C;  5M5X K;  4BLB A;  2PA8 D;  4BKW A;  1XZP B;  1WQH A;  4XCH A;  3S16 K;  4A3M K;  4Y52 C;  5C4J C;  4GTA A;  4Y7N K;  4FM9 A;  2B63 A;  1VLO A;  1BGW A;  4KMA A;  4OIP A;  5IYC C;  4LR2 A;  2NVQ K;  4ZH4 A;  4GZY A;  2R7Z K;  2Y0S L;  1DCO A;  4WJ3 M;  2RH6 A;  1EFW A;  1R9T A;  1TWH A;  4KM9 A;  2NVT K;  4BXX C;  3HOY C;  5IP7 C;  5FJ8 K;  4C3J K;  3H3V D;  2VUM A;  5M3M K;  4KN7 A;  1DD5 A;  3GTK A;  3RZD C;  3DXJ A;  3GTM K;  1Y1W K;  4YFK A;  5EGH A;  3GTG K;  2E2I K;  4BBS C;  1ZBS A;  4BY7 K;  2W7V A;  5IP9 K;  3S1R C;  4GTD A;  3HOX C;  3GTL C;  4A3B C;  4A3L K;  2ZUE A;  3ORE A;  5M5Y K;  1SMY A;  5C44 C;  4DDQ A;  3M4O C;  3HKZ L;  3N3Y A;  4X6A K;  1O2F B;  4FZB A;  4A93 C;  1F93 A;  1IS1 A;  4AH6 A;  1WOS A;  4A3I K;  2A6E A;  2JH3 A;  5IOT A;  4KMU A;  2P8T A;  2R92 C;  4BY1 C;  3OEP A;  2E2H K;  2JA8 K;  1B4B A;  1DCP A;  2GSO A;  2PMZ L;  3GTO K;  1AB4 A;  3G4A A;  4A3C K;  3GTM A;  4A3G C;  2E2I A;  1ISE A;  1TWF K;  1USM A;  1INN A;  3K7A K;  4GTL A;  1ZQ1 C;  3H0G K;  3A8I A;  1HI9 A;  4KM8 A;  1ZVU A;  1O24 A;  4C3H K;  3HOV K;  3PO2 C;  3S16 C;  1TWC A;  5HL8 A;  3AD8 C;  2GAG C;  2Y0S D;  3BP3 A;  5FLM K;  4Y7N C;  4A3J C;  3BUE A;  1RU0 A;  3I4M C;  2YU9 C;  4KAW X;  2D6F C;  1I3Q K;  2CFA A;  1G51 A;  1VGX A;  3QX3 A;  1I6H C;  3N0C A;  1X31 C;  2R7Z C;  1TWA C;  1F7V A;  1R9T K;  1WQF A;  2KWA A;  4A3K C;  3LPX A;  3IPJ A;  3HOU K;  5TMC A;  3GTQ K;  3GTO A;  1ZYR A;  4QJV A;  3S14 C;  4BBR C;  3GTK K;  1ZXO A;  1Y1W C;  3GTG C;  3S2H K;  3HKZ D;  3H0G A;  4G7H A;  3S15 C;  4A3E C;  1XXB A;  3T02 A;  1EH1 A;  2JA6 K; 
#chains in the Genus database with same CATH homology
 2PA8 L;  4QJV B;  2NVQ C;  4C3J K;  3H3V D;  3CQZ C;  1K83 K;  5C4X K;  5M3M K;  3S1R K;  4KN7 A;  4A3L C;  3RZO K;  3HOX K;  2A68 A;  3GTL K;  3HOZ K;  4JK1 A;  1WCM C;  4MQ9 A;  3S2H C;  4QIW D;  4A3B K;  3RZD C;  5TMF A;  3DXJ A;  3S2D K;  3GTM K;  1Y1W K;  4YFK A;  2NVT C;  3GTG K;  2E2I K;  4BBS C;  3M4O K;  4X6A C;  2JA6 C;  4XSZ A;  2NVY K;  3S1Q K;  4BY7 K;  3HOY K;  5IP9 K;  4AYB L;  1K83 C;  5C4X C;  5C3E C;  3S1R C;  4A93 K;  3S1M K;  3RZO C;  4YFX A;  3HOX C;  3CQZ K;  3GTL C;  1TWG K;  2PMZ D;  3HOZ C;  4A3B C;  4A3L K;  3GTM C;  5M5Y K;  1SMY A;  5C44 C;  2E2I C;  3RZD K;  5IYB K;  2R92 K;  3M4O C;  2NVY C;  2E2H C;  4BY7 C;  4Q4Z A;  3HKZ L;  2A69 A;  5IP9 C;  4X6A K;  4XSX A;  1I6V A;  2WB1 D;  3S1M C;  3GTJ K;  4A93 C;  4A3D K;  3HOW K;  1TWG C;  3FKI K;  5C3E K;  4OIO A;  2WAQ D;  4A3I K;  2A6E A;  4OIN A;  3H3V L;  2E2J K;  1TWC C;  3M3Y C;  4KMU A;  4C2M K;  2PPB A;  4A3C C;  5IYB C;  2R92 C;  4BY1 C;  2BE5 A;  4QIW L;  5C44 K;  4G7O A;  2R93 C;  4A3G K;  4OIR A;  2E2H K;  2JA8 K;  4A3D C;  3GTJ C;  3HOW C;  1SFO K;  3FKI C;  4YG2 A;  4A3I C;  1HQM A;  2E2J C;  2B63 K;  4MEY A;  4A3F C;  1TWC K;  2PMZ L;  2JA5 K;  3M3Y K;  3GTO K;  3S17 C;  4LK1 A;  3PO2 K;  4YFN A;  4A3C K;  2JA7 K;  4A3G C;  4BY1 K;  4LK0 A;  1XPP A;  2JA8 C;  3S1N K;  2R93 K;  1SFO C;  1TWF K;  3K7A K;  4OIQ A;  3H0G K;  1TWH K;  5M5W K;  4A3J K;  2B63 C;  4XLN A;  1Y1V K;  2WB1 L;  2NVX K;  3GTP C;  2JA5 C;  2WAQ L;  3GTO C;  3I4M K;  4C3H K;  2YU9 K;  3HOV K;  4LLG A;  1YNN A;  4A3F K;  3PO2 C;  3S16 C;  2JA7 C;  3S17 K;  1BDF A;  2VUM K;  1I6H K;  5IYD K;  3S1N C;  4NOI A;  2Y0S D;  1TWF C;  3I4N K;  5FLM K;  4Y7N C;  3K7A C;  2O5I A;  1I50 K;  4Y52 K;  3H0G C;  1TWH C;  5C4J K;  1TWA K;  4A3J C;  1R9T C;  1Y1V C;  3EQL A;  2O5J A;  2CW0 A;  2NVX C;  5M5X K;  1YNJ A;  4Q5S A;  3I4M C;  5IYD C;  2YU9 C;  3HOV C;  1I3Q K;  5D4D A;  5M3F K;  2PA8 D;  4A3K K;  3GTP K;  2VUM C;  1I6H C;  2A6H A;  3S16 K;  4KN4 A;  4A3M K;  3I4N C;  5IYC K;  5FLM C;  2R7Z C;  1I50 C;  3GTK C;  3WOD A;  4Y52 C;  5C4J C;  1TWA C;  4Y7N K;  4BBR K;  3S14 K;  3PO3 C;  1R9T K;  1I3Q C;  4A3K C;  4AYB D;  4BXX K;  3S15 K;  4LJZ A;  4A3E K;  3HOU K;  5TMC A;  4OIP A;  4A3M C;  5IP7 K;  5IYC C;  1ZYR A;  4MEX A;  3GTQ K;  1IW7 A;  2NVQ K;  4ZH4 A;  4C3I K;  4GZY A;  4QJV A;  2R7Z K;  4BBR C;  3S14 C;  3S2D C;  2Y0S L;  3GTK K;  4XLP A;  1Y1W C;  3GTG C;  1WCM K;  3S2H K;  3PO3 K;  3HKZ D;  4G7H A;  3S1Q C;  2NVT K;  4BXX C;  3S15 C;  3HOY C;  4A3E C;  3HOU C;  4BBS K;  3GTQ C;  5IP7 C;  2JA6 K;  5FJ8 K;  4G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...