4A93K

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a93K00
2PPBA 3HOXK 3GTPC 4X6AC 2E2JC 2WAQL 3HOZC 4QIWL 2NVXC 1R9TK 1I50C 5C4JC 4YFNA 2JA5C 2JA6K 3H0GK 3GTKC 2WB1L 5IYBC 3PO2C 2R93K 4A3DK 5IP7C 5IYDC 3HOWK 3GTLK 1ZYRA 4A3KC 2R92K 4A3FC 3GTGC 3GTQK 3S2HK 3S1RC 4QIWD 4A3BK 5M3MK 2JA7C 3S17K 2NVQK 3HOUC 1IW7A 4JK1A 5IP9K 4Q5SA 2A68A 1TWAC 4OIRA 3RZOC 3K7AK 3I4NK 2B63C 4XLPA 3HOYK 4LJZA 4Y52C 4YFKA 2JA8K 1XPPA 4OIOA 2R7ZK 3S1QK 1R9TC 4MQ9A 4LK1A 3HOVC 3M4OK 1TWCC 1K83C 3FKIK 1TWGK 4Y7NK 3I4MC 3PO3C 3S1NK 4A93C 1WCMC 4BXXC 4YFXA 3S2DK 3S15K 3GTJK 1SMYA 4KMUA 4AYBD 3RZDK 2E2HK 4KN7A 4A3JC 4BBSK 5IYCC 4A3IK 1Y1WK 4A3CC 2NVTK 1I6HK 3EQLA 3CQZK 4A3LC 3GTQC 2E2IK 3GTMK 5FLMK 4A3EC 4OINA 2VUMK 3S16C 3M3YK 4XLNA 4QJVB 1I3QC 1TWHC 5C4XC 4MEYA 4A3MC 3GTOC 2YU9C 1BDFA 4XSZA 4BY7K 2NVYC 4AYBL 2BE5A 4XSXA 1TWFK 5C3EC 5C44C 4BY1K 4A3GK 3HOXC 4Y7NC 1SFOK 3S1MK 4G7ZA 3PO3K 1Y1VK 4OIQA 1HQMA 3GTPK 2E2JK 1I6VA 3RZDC 3HOZK 4X6AK 2A6EA 2NVXK 2A6HA 2JA6C 3H0GC 1I50K 5C4JK 3H3VL 2JA5K 3CQZC 4C3HK 2R93C 4A3DC 3WODA 4BBRK 3S14K 5FJ8K 4KN4A 3GTKK 5TMCA 5IYBK 3GTLC 3HOWC 3PO2K 2R92C 3S2HC 5IP7K 4A3BC 4G7HA 3S17C 5IYDK 2NVQC 4A3KK 4QJVA 4A3FK 3GTGK 5IP9C 3S1RK 3K7AC 3I4NC 4C3IK 2PMZD 3HOUK 4LLGA 3HOYC 4GZYA 2Y0SL 3H3VD 1TWAK 3RZOK 2JA8C 2B63K 2R7ZC 3S1QC 3HKZD 2CW0A 2PA8D 5TMFA 4Y52K 1YNNA 3M4OC 4Q4ZA 3FKIC 1TWGC 4ZH4A 3S1NC 3HOVK 1TWCK 4OIPA 5M5YK 1K83K 3S15C 2O5IA 3GTJC 4BBRC 3I4MK 2E2HC 3S14C 4BBSC 4A93K 1WCMK 2PMZL 2Y0SD 4A3IC 1Y1WC 2NVTC 4BXXK 1I6HC 4G7OA 2A69A 2E2IC 4YG2A 4A3JK 5IYCK 3DXJA 3GTMC 3HKZL 4C2MK 2PA8L 5FLMC 4LK0A 4C3JK 2VUMC 4A3CK 4A3LK 3M3YC 2WAQD 2O5JA 4A3EK 3S16K 5M5XK 1I3QK 3S2DC 1TWHK 5C4XK 4BY7C 5M5WK 2JA7K 2WB1D 1YNJA 4A3MK 1TWFC 4NOIA 4MEXA 2YU9K 3GTOK 4BY1C 2NVYK 5D4DA 4A3GC 1SFOC 5C3EK 5M3FK 3S1MC 5C44K 1Y1VC
chains in the Genus database with same CATH superfamily
2PPBA 3HOXK 3HOZC 3GTOA 1R9TK 2JA5C 1F7VA 2JA6K 3H0GK 3GTKC 4FM9A 2WB1L 5IYBC 2R93K 3TTGA 3JSTA 3FOEA 2PHCB 1EFWA 3HOWK 3GTLK 1ZYRA 1PJ6A 3GTGC 3FOFA 5M3MK 1JQWA 4C3IC 1F7UA 3RZOC 2XCOA 2B63C 3HOYK 1PJ7A 4LJZA 3GTQA 1XPPA 3T02A 1G51A 5IORA 1J6WA 2R7ZK 3LAJA 2ZUEA 1R9TC 4LK1A 3FKIK 3AQPA 2FQTA 3S15K 1WOSA 1EH1A 1VLOA 4KMUA 4KN7A 4C2MC 3EQLA 3CQZK 1TWGA 1O28A 4XLNA 1TWHC 4MEYA 2YU9C 2GSNA 2E2IA 4J3NA 2BE5A 1RU0A 1SFOK 3PO3K 4X6AK 1USOA 2E2JK 4LOWA 2CFAA 1TWFA 1GE9A 4KM8A 5C4JK 3CQZC 4A3DC 2P8TA 3V4GA 3PO2K 3LAPA 3GTPA 2R92C 1ZVUA 4A3BC 4G7HA 1L0WA 5IYDK 4QJVA 5TJ3A 4A3FK 2ZFZA 5L46A 5E68A 3GSIA 1IL2A 3HOUK 1AB4A 3A8KA 3H3VD 3HKZD 1YNNA 3M4OC 4Q4ZA 2Y3PA 1TWAA 3A8IA 3S2DC 1IE0A 4KASA 1K83K 3GTJC 2GSOA 1WQFA 1USMA 1Y1WC 1I6HC 4G7OA 4ILDA 3AD8C 3ERED 1TWCA 3OEPA 3OPFA 4M1XA 1WCMA 4A3EK 1O27A 5M5XK 1I3QK 1O2AA 4A3MK 1YNJA 3GTOK 4NOIA 1BGWA 1JOEA 3S1MC 1F93A 5JFEA 2JA7A 2NVXC 1ZBSA 1KQ4A 1I50C 4KC6A 4C3HC 1BJTA 1VJEA 4GTFA 3GTQK 2GAHC 3BP8C 3S17K 4LQYA 4JK1A 2A68A 4OIRA 3K7AK 3I4NK 4KDDA 4Y52C 3VA7A 4YFKA 1ISEA 3S1QK 1J6VA 3N0CA 3HOVC 1I3QA 1TWGK 1IQ0A 2CFAB 3S1NK 2V6UA 3RZDK 5IOQA 4AYBD 4BBSK 5IYCC 4A3IK 4A3CC 2NVTK 4A3LC 3GTQC 2E2IK 3AQOA 3S16C 4QJVB 2E2HA 1IS1A 3T01A 4XSZA 2NVYC 3GTMA 2VUMA 1TWFK 5C44C 4BY1K 3HOXC 3AD7C 1YCLA 4P9SA 4OIQA 3GTPK 3RZDC 4GTAA 2RH6A 2JA6C 3H0GC 1O2FB 4O2DA 3H3VL 2R93C 4BBRK 5FJ8K 4KN4A 1Y1VA 5TMCA 2V6SA 3L4KA 3GTLC 3HOWC 5IP7K 4A3KK 2JA5A 3S1RK 3GTKA 2PMZD 3HOYC 4P5AA 1TWAK 2R7ZC 2CW0A 2PA8D 5TMFA 3G4AA 1B4AA 3GTGA 4GTBA 4PABA 1EK8A 3FKIC 3LPXA 4WJ4A 1TWCK 4OIPA 5M5YK 3S15C 2O5IA 3I4MK 4BBRC 2B63A 1O25A 2JH3A 4A93K 1WCMK 4BXXK 2Y0SD 2A69A 4A3JK 1PJ5A 4C3JK 4KMHA 1J98A 3HXAA 2KWAA 5C4XK 1WSVA 2JA7K 2WB1D 1WQHA 4KATA 3TFHA 4LR2A 1SFOC 5C3EK 5M3FK 3PO3C 1TWHA 4X6AC 2E2JC 2WAQL 4KAWX 2YU9A 5C4JC 1XZQA 3SZZA 5EGEA 2ZUFA 3PO2C 2EBBA 2GSUA 1INNA 5IYDC 3IPJA 1WOOA 4A3FC 4GTDA 3S2HK 4QIWD 2JA7C 2NVQK 3HOUC 1IW7A 5IP9K 4Q5SA 4XLPA 2R92A 3AD9C 2JA8K 4OIOA 4PAAA 3GDZA 5EGHA 4MQ9A 2FQOA 1K83C 4Y7NK 1VRQC 2E2HK 3MMLB 1DD5A 1J6XA 1VGXA 3GEIA 3GTMK 5FLMK 4A3EC 2VUMK 3M3YK 3GTJA 4KB2A 1I3QC 3BUEA 3OREA 4GTCA 1DCHA 4A3MC 2D6FC 3GTOC 1BDFA 4BY7K 5CJ9A 4G0UA 1XXBA 4KM9A 1WORA 4GTEA 3FHZA 4A3GK 4Y7NC 4G7ZA 1Y1VK 5CHPA 3BP3A 3HOZK 2A6EA 1XZPA 2JA5K 1F9NA 3WODA 3S14K 3GTKK 3L4JA 5IYBK 5IOTA 2NVXA 1I50A 3S17C 1WIHA 4KARA 3GTGK 3K7AC 3I4NC 4C3IK 4GZYA 2Y0SL 3RZOK 2B63K 3S1QC 1TWGC 4GT9A 3S1NC 3S14C 4FZBA 1EI6A 1XZQB 3N0BA 4G0VA 4BBSC 4A3IC 2NVTC 4KMDA 2E2IC 1DCPA 3HKZL 4C2MK 4KB4A 4C45A 1UV7A 1O29A 1TWHK 5M5WK 4AH6A 1WOPA 1TWFC 4MEXA 2YU9K 3QX3A 4BY1C 3S0XA 3GTPC 1ZQ1C 3AH5A 4G0WA 4QIWL 3TFJA 1EQRA 2XCQA 2NVYA 4YFNA 1O26A 1WSRA 4WILA 1IBAA 4A3DK 4RMFA 5IP7C 4DDQA 1R9TA 4A3KC 2R92K 3S1RC 2JA6A 4P5BA 3H0GA 4A3BK 2P5MA 5IOSA 3SZYA 2R93A 1VH2A 1TWAC 1WQGA 3GTLA 2GAGC 1C0AA 3NUHA 4GFQA 4WJ3M 3GIRA 3M4OK 1TWCC 4BLBA 1BS2A 1V5VA 3I4MC 1XZPB 4A93C 1WCMC 4BXXC 4YFXA 3S2DK 3GTJK 1SMYA 2R7ZA 4A3JC 1Y1WK 1I6HK 4C3JC 3FKIA 4OINA 1JVIA 5C4XC 3T00A 2XCRB 3CQZA 4AYBL 1X31C 4XSXA 5C3EC 3S1MK 1HQMA 1I6VA 2NVXK 2A6HA 3A8JA 1I50K 3TFIA 4C3HK 3GEEA 1SFOA 4GTLA 3S2HC 3ADAC 2NVQC 4BKWA 1HI9A 5IP9C 4BLAA 1Y1WA 4LLGA 4XCHA 2JA8C 3G4CA 5JVOA 4Y52K 4ZH4A 3HOVK 5HL8A 1DCOA 1XXAA 2W7VA 1O2BA 2E2HC 2PMZL 4KMAA 4YG2A 5IYCK 3DXJA 3GTMC 4A3CK 2PA8L 5FLMC 4LK0A 2VUMC 4A3LK 3CAGA 1K83A 2V6TA 3M3YC 2WAQD 2O5JA 3S16K 1YX2A 4BY7C 3GEHA 2RGRA 1XXCA 2NVYK 5D4DA 4A3GC 3N3YA 3Q3QA 1ZXOA 1B4BA 1O24A 5C44K 1Y1VC
chains in the Genus database with same CATH topology
2PPBA 3HOXK 3GTPC 4X6AC 2E2JC 2WAQL 3HOZC 4QIWL 2NVXC 1R9TK 1I50C 5C4JC 4YFNA 2JA5C 2JA6K 3H0GK 3GTKC 2WB1L 5IYBC 3PO2C 2R93K 4A3DK 5IP7C 5IYDC 3HOWK 3GTLK 1ZYRA 4A3KC 2R92K 4A3FC 3GTGC 3GTQK 3S2HK 3S1RC 4QIWD 4A3BK 5M3MK 2JA7C 3S17K 2NVQK 3HOUC 1IW7A 4JK1A 5IP9K 4Q5SA 2A68A 1TWAC 4OIRA 3RZOC 3K7AK 3I4NK 2B63C 4XLPA 3HOYK 4LJZA 4Y52C 4YFKA 2JA8K 1XPPA 4OIOA 2R7ZK 3S1QK 1R9TC 4MQ9A 4LK1A 3HOVC 3M4OK 1TWCC 1K83C 3FKIK 1TWGK 4Y7NK 3I4MC 3PO3C 3S1NK 4A93C 1WCMC 4BXXC 4YFXA 3S2DK 3S15K 3GTJK 1SMYA 4KMUA 4AYBD 3RZDK 2E2HK 4KN7A 4A3JC 4BBSK 5IYCC 4A3IK 1Y1WK 4A3CC 2NVTK 1I6HK 3EQLA 3CQZK 4A3LC 3GTQC 2E2IK 3GTMK 5FLMK 4A3EC 4OINA 2VUMK 3S16C 3M3YK 4XLNA 4QJVB 1I3QC 1TWHC 5C4XC 4MEYA 4A3MC 3GTOC 2YU9C 1BDFA 4XSZA 4BY7K 2NVYC 4AYBL 2BE5A 4XSXA 1TWFK 5C3EC 5C44C 4BY1K 4A3GK 3HOXC 4Y7NC 1SFOK 3S1MK 4G7ZA 3PO3K 1Y1VK 4OIQA 1HQMA 3GTPK 2E2JK 1I6VA 3RZDC 3HOZK 4X6AK 2A6EA 2NVXK 2A6HA 2JA6C 3H0GC 1I50K 5C4JK 3H3VL 2JA5K 3CQZC 4C3HK 2R93C 4A3DC 3WODA 4BBRK 3S14K 5FJ8K 4KN4A 3GTKK 5TMCA 5IYBK 3GTLC 3HOWC 3PO2K 2R92C 3S2HC 5IP7K 4A3BC 4G7HA 3S17C 5IYDK 2NVQC 4A3KK 4QJVA 4A3FK 3GTGK 5IP9C 3S1RK 3K7AC 3I4NC 4C3IK 2PMZD 3HOUK 4LLGA 3HOYC 4GZYA 2Y0SL 3H3VD 1TWAK 3RZOK 2JA8C 2B63K 2R7ZC 3S1QC 3HKZD 2CW0A 2PA8D 5TMFA 4Y52K 1YNNA 3M4OC 4Q4ZA 3FKIC 1TWGC 4ZH4A 3S1NC 3HOVK 1TWCK 4OIPA 5M5YK 1K83K 3S15C 2O5IA 3GTJC 4BBRC 3I4MK 2E2HC 3S14C 4BBSC 4A93K 1WCMK 2PMZL 2Y0SD 4A3IC 1Y1WC 2NVTC 4BXXK 1I6HC 4G7OA 2A69A 2E2IC 4YG2A 4A3JK 5IYCK 3DXJA 3GTMC 3HKZL 4C2MK 2PA8L 5FLMC 4LK0A 4C3JK 2VUMC 4A3CK 4A3LK 3M3YC 2WAQD 2O5JA 4A3EK 3S16K 5M5XK 1I3QK 3S2DC 1TWHK 5C4XK 4BY7C 5M5WK 2JA7K 2WB1D 1YNJA 4A3MK 1TWFC 4NOIA 4MEXA 2YU9K 3GTOK 4BY1C 2NVYK 5D4DA 4A3GC 1SFOC 5C3EK 5M3FK 3S1MC 5C44K 1Y1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPB A;  3HOX K;  3GTP C;  4X6A C;  2E2J C;  2WAQ L;  3HOZ C;  4QIW L;  2NVX C;  1R9T K;  1I50 C;  5C4J C;  4YFN A;  2JA5 C;  2JA6 K;  3H0G K;  3GTK C;  2WB1 L;  5IYB C;  3PO2 C;  2R93 K;  4A3D K;  5IP7 C;  5IYD C;  3HOW K;  3GTL K;  1ZYR A;  4A3K C;  2R92 K;  4A3F C;  3GTG C;  3GTQ K;  3S2H K;  3S1R C;  4QIW D;  4A3B K;  5M3M K;  2JA7 C;  3S17 K;  2NVQ K;  3HOU C;  1IW7 A;  4JK1 A;  5IP9 K;  4Q5S A;  2A68 A;  1TWA C;  4OIR A;  3RZO C;  3K7A K;  3I4N K;  2B63 C;  4XLP A;  3HOY K;  4LJZ A;  4Y52 C;  4YFK A;  2JA8 K;  1XPP A;  4OIO A;  2R7Z K;  3S1Q K;  1R9T C;  4MQ9 A;  4LK1 A;  3HOV C;  3M4O K;  1TWC C;  1K83 C;  3FKI K;  1TWG K;  4Y7N K;  3I4M C;  3PO3 C;  3S1N K;  4A93 C;  1WCM C;  4BXX C;  4YFX A;  3S2D K;  3S15 K;  3GTJ K;  1SMY A;  4KMU A;  4AYB D;  3RZD K;  2E2H K;  4KN7 A;  4A3J C;  4BBS K;  5IYC C;  4A3I K;  1Y1W K;  4A3C C;  2NVT K;  1I6H K;  3EQL A;  3CQZ K;  4A3L C;  3GTQ C;  2E2I K;  3GTM K;  5FLM K;  4A3E C;  4OIN A;  2VUM K;  3S16 C;  3M3Y K;  4XLN A;  4QJV B;  1I3Q C;  1TWH C;  5C4X C;  4MEY A;  4A3M C;  3GTO C;  2YU9 C;  1BDF A;  4XSZ A;  4BY7 K;  2NVY C;  4AYB L;  2BE5 A;  4XSX A;  1TWF K;  5C3E C;  5C44 C;  4BY1 K;  4A3G K;  3HOX C;  4Y7N C;  1SFO K;  3S1M K;  4G7Z A;  3PO3 K;  1Y1V K;  4OIQ A;  1HQM A;  3GTP K;  2E2J K;  1I6V A;  3RZD C;  3HOZ K;  4X6A K;  2A6E A;  2NVX K;  2A6H A;  2JA6 C;  3H0G C;  1I50 K;  5C4J K;  3H3V L;  2JA5 K;  3CQZ C;  4C3H K;  2R93 C;  4A3D C;  3WOD A;  4BBR K;  3S14 K;  5FJ8 K;  4KN4 A;  3GTK K;  5TMC A;  5IYB K;  3GTL C;  3HOW C;  3PO2 K;  2R92 C;  3S2H C;  5IP7 K;  4A3B C;  4G7H A;  3S17 C;  5IYD K;  2NVQ C;  4A3K K;  4QJV A;  4A3F K;  3GTG K;  5IP9 C;  3S1R K;  3K7A C;  3I4N C;  4C3I K;  2PMZ D;  3HOU K;  4LLG A;  3HOY C;  4GZY A;  2Y0S L;  3H3V D;  1TWA K;  3RZO K;  2JA8 C;  2B63 K;  2R7Z C;  3S1Q C;  3HKZ D;  2CW0 A;  2PA8 D;  5TMF A;  4Y52 K;  1YNN A;  3M4O C;  4Q4Z A;  3FKI C;  1TWG C;  4ZH4 A;  3S1N C;  3HOV K;  1TWC K;  4OIP A;  5M5Y K;  1K83 K;  3S15 C;  2O5I A;  3GTJ C;  4BBR C;  3I4M K;  2E2H C;  3S14 C;  4BBS C;  4A93 K;  1WCM K;  2PMZ L;  2Y0S D;  4A3I C;  1Y1W C;  2NVT C;  4BXX K;  1I6H C;  4G7O A;  2A69 A;  2E2I C;  4YG2 A;  4A3J K;  5IYC K;  3DXJ A;  3GTM C;  3HKZ L;  4C2M K;  2PA8 L;  5FLM C;  4LK0 A;  4C3J K;  2VUM C;  4A3C K;  4A3L K;  3M3Y C;  2WAQ D;  2O5J A;  4A3E K;  3S16 K;  5M5X K;  1I3Q K;  3S2D C;  1TWH K;  5C4X K;  4BY7 C;  5M5W K;  2JA7 K;  2WB1 D;  1YNJ A;  4A3M K;  1TWF C;  4NOI A;  4MEX A;  2YU9 K;  3GTO K;  4BY1 C;  2NVY K;  5D4D A;  4A3G C;  1SFO C;  5C3E K;  5M3F K;  3S1M C;  5C44 K;  1Y1V C; 
#chains in the Genus database with same CATH topology
 2PPB A;  3HOX K;  3HOZ C;  3GTO A;  1R9T K;  2JA5 C;  1F7V A;  2JA6 K;  3H0G K;  3GTK C;  4FM9 A;  2WB1 L;  5IYB C;  2R93 K;  3TTG A;  3JST A;  3FOE A;  2PHC B;  1EFW A;  3HOW K;  3GTL K;  1ZYR A;  1PJ6 A;  3GTG C;  3FOF A;  5M3M K;  1JQW A;  4C3I C;  1F7U A;  3RZO C;  2XCO A;  2B63 C;  3HOY K;  1PJ7 A;  4LJZ A;  3GTQ A;  1XPP A;  3T02 A;  1G51 A;  5IOR A;  1J6W A;  2R7Z K;  3LAJ A;  2ZUE A;  1R9T C;  4LK1 A;  3FKI K;  3AQP A;  2FQT A;  3S15 K;  1WOS A;  1EH1 A;  1VLO A;  4KMU A;  4KN7 A;  4C2M C;  3EQL A;  3CQZ K;  1TWG A;  1O28 A;  4XLN A;  1TWH C;  4MEY A;  2YU9 C;  2GSN A;  2E2I A;  4J3N A;  2BE5 A;  1RU0 A;  1SFO K;  3PO3 K;  4X6A K;  1USO A;  2E2J K;  4LOW A;  2CFA A;  1TWF A;  1GE9 A;  4KM8 A;  5C4J K;  3CQZ C;  4A3D C;  2P8T A;  3V4G A;  3PO2 K;  3LAP A;  3GTP A;  2R92 C;  1ZVU A;  4A3B C;  4G7H A;  1L0W A;  5IYD K;  4QJV A;  5TJ3 A;  4A3F K;  2ZFZ A;  5L46 A;  5E68 A;  3GSI A;  1IL2 A;  3HOU K;  1AB4 A;  3A8K A;  3H3V D;  3HKZ D;  1YNN A;  3M4O C;  4Q4Z A;  2Y3P A;  1TWA A;  3A8I A;  3S2D C;  1IE0 A;  4KAS A;  1K83 K;  3GTJ C;  2GSO A;  1WQF A;  1USM A;  1Y1W C;  1I6H C;  4G7O A;  4ILD A;  3AD8 C;  3ERE D;  1TWC A;  3OEP A;  3OPF A;  4M1X A;  1WCM A;  4A3E K;  1O27 A;  5M5X K;  1I3Q K;  1O2A A;  4A3M K;  1YNJ A;  3GTO K;  4NOI A;  1BGW A;  1JOE A;  3S1M C;  1F93 A;  5JFE A;  2JA7 A;  2NVX C;  1ZBS A;  1KQ4 A;  1I50 C;  4KC6 A;  4C3H C;  1BJT A;  1VJE A;  4GTF A;  3GTQ K;  2GAH C;  3BP8 C;  3S17 K;  4LQY A;  4JK1 A;  2A68 A;  4OIR A;  3K7A K;  3I4N K;  4KDD A;  4Y52 C;  3VA7 A;  4YFK A;  1ISE A;  3S1Q K;  1J6V A;  3N0C A;  3HOV C;  1I3Q A;  1TWG K;  1IQ0 A;  2CFA B;  3S1N K;  2V6U A;  3RZD K;  5IOQ A;  4AYB D;  4BBS K;  5IYC C;  4A3I K;  4A3C C;  2NVT K;  4A3L C;  3GTQ C;  2E2I K;  3AQO A;  3S16 C;  4QJV B;  2E2H A;  1IS1 A;  3T01 A;  4XSZ A;  2NVY C;  3GTM A;  2VUM A;  1TWF K;  5C44 C;  4BY1 K;  3HOX C;  3AD7 C;  1YCL A;  4P9S A;  4OIQ A;  3GTP K;  3RZD C;  4GTA A;  2RH6 A;  2JA6 C;  3H0G C;  1O2F B;  4O2D A;  3H3V L;  2R93 C;  4BBR K;  5FJ8 K;  4KN4 A;  1Y1V A;  5TMC A;  2V6S A;  3L4K A;  3GTL C;  3HOW C;  5IP7 K;  4A3K K;  2JA5 A;  3S1R K;  3GTK A;  2PMZ D;  3HOY C;  4P5A A;  1TWA K;  2R7Z C;  2CW0 A;  2PA8 D;  5TMF A;  3G4A A;  1B4A A;  3GTG A;  4GTB A;  4PAB A;  1EK8 A;  3FKI C;  3LPX A;  4WJ4 A;  1TWC K;  4OIP A;  5M5Y K;  3S15 C;  2O5I A;  3I4M K;  4BBR C;  2B63 A;  1O25 A;  2JH3 A;  4A93 K;  1WCM K;  4BXX K;  2Y0S D;  2A69 A;  4A3J K;  1PJ5 A;  4C3J K;  4KMH A;  1J98 A;  3HXA A;  2KWA A;  5C4X K;  1WSV A;  2JA7 K;  2WB1 D;  1WQH A;  4KAT A;  3TFH A;  4LR2 A;  1SFO C;  5C3E K;  5M3F K;  3PO3 C;  1TWH A;  4X6A C;  2E2J C;  2WAQ L;  4KAW X;  2YU9 A;  5C4J C;  1XZQ A;  3SZZ A;  5EGE A;  2ZUF A;  3PO2 C;  2EBB A;  2GSU A;  1INN A;  5IYD C;  3IPJ A;  1WOO A;  4A3F C;  4GTD A;  3S2H K;  4QIW D;  2JA7 C;  2NVQ K;  3HOU C;  1IW7 A;  5IP9 K;  4Q5S A;  4XLP A;  2R92 A;  3AD9 C;  2JA8 K;  4OIO A;  4PAA A;  3GDZ A;  5EGH A;  4MQ9 A;  2FQO A;  1K83 C;  4Y7N K;  1VRQ C;  2E2H K;  3MML B;  1DD5 A;  1J6X A;  1VGX A;  3GEI A;  3GTM K;  5FLM K;  4A3E C;  2VUM K;  3M3Y K;  3GTJ A;  4KB2 A;  1I3Q C;  3BUE A;  3ORE A;  4GTC A;  1DCH A;  4A3M C;  2D6F C;  3GTO C;  1BDF A;  4BY7 K;  5CJ9 A;  4G0U A;  1XXB A;  4KM9 A;  1WOR A;  4GTE A;  3FHZ A;  4A3G K;  4Y7N C;  4G7Z A;  1Y1V K;  5CHP A;  3BP3 A;  3HOZ K;  2A6E A;  1XZP A;  2JA5 K;  1F9N A;  3WOD A;  3S14 K;  3GTK K;  3L4J A;  5IYB K;  5IOT A;  2NVX A;  1I50 A;  3S17 C;  1WIH A;  4KAR A;  3GTG K;  3K7A C;  3I4N C;  4C3I K;  4GZY A;  2Y0S L;  3RZO K;  2B63 K;  3S1Q C;  1TWG C;  4GT9 A;  3S1N C;  3S14 C;  4FZB A;  1EI6 A;  1XZQ B;  3N0B A;  4G0V A;  4BBS C;  4A3I C;  2NVT C;  4KMD A;  2E2I C;  1DCP A;  3HKZ L;  4C2M K;  4KB4 A;  4C45 A;  1UV7 A;  1O29 A;  1TWH K;  5M5W K;  4AH6 A;  1WOP A;  1TWF C;  4MEX A;  2YU9 K;  3QX3 A;  4BY1 C;  3S0X A;  3GTP C;  1ZQ1 C;  3AH5 A;  4G0W A;  4QIW L;  3TFJ A;  1EQR A;  2XCQ A;  2NVY A;  4YFN A;  1O26 A;  1WSR A;  4WIL A;  1IBA A;  4A3D K;  4RMF A;  5IP7 C;  4DDQ A;  1R9T A;  4A3K C;  2R92 K;  3S1R C;  2JA6 A;  4P5B A;  3H0G A;  4A3B K;  2P5M A;  5IOS A;  3SZY A;  2R93 A;  1VH2 A;  1TWA C;  1WQG A;  3GTL A;  2GAG C;  1C0A A;  3NUH A;  4GFQ A;  4WJ3 M;  3GIR A;  3M4O K;  1TWC C;  4BLB A;  1BS2 A;  1V5V A;  3I4M C;  1XZP B;  4A93 C;  1WCM C;  4BXX C;  4YFX A;  3S2D K;  3GTJ K;  1SMY A;  2R7Z A;  4A3J C;  1Y1W K;  1I6H K;  4C3J C;  3FKI A;  4OIN A;  1JVI A;  5C4X C;  3T00 A;  2XCR B;  3CQZ A;  4AYB L;  1X31 C;  4XSX A;  5C3E C;  3S1M K;  1HQM A;  1I6V A;  2NVX K;  2A6H A;  3A8J A;  1I50 K;  3TFI A;  4C3H K;  3GEE A;  1SFO A;  4GTL A;  3S2H C;  3ADA C;  2NVQ C;  4BKW A;  1HI9 A;  5IP9 C;  4BLA A;  1Y1W A;  4LLG A;  4XCH A;  2JA8 C;  3G4C A;  5JVO A;  4Y52 K;  4ZH4 A;  3HOV K;  5HL8 A;  1DCO A;  1XXA A;  2W7V A;  1O2B A;  2E2H C;  2PMZ L;  4KMA A;  4YG2 A;  5IYC K;  3DXJ A;  3GTM C;  4A3C K;  2PA8 L;  5FLM C;  4LK0 A;  2VUM C;  4A3L K;  3CAG A;  1K83 A;  2V6T A;  3M3Y C;  2WAQ D;  2O5J A;  3S16 K;  1YX2 A;  4BY7 C;  3GEH A;  2RGR A;  1XXC A;  2NVY K;  5D4D A;  4A3G C;  3N3Y A;  3Q3Q A;  1ZXO A;  1B4B A;  1O24 A;  5C44 K;  1Y1V C; 
#chains in the Genus database with same CATH homology
 2PPB A;  3HOX K;  3GTP C;  4X6A C;  2E2J C;  2WAQ L;  3HOZ C;  4QIW L;  2NVX C;  1R9T K;  1I50 C;  5C4J C;  4YFN A;  2JA5 C;  2JA6 K;  3H0G K;  3GTK C;  2WB1 L;  5IYB C;  3PO2 C;  2R93 K;  4A3D K;  5IP7 C;  5IYD C;  3HOW K;  3GTL K;  1ZYR A;  4A3K C;  2R92 K;  4A3F C;  3GTG C;  3GTQ K;  3S2H K;  3S1R C;  4QIW D;  4A3B K;  5M3M K;  2JA7 C;  3S17 K;  2NVQ K;  3HOU C;  1IW7 A;  4JK1 A;  5IP9 K;  4Q5S A;  2A68 A;  1TWA C;  4OIR A;  3RZO C;  3K7A K;  3I4N K;  2B63 C;  4XLP A;  3HOY K;  4LJZ A;  4Y52 C;  4YFK A;  2JA8 K;  1XPP A;  4OIO A;  2R7Z K;  3S1Q K;  1R9T C;  4MQ9 A;  4LK1 A;  3HOV C;  3M4O K;  1TWC C;  1K83 C;  3FKI K;  1TWG K;  4Y7N K;  3I4M C;  3PO3 C;  3S1N K;  4A93 C;  1WCM C;  4BXX C;  4YFX A;  3S2D K;  3S15 K;  3GTJ K;  1SMY A;  4KMU A;  4AYB D;  3RZD K;  2E2H K;  4KN7 A;  4A3J C;  4BBS K;  5IYC C;  4A3I K;  1Y1W K;  4A3C C;  2NVT K;  1I6H K;  3EQL A;  3CQZ K;  4A3L C;  3GTQ C;  2E2I K;  3GTM K;  5FLM K;  4A3E C;  4OIN A;  2VUM K;  3S16 C;  3M3Y K;  4XLN A;  4QJV B;  1I3Q C;  1TWH C;  5C4X C;  4MEY A;  4A3M C;  3GTO C;  2YU9 C;  1BDF A;  4XSZ A;  4BY7 K;  2NVY C;  4AYB L;  2BE5 A;  4XSX A;  1TWF K;  5C3E C;  5C44 C;  4BY1 K;  4A3G K;  3HOX C;  4Y7N C;  1SFO K;  3S1M K;  4G7Z A;  3PO3 K;  1Y1V K;  4OIQ A;  1HQM A;  3GTP K;  2E2J K;  1I6V A;  3RZD C;  3HOZ K;  4X6A K;  2A6E A;  2NVX K;  2A6H A;  2JA6 C;  3H0G C;  1I50 K;  5C4J K;  3H3V L;  2JA5 K;  3CQZ C;  4C3H K;  2R93 C;  4A3D C;  3WOD A;  4BBR K;  3S14 K;  5FJ8 K;  4KN4 A;  3GTK K;  5TMC A;  5IYB K;  3GTL C;  3HOW C;  3PO2 K;  2R92 C;  3S2H C;  5IP7 K;  4A3B C;  4G7H A;  3S17 C;  5IYD K;  2NVQ C;  4A3K K;  4QJV A;  4A3F K;  3GTG K;  5IP9 C;  3S1R K;  3K7A C;  3I4N C;  4C3I K;  2PMZ D;  3HOU K;  4LLG A;  3HOY C;  4GZY A;  2Y0S L;  3H3V D;  1TWA K;  3RZO K;  2JA8 C;  2B63 K;  2R7Z C;  3S1Q C;  3HKZ D;  2CW0 A;  2PA8 D;  5TMF A;  4Y52 K;  1YNN A;  3M4O C;  4Q4Z A;  3FKI C;  1TWG C;  4ZH4 A;  3S1N C;  3HOV K;  1TWC K;  4OIP A;  5M5Y K;  1K83 K;  3S15 C;  2O5I A;  3GTJ C;  4BBR C;  3I4M K;  2E2H C;  3S14 C;  4BBS C;  4A93 K;  1WCM K;  2PMZ L;  2Y0S D;  4A3I C;  1Y1W C;  2NVT C;  4BXX K;  1I6H C;  4G7O A;  2A69 A;  2E2I C;  4YG2 A;  4A3J K;  5IYC K;  3DXJ A;  3GTM C;  3HKZ L;  4C2M K;  2PA8 L;  5FLM C;  4LK0 A;  4C3J K;  2VUM C;  4A3C K;  4A3L K;  3M3Y C;  2WAQ D;  2O5J A;  4A3E K;  3S16 K;  5M5X K;  1I3Q K;  3S2D C;  1TWH K;  5C4X K;  4BY7 C;  5M5W K;  2JA7 K;  2WB1 D;  1YNJ A;  4A3M K;  1TWF C;  4NOI A;  4MEX A;  2YU9 K;  3GTO K;  4BY1 C;  2NVY K;  5D4D A;  4A3G C;  1SFO C;  5C3E K;  5M3F K;  3S1M C;  5C44 K;  1Y1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...