3HOXK

Complete rna polymerase ii elongation complex v
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoxK00
1TWFK 4A3BC 1SMYA 3H0GK 5IP9K 4AYBD 3I4NK 4Q5SA 1IW7A 2JA8C 1ZYRA 2O5IA 2NVQK 2A6EA 1TWGK 5C3EC 2JA5C 2PA8L 2Y0SL 4BY7C 4KN7A 5FJ8K 5FLMK 3PO3K 5IYDC 2CW0A 2R7ZK 3RZOC 2WB1L 4A3IC 2JA6K 3S1MK 2JA7C 4G7ZA 2VUMC 3HOZK 5M5WK 1SFOK 4A3CC 4A3DC 4A3MC 2E2IC 2E2HC 4GZYA 3RZDK 1TWHC 4XLPA 3GTLK 3HOWK 3GTMK 4AYBL 4A3JC 3HOUC 3S16K 4A3JK 4A3KK 3HOYC 1I3QC 1TWAC 4XLNA 3S1NC 3GTGC 1BDFA 3GTKK 5IP7K 4BY1K 4A3EK 4YFKA 4QJVB 1Y1WC 1TWFC 1WCMK 3K7AK 5M5YK 3S15K 3GTPK 3H0GC 5IP9C 3I4NC 3HKZL 3HOVK 1I50K 2NVQC 4BBSK 2A69A 5TMFA 1TWGC 3GTJK 1Y1VK 4MEXA 4BXXK 3S1QK 4X6AK 5FLMC 4Y7NK 3PO3C 4C3JK 5C44K 3S1RK 4YFNA 3FKIK 2B63K 2R7ZC 2JA6C 3HOXK 3S1MC 3GTQK 3HOZC 1SFOC 1YNJA 4BBRK 3RZDC 4A3DK 4QIWD 3GTLC 2PPBA 3CQZK 3HOWC 2R92K 1R9TK 3GTMC 3H3VD 3S16C 3S14K 3M4OK 4A3LK 4Y52K 1I6HK 4A3KC 4A3FK 3GTKC 5IP7C 5C4XK 4A3EC 2NVXK 4BY1C 4OIRA 4A3GK 2YU9K 1WCMC 3K7AC 2WAQD 3M3YK 3S15C 3GTPC 5C4JK 4MQ9A 4XSXA 3HOVC 1I50C 4BBSC 4OIOA 1HQMA 3GTJC 1Y1VC 4X6AC 3PO2K 4XSZA 4C2MK 3S1QC 4BXXC 4KMUA 3I4MK 4Y7NC 3S17K 4NOIA 5C44C 3S1RC 1K83K 3FKIC 4QIWL 4YG2A 2B63C 2A6HA 3HOXC 3H3VL 2E2JK 2R93K 3GTQC 4A93K 4G7OA 5M5XK 1TWCK 4BBRC 5IYBK 3GTOK 2NVYK 5IYCC 3S2DK 2O5JA 3CQZC 2WAQL 5IYCK 1YNNA 1R9TC 2R92C 4Y52C 2NVTK 3S14C 1Y1WK 3M4OC 4ZH4A 4A3LC 3S2HK 1I6HC 2PMZD 4A3FC 5C4XC 4QJVA 5D4DA 2NVXC 4LK0A 3WODA 4OINA 3EQLA 4LJZA 2YU9C 4OIQA 4A3BK 4YFXA 3M3YC 4A3GC 4C3IK 5C4JC 2JA8K 5M3MK 4JK1A 5C3EK 2JA5K 4G7HA 4LK1A 4BY7K 3PO2C 4Q4ZA 3HKZD 3I4MC 3S17C 5IYDK 3RZOK 1K83C 1XPPA 4A3IK 2JA7K 2R93C 2BE5A 4KN4A 2E2JC 2PA8D 1I6VA 3DXJA 2VUMK 5M3FK 4A3CK 4A93C 2Y0SD 4C3HK 4A3MK 2PMZL 2E2IK 4OIPA 2E2HK 1TWCC 5IYBC 3GTOC 1TWHK 2NVYC 2WB1D 3S2DC 4MEYA 2A68A 3HOUK 2NVTC 3HOYK 1I3QK 1TWAK 3S1NK 3S2HC 3GTGK 5TMCA 4LLGA
chains in the Genus database with same CATH superfamily
4A3BC 1O27A 3H0GK 4LQYA 4AYBD 1IW7A 2PHCB 2O5IA 1YCLA 3OPFA 4AH6A 4BY7C 5FJ8K 1VGXA 1WORA 5IYDC 3RZOC 3T02A 4GTBA 4G7ZA 3HOZK 4A3MC 4BKWA 1TWHC 4XLPA 1DCHA 3HOUC 3S16K 4KM8A 4A3JK 1J6VA 1I3QC 4J3NA 1TWHA 2CFAB 1XXCA 1VRQC 3K7AK 1WOSA 3I4NC 1I3QA 4GFQA 1TWGC 3TFIA 5FLMC 5IOQA 4Y7NK 5L46A 1XXBA 1TWGA 3S1MC 3S0XA 1SFOC 1IQ0A 1ZXOA 1WOPA 1PJ7A 3BUEA 1YNJA 1BGWA 2V6SA 4QIWD 3GTLC 3GTMC 1SFOA 1G51A 1IL2A 3GTLA 4A3EC 1INNA 4OIRA 3GTMA 1ISEA 1WCMC 3S15C 4MQ9A 4XSXA 3HOVC 1I50C 1WCMA 4XSZA 1VJEA 3S1QC 4GT9A 4KMUA 1O25A 4KB4A 1I50A 4YG2A 4WJ4A 1IBAA 5IYBK 1VH2A 5IOTA 3CQZC 3FOEA 1YNNA 4GTDA 1XZPA 3S14C 3M4OC 1I6HC 3BP3A 3FOFA 4A3FC 1EI6A 4QJVA 3CQZA 4A3GC 1V5VA 2YU9C 4C3IK 5C4JC 5M3MK 4JK1A 1IS1A 5C3EK 2FQOA 3Q3QA 4BLAA 4G7HA 1XXAA 2YU9A 4LK1A 3PO2C 4KM9A 4O2DA 2JA7K 2R93C 4A3DK 1PJ5A 4C3HK 2PMZL 2E2IK 3SZZA 2R93A 1O24A 1WQFA 3S2DC 4MEYA 2A68A 3S2HC 5TMCA 1UV7A 3VA7A 1TWFK 1WQGA 5IP9K 1KQ4A 4Q5SA 4GTCA 1DCOA 1EK8A 2JA5C 2P8TA 1XZQA 4KN7A 1DD5A 3ADAC 2EBBA 2CW0A 2R7ZK 2JA5A 2ZFZA 1RU0A 2VUMC 5M5WK 4A3CC 4DDQA 1WSVA 3AD9C 3HOWK 2VUMA 4FM9A 4A3JC 4A3KK 1YX2A 3GTGC 4BY1K 2D6FC 3AD8C 5M5YK 3GTGA 4BBSK 2NVQC 2A69A 5TMFA 5IOSA 3GTJK 1Y1VK 4X6AK 4BXXK 3PO3C 4C3JK 5C44K 1DCPA 3S1RK 2B63K 2JA6C 3CAGA 1WOOA 3A8KA 3RZDC 2JA6A 2ZUFA 2R92K 1R9TK 4GTLA 4Y52K 4G0WA 3GTKC 5IP7C 2NVXK 1O2BA 3SZYA 3GTPC 3LAPA 3GDZA 3BP8C 3GTKA 4OIOA 5JFEA 4KMDA 3LPXA 3GTPA 3S17K 3FKIC 1EH1A 4G0VA 4KC6A 3HOXC 2GSNA 3H3VL 3GTQC 4A93K 4G7OA 4KDDA 5M5XK 1TWCK 3FKIA 4BBRC 3GTQA 2NVTK 4A3LC 1ZQ1C 4ZH4A 2PMZD 2CFAA 1USMA 5C4XC 1O29A 4A3BK 4YFXA 3M3YC 2JH3A 4BY7K 4C2MC 3I4MC 3HKZD 5IYDK 3RZOK 1K83C 1XPPA 4KASA 2GSOA 3TFJA 4KN4A 2E2JC 4LR2A 3DXJA 5M3FK 1O2FB 4A3MK 4OIPA 2RH6A 1K83A 3GTOC 1TWHK 2NVYC 1BJTA 3HOUK 3T01A 2W7VA 1EFWA 1I3QK 1GE9A 5HL8A 1L0WA 3GTOA 2NVYA 4LLGA 3I4NK 3N3YA 2JA8C 2XCRB 2A6EA 1O2AA 1TWGK 4P5BA 1BS2A 5FLMK 4P5AA 4A3IC 1O26A 3S1MK 1SFOK 4LOWA 4P9SA 1J6XA 3OEPA 2E2HC 2P5MA 3GTLK 3GTMK 3HOYC 2E2HA 1TWAC 3L4KA 3S1NC 1BDFA 4A3EK 4YFKA 1Y1WC 1WCMK 3S15K 3H0GC 3HKZL 1TWAA 4GTFA 3HOVK 1I50K 1ZVUA 1Y1WA 1IE0A 4M1XA 4GTEA 3S1QK 3H0GA 4YFNA 3IPJA 1WSRA 2FQTA 3HOZC 3AD7C 3GEHA 4XCHA 2PPBA 3CQZK 3H3VD 3S16C 3S14K 3M4OK 1I6HK 1X31C 4A3FK 3JSTA 4A3GK 4WJ3M 2YU9K 3K7AC 3GEEA 2ZUEA 3FHZA 5C4JK 3AQOA 3OREA 2KWAA 5EGHA 1HQMA 2V6UA 3PO2K 4Y7NC 4NOIA 3A8IA 1WIHA 2A6HA 2R93K 5IORA 1F7VA 4KMAA 3S2DK 2O5JA 2WAQL 3NUHA 5IYCK 4BLBA 1VLOA 2GAHC 1JOEA 3S2HK 4LK0A 3GIRA 1AB4A 4LJZA 4OIQA 4KATA 2Y3PA 3N0BA 2JA5K 1USOA 1PJ6A 2BE5A 3GEIA 3HXAA 2VUMK 1I6VA 4A3CK 1F7UA 5IYBC 4PABA 4C45A 3GTGK 1O28A 1SMYA 4C3IC 1ZYRA 2NVQK 5C3EC 2PA8L 2Y0SL 3T00A 3PO3K 2WB1L 2JA6K 2JA7C 4A3DC 5JVOA 4C3HC 1J98A 4KB2A 2E2IC 4GZYA 3RZDK 2JA7A 4AYBL 1XZPB 2E2IA 4XLNA 1EQRA 3ERED 3GTKK 5IP7K 4QJVB 1TWFC 3G4CA 3GTPK 5IP9C 2V6TA 2GAGC 1B4BA 1TWFA 4MEXA 5CHPA 4KAWX 3N0CA 3AH5A 3FKIK 2R7ZC 3HOXK 4GTAA 4KARA 3GTQK 1ZBSA 1J6WA 4BBRK 2R7ZA 4WILA 3V4GA 3HOWC 4A3LK 4A3KC 1B4AA 5E68A 4BY1C 5C4XK 2GSUA 4G0UA 2WAQD 3M3YK 4PAAA 3QX3A 4BBSC 3GTJC 1JQWA 3AQPA 1Y1VC 4FZBA 4BXXC 1XZQB 3G4AA 4C2MK 2RGRA 3I4MK 4X6AC 4C3JC 5C44C 3S1RC 3TFHA 1K83K 4QIWL 2B63C 2XCQA 3GTJA 2E2JK 1Y1VA 2XCOA 4KMHA 3LAJA 1F9NA 5CJ9A 3GTOK 2B63A 3L4JA 2NVYK 5IYCC 2R92C 1R9TC 4Y52C 3TTGA 3A8JA 1JVIA 1C0AA 4ILDA 2NVXC 5D4DA 3WODA 4OINA 1R9TA 3EQLA 2R92A 1F93A 2JA8K 2NVXA 1WQHA 4RMFA 3GSIA 3MMLB 4Q4ZA 3S17C 4A3IK 2PA8D 4A93C 2Y0SD 2E2HK 1TWCC 5TJ3A 5EGEA 2WB1D 2NVTC 3HOYK 1TWAK 3S1NK 1TWCA 1Y1WK 1HI9A
chains in the Genus database with same CATH topology
1TWFK 4A3BC 1SMYA 3H0GK 5IP9K 4AYBD 3I4NK 4Q5SA 1IW7A 2JA8C 1ZYRA 2O5IA 2NVQK 2A6EA 1TWGK 5C3EC 2JA5C 2PA8L 2Y0SL 4BY7C 4KN7A 5FJ8K 5FLMK 3PO3K 5IYDC 2CW0A 2R7ZK 3RZOC 2WB1L 4A3IC 2JA6K 3S1MK 2JA7C 4G7ZA 2VUMC 3HOZK 5M5WK 1SFOK 4A3CC 4A3DC 4A3MC 2E2IC 2E2HC 4GZYA 3RZDK 1TWHC 4XLPA 3GTLK 3HOWK 3GTMK 4AYBL 4A3JC 3HOUC 3S16K 4A3JK 4A3KK 3HOYC 1I3QC 1TWAC 4XLNA 3S1NC 3GTGC 1BDFA 3GTKK 5IP7K 4BY1K 4A3EK 4YFKA 4QJVB 1Y1WC 1TWFC 1WCMK 3K7AK 5M5YK 3S15K 3GTPK 3H0GC 5IP9C 3I4NC 3HKZL 3HOVK 1I50K 2NVQC 4BBSK 2A69A 5TMFA 1TWGC 3GTJK 1Y1VK 4MEXA 4BXXK 3S1QK 4X6AK 5FLMC 4Y7NK 3PO3C 4C3JK 5C44K 3S1RK 4YFNA 3FKIK 2B63K 2R7ZC 2JA6C 3HOXK 3S1MC 3GTQK 3HOZC 1SFOC 1YNJA 4BBRK 3RZDC 4A3DK 4QIWD 3GTLC 2PPBA 3CQZK 3HOWC 2R92K 1R9TK 3GTMC 3H3VD 3S16C 3S14K 3M4OK 4A3LK 4Y52K 1I6HK 4A3KC 4A3FK 3GTKC 5IP7C 5C4XK 4A3EC 2NVXK 4BY1C 4OIRA 4A3GK 2YU9K 1WCMC 3K7AC 2WAQD 3M3YK 3S15C 3GTPC 5C4JK 4MQ9A 4XSXA 3HOVC 1I50C 4BBSC 4OIOA 1HQMA 3GTJC 1Y1VC 4X6AC 3PO2K 4XSZA 4C2MK 3S1QC 4BXXC 4KMUA 3I4MK 4Y7NC 3S17K 4NOIA 5C44C 3S1RC 1K83K 3FKIC 4QIWL 4YG2A 2B63C 2A6HA 3HOXC 3H3VL 2E2JK 2R93K 3GTQC 4A93K 4G7OA 5M5XK 1TWCK 4BBRC 5IYBK 3GTOK 2NVYK 5IYCC 3S2DK 2O5JA 3CQZC 2WAQL 5IYCK 1YNNA 1R9TC 2R92C 4Y52C 2NVTK 3S14C 1Y1WK 3M4OC 4ZH4A 4A3LC 3S2HK 1I6HC 2PMZD 4A3FC 5C4XC 4QJVA 5D4DA 2NVXC 4LK0A 3WODA 4OINA 3EQLA 4LJZA 2YU9C 4OIQA 4A3BK 4YFXA 3M3YC 4A3GC 4C3IK 5C4JC 2JA8K 5M3MK 4JK1A 5C3EK 2JA5K 4G7HA 4LK1A 4BY7K 3PO2C 4Q4ZA 3HKZD 3I4MC 3S17C 5IYDK 3RZOK 1K83C 1XPPA 4A3IK 2JA7K 2R93C 2BE5A 4KN4A 2E2JC 2PA8D 1I6VA 3DXJA 2VUMK 5M3FK 4A3CK 4A93C 2Y0SD 4C3HK 4A3MK 2PMZL 2E2IK 4OIPA 2E2HK 1TWCC 5IYBC 3GTOC 1TWHK 2NVYC 2WB1D 3S2DC 4MEYA 2A68A 3HOUK 2NVTC 3HOYK 1I3QK 1TWAK 3S1NK 3S2HC 3GTGK 5TMCA 4LLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF K;  4A3B C;  1SMY A;  3H0G K;  5IP9 K;  4AYB D;  3I4N K;  4Q5S A;  1IW7 A;  2JA8 C;  1ZYR A;  2O5I A;  2NVQ K;  2A6E A;  1TWG K;  5C3E C;  2JA5 C;  2PA8 L;  2Y0S L;  4BY7 C;  4KN7 A;  5FJ8 K;  5FLM K;  3PO3 K;  5IYD C;  2CW0 A;  2R7Z K;  3RZO C;  2WB1 L;  4A3I C;  2JA6 K;  3S1M K;  2JA7 C;  4G7Z A;  2VUM C;  3HOZ K;  5M5W K;  1SFO K;  4A3C C;  4A3D C;  4A3M C;  2E2I C;  2E2H C;  4GZY A;  3RZD K;  1TWH C;  4XLP A;  3GTL K;  3HOW K;  3GTM K;  4AYB L;  4A3J C;  3HOU C;  3S16 K;  4A3J K;  4A3K K;  3HOY C;  1I3Q C;  1TWA C;  4XLN A;  3S1N C;  3GTG C;  1BDF A;  3GTK K;  5IP7 K;  4BY1 K;  4A3E K;  4YFK A;  4QJV B;  1Y1W C;  1TWF C;  1WCM K;  3K7A K;  5M5Y K;  3S15 K;  3GTP K;  3H0G C;  5IP9 C;  3I4N C;  3HKZ L;  3HOV K;  1I50 K;  2NVQ C;  4BBS K;  2A69 A;  5TMF A;  1TWG C;  3GTJ K;  1Y1V K;  4MEX A;  4BXX K;  3S1Q K;  4X6A K;  5FLM C;  4Y7N K;  3PO3 C;  4C3J K;  5C44 K;  3S1R K;  4YFN A;  3FKI K;  2B63 K;  2R7Z C;  2JA6 C;  3HOX K;  3S1M C;  3GTQ K;  3HOZ C;  1SFO C;  1YNJ A;  4BBR K;  3RZD C;  4A3D K;  4QIW D;  3GTL C;  2PPB A;  3CQZ K;  3HOW C;  2R92 K;  1R9T K;  3GTM C;  3H3V D;  3S16 C;  3S14 K;  3M4O K;  4A3L K;  4Y52 K;  1I6H K;  4A3K C;  4A3F K;  3GTK C;  5IP7 C;  5C4X K;  4A3E C;  2NVX K;  4BY1 C;  4OIR A;  4A3G K;  2YU9 K;  1WCM C;  3K7A C;  2WAQ D;  3M3Y K;  3S15 C;  3GTP C;  5C4J K;  4MQ9 A;  4XSX A;  3HOV C;  1I50 C;  4BBS C;  4OIO A;  1HQM A;  3GTJ C;  1Y1V C;  4X6A C;  3PO2 K;  4XSZ A;  4C2M K;  3S1Q C;  4BXX C;  4KMU A;  3I4M K;  4Y7N C;  3S17 K;  4NOI A;  5C44 C;  3S1R C;  1K83 K;  3FKI C;  4QIW L;  4YG2 A;  2B63 C;  2A6H A;  3HOX C;  3H3V L;  2E2J K;  2R93 K;  3GTQ C;  4A93 K;  4G7O A;  5M5X K;  1TWC K;  4BBR C;  5IYB K;  3GTO K;  2NVY K;  5IYC C;  3S2D K;  2O5J A;  3CQZ C;  2WAQ L;  5IYC K;  1YNN A;  1R9T C;  2R92 C;  4Y52 C;  2NVT K;  3S14 C;  1Y1W K;  3M4O C;  4ZH4 A;  4A3L C;  3S2H K;  1I6H C;  2PMZ D;  4A3F C;  5C4X C;  4QJV A;  5D4D A;  2NVX C;  4LK0 A;  3WOD A;  4OIN A;  3EQL A;  4LJZ A;  2YU9 C;  4OIQ A;  4A3B K;  4YFX A;  3M3Y C;  4A3G C;  4C3I K;  5C4J C;  2JA8 K;  5M3M K;  4JK1 A;  5C3E K;  2JA5 K;  4G7H A;  4LK1 A;  4BY7 K;  3PO2 C;  4Q4Z A;  3HKZ D;  3I4M C;  3S17 C;  5IYD K;  3RZO K;  1K83 C;  1XPP A;  4A3I K;  2JA7 K;  2R93 C;  2BE5 A;  4KN4 A;  2E2J C;  2PA8 D;  1I6V A;  3DXJ A;  2VUM K;  5M3F K;  4A3C K;  4A93 C;  2Y0S D;  4C3H K;  4A3M K;  2PMZ L;  2E2I K;  4OIP A;  2E2H K;  1TWC C;  5IYB C;  3GTO C;  1TWH K;  2NVY C;  2WB1 D;  3S2D C;  4MEY A;  2A68 A;  3HOU K;  2NVT C;  3HOY K;  1I3Q K;  1TWA K;  3S1N K;  3S2H C;  3GTG K;  5TMC A;  4LLG A; 
#chains in the Genus database with same CATH topology
 4A3B C;  1O27 A;  3H0G K;  4LQY A;  4AYB D;  1IW7 A;  2PHC B;  2O5I A;  1YCL A;  3OPF A;  4AH6 A;  4BY7 C;  5FJ8 K;  1VGX A;  1WOR A;  5IYD C;  3RZO C;  3T02 A;  4GTB A;  4G7Z A;  3HOZ K;  4A3M C;  4BKW A;  1TWH C;  4XLP A;  1DCH A;  3HOU C;  3S16 K;  4KM8 A;  4A3J K;  1J6V A;  1I3Q C;  4J3N A;  1TWH A;  2CFA B;  1XXC A;  1VRQ C;  3K7A K;  1WOS A;  3I4N C;  1I3Q A;  4GFQ A;  1TWG C;  3TFI A;  5FLM C;  5IOQ A;  4Y7N K;  5L46 A;  1XXB A;  1TWG A;  3S1M C;  3S0X A;  1SFO C;  1IQ0 A;  1ZXO A;  1WOP A;  1PJ7 A;  3BUE A;  1YNJ A;  1BGW A;  2V6S A;  4QIW D;  3GTL C;  3GTM C;  1SFO A;  1G51 A;  1IL2 A;  3GTL A;  4A3E C;  1INN A;  4OIR A;  3GTM A;  1ISE A;  1WCM C;  3S15 C;  4MQ9 A;  4XSX A;  3HOV C;  1I50 C;  1WCM A;  4XSZ A;  1VJE A;  3S1Q C;  4GT9 A;  4KMU A;  1O25 A;  4KB4 A;  1I50 A;  4YG2 A;  4WJ4 A;  1IBA A;  5IYB K;  1VH2 A;  5IOT A;  3CQZ C;  3FOE A;  1YNN A;  4GTD A;  1XZP A;  3S14 C;  3M4O C;  1I6H C;  3BP3 A;  3FOF A;  4A3F C;  1EI6 A;  4QJV A;  3CQZ A;  4A3G C;  1V5V A;  2YU9 C;  4C3I K;  5C4J C;  5M3M K;  4JK1 A;  1IS1 A;  5C3E K;  2FQO A;  3Q3Q A;  4BLA A;  4G7H A;  1XXA A;  2YU9 A;  4LK1 A;  3PO2 C;  4KM9 A;  4O2D A;  2JA7 K;  2R93 C;  4A3D K;  1PJ5 A;  4C3H K;  2PMZ L;  2E2I K;  3SZZ A;  2R93 A;  1O24 A;  1WQF A;  3S2D C;  4MEY A;  2A68 A;  3S2H C;  5TMC A;  1UV7 A;  3VA7 A;  1TWF K;  1WQG A;  5IP9 K;  1KQ4 A;  4Q5S A;  4GTC A;  1DCO A;  1EK8 A;  2JA5 C;  2P8T A;  1XZQ A;  4KN7 A;  1DD5 A;  3ADA C;  2EBB A;  2CW0 A;  2R7Z K;  2JA5 A;  2ZFZ A;  1RU0 A;  2VUM C;  5M5W K;  4A3C C;  4DDQ A;  1WSV A;  3AD9 C;  3HOW K;  2VUM A;  4FM9 A;  4A3J C;  4A3K K;  1YX2 A;  3GTG C;  4BY1 K;  2D6F C;  3AD8 C;  5M5Y K;  3GTG A;  4BBS K;  2NVQ C;  2A69 A;  5TMF A;  5IOS A;  3GTJ K;  1Y1V K;  4X6A K;  4BXX K;  3PO3 C;  4C3J K;  5C44 K;  1DCP A;  3S1R K;  2B63 K;  2JA6 C;  3CAG A;  1WOO A;  3A8K A;  3RZD C;  2JA6 A;  2ZUF A;  2R92 K;  1R9T K;  4GTL A;  4Y52 K;  4G0W A;  3GTK C;  5IP7 C;  2NVX K;  1O2B A;  3SZY A;  3GTP C;  3LAP A;  3GDZ A;  3BP8 C;  3GTK A;  4OIO A;  5JFE A;  4KMD A;  3LPX A;  3GTP A;  3S17 K;  3FKI C;  1EH1 A;  4G0V A;  4KC6 A;  3HOX C;  2GSN A;  3H3V L;  3GTQ C;  4A93 K;  4G7O A;  4KDD A;  5M5X K;  1TWC K;  3FKI A;  4BBR C;  3GTQ A;  2NVT K;  4A3L C;  1ZQ1 C;  4ZH4 A;  2PMZ D;  2CFA A;  1USM A;  5C4X C;  1O29 A;  4A3B K;  4YFX A;  3M3Y C;  2JH3 A;  4BY7 K;  4C2M C;  3I4M C;  3HKZ D;  5IYD K;  3RZO K;  1K83 C;  1XPP A;  4KAS A;  2GSO A;  3TFJ A;  4KN4 A;  2E2J C;  4LR2 A;  3DXJ A;  5M3F K;  1O2F B;  4A3M K;  4OIP A;  2RH6 A;  1K83 A;  3GTO C;  1TWH K;  2NVY C;  1BJT A;  3HOU K;  3T01 A;  2W7V A;  1EFW A;  1I3Q K;  1GE9 A;  5HL8 A;  1L0W A;  3GTO A;  2NVY A;  4LLG A;  3I4N K;  3N3Y A;  2JA8 C;  2XCR B;  2A6E A;  1O2A A;  1TWG K;  4P5B A;  1BS2 A;  5FLM K;  4P5A A;  4A3I C;  1O26 A;  3S1M K;  1SFO K;  4LOW A;  4P9S A;  1J6X A;  3OEP A;  2E2H C;  2P5M A;  3GTL K;  3GTM K;  3HOY C;  2E2H A;  1TWA C;  3L4K A;  3S1N C;  1BDF A;  4A3E K;  4YFK A;  1Y1W C;  1WCM K;  3S15 K;  3H0G C;  3HKZ L;  1TWA A;  4GTF A;  3HOV K;  1I50 K;  1ZVU A;  1Y1W A;  1IE0 A;  4M1X A;  4GTE A;  3S1Q K;  3H0G A;  4YFN A;  3IPJ A;  1WSR A;  2FQT A;  3HOZ C;  3AD7 C;  3GEH A;  4XCH A;  2PPB A;  3CQZ K;  3H3V D;  3S16 C;  3S14 K;  3M4O K;  1I6H K;  1X31 C;  4A3F K;  3JST A;  4A3G K;  4WJ3 M;  2YU9 K;  3K7A C;  3GEE A;  2ZUE A;  3FHZ A;  5C4J K;  3AQO A;  3ORE A;  2KWA A;  5EGH A;  1HQM A;  2V6U A;  3PO2 K;  4Y7N C;  4NOI A;  3A8I A;  1WIH A;  2A6H A;  2R93 K;  5IOR A;  1F7V A;  4KMA A;  3S2D K;  2O5J A;  2WAQ L;  3NUH A;  5IYC K;  4BLB A;  1VLO A;  2GAH C;  1JOE A;  3S2H K;  4LK0 A;  3GIR A;  1AB4 A;  4LJZ A;  4OIQ A;  4KAT A;  2Y3P A;  3N0B A;  2JA5 K;  1USO A;  1PJ6 A;  2BE5 A;  3GEI A;  3HXA A;  2VUM K;  1I6V A;  4A3C K;  1F7U A;  5IYB C;  4PAB A;  4C45 A;  3GTG K;  1O28 A;  1SMY A;  4C3I C;  1ZYR A;  2NVQ K;  5C3E C;  2PA8 L;  2Y0S L;  3T00 A;  3PO3 K;  2WB1 L;  2JA6 K;  2JA7 C;  4A3D C;  5JVO A;  4C3H C;  1J98 A;  4KB2 A;  2E2I C;  4GZY A;  3RZD K;  2JA7 A;  4AYB L;  1XZP B;  2E2I A;  4XLN A;  1EQR A;  3ERE D;  3GTK K;  5IP7 K;  4QJV B;  1TWF C;  3G4C A;  3GTP K;  5IP9 C;  2V6T A;  2GAG C;  1B4B A;  1TWF A;  4MEX A;  5CHP A;  4KAW X;  3N0C A;  3AH5 A;  3FKI K;  2R7Z C;  3HOX K;  4GTA A;  4KAR A;  3GTQ K;  1ZBS A;  1J6W A;  4BBR K;  2R7Z A;  4WIL A;  3V4G A;  3HOW C;  4A3L K;  4A3K C;  1B4A A;  5E68 A;  4BY1 C;  5C4X K;  2GSU A;  4G0U A;  2WAQ D;  3M3Y K;  4PAA A;  3QX3 A;  4BBS C;  3GTJ C;  1JQW A;  3AQP A;  1Y1V C;  4FZB A;  4BXX C;  1XZQ B;  3G4A A;  4C2M K;  2RGR A;  3I4M K;  4X6A C;  4C3J C;  5C44 C;  3S1R C;  3TFH A;  1K83 K;  4QIW L;  2B63 C;  2XCQ A;  3GTJ A;  2E2J K;  1Y1V A;  2XCO A;  4KMH A;  3LAJ A;  1F9N A;  5CJ9 A;  3GTO K;  2B63 A;  3L4J A;  2NVY K;  5IYC C;  2R92 C;  1R9T C;  4Y52 C;  3TTG A;  3A8J A;  1JVI A;  1C0A A;  4ILD A;  2NVX C;  5D4D A;  3WOD A;  4OIN A;  1R9T A;  3EQL A;  2R92 A;  1F93 A;  2JA8 K;  2NVX A;  1WQH A;  4RMF A;  3GSI A;  3MML B;  4Q4Z A;  3S17 C;  4A3I K;  2PA8 D;  4A93 C;  2Y0S D;  2E2H K;  1TWC C;  5TJ3 A;  5EGE A;  2WB1 D;  2NVT C;  3HOY K;  1TWA K;  3S1N K;  1TWC A;  1Y1W K;  1HI9 A; 
#chains in the Genus database with same CATH homology
 1TWF K;  4A3B C;  1SMY A;  3H0G K;  5IP9 K;  4AYB D;  3I4N K;  4Q5S A;  1IW7 A;  2JA8 C;  1ZYR A;  2O5I A;  2NVQ K;  2A6E A;  1TWG K;  5C3E C;  2JA5 C;  2PA8 L;  2Y0S L;  4BY7 C;  4KN7 A;  5FJ8 K;  5FLM K;  3PO3 K;  5IYD C;  2CW0 A;  2R7Z K;  3RZO C;  2WB1 L;  4A3I C;  2JA6 K;  3S1M K;  2JA7 C;  4G7Z A;  2VUM C;  3HOZ K;  5M5W K;  1SFO K;  4A3C C;  4A3D C;  4A3M C;  2E2I C;  2E2H C;  4GZY A;  3RZD K;  1TWH C;  4XLP A;  3GTL K;  3HOW K;  3GTM K;  4AYB L;  4A3J C;  3HOU C;  3S16 K;  4A3J K;  4A3K K;  3HOY C;  1I3Q C;  1TWA C;  4XLN A;  3S1N C;  3GTG C;  1BDF A;  3GTK K;  5IP7 K;  4BY1 K;  4A3E K;  4YFK A;  4QJV B;  1Y1W C;  1TWF C;  1WCM K;  3K7A K;  5M5Y K;  3S15 K;  3GTP K;  3H0G C;  5IP9 C;  3I4N C;  3HKZ L;  3HOV K;  1I50 K;  2NVQ C;  4BBS K;  2A69 A;  5TMF A;  1TWG C;  3GTJ K;  1Y1V K;  4MEX A;  4BXX K;  3S1Q K;  4X6A K;  5FLM C;  4Y7N K;  3PO3 C;  4C3J K;  5C44 K;  3S1R K;  4YFN A;  3FKI K;  2B63 K;  2R7Z C;  2JA6 C;  3HOX K;  3S1M C;  3GTQ K;  3HOZ C;  1SFO C;  1YNJ A;  4BBR K;  3RZD C;  4A3D K;  4QIW D;  3GTL C;  2PPB A;  3CQZ K;  3HOW C;  2R92 K;  1R9T K;  3GTM C;  3H3V D;  3S16 C;  3S14 K;  3M4O K;  4A3L K;  4Y52 K;  1I6H K;  4A3K C;  4A3F K;  3GTK C;  5IP7 C;  5C4X K;  4A3E C;  2NVX K;  4BY1 C;  4OIR A;  4A3G K;  2YU9 K;  1WCM C;  3K7A C;  2WAQ D;  3M3Y K;  3S15 C;  3GTP C;  5C4J K;  4MQ9 A;  4XSX A;  3HOV C;  1I50 C;  4BBS C;  4OIO A;  1HQM A;  3GTJ C;  1Y1V C;  4X6A C;  3PO2 K;  4XSZ A;  4C2M K;  3S1Q C;  4BXX C;  4KMU A;  3I4M K;  4Y7N C;  3S17 K;  4NOI A;  5C44 C;  3S1R C;  1K83 K;  3FKI C;  4QIW L;  4YG2 A;  2B63 C;  2A6H A;  3HOX C;  3H3V L;  2E2J K;  2R93 K;  3GTQ C;  4A93 K;  4G7O A;  5M5X K;  1TWC K;  4BBR C;  5IYB K;  3GTO K;  2NVY K;  5IYC C;  3S2D K;  2O5J A;  3CQZ C;  2WAQ L;  5IYC K;  1YNN A;  1R9T C;  2R92 C;  4Y52 C;  2NVT K;  3S14 C;  1Y1W K;  3M4O C;  4ZH4 A;  4A3L C;  3S2H K;  1I6H C;  2PMZ D;  4A3F C;  5C4X C;  4QJV A;  5D4D A;  2NVX C;  4LK0 A;  3WOD A;  4OIN A;  3EQL A;  4LJZ A;  2YU9 C;  4OIQ A;  4A3B K;  4YFX A;  3M3Y C;  4A3G C;  4C3I K;  5C4J C;  2JA8 K;  5M3M K;  4JK1 A;  5C3E K;  2JA5 K;  4G7H A;  4LK1 A;  4BY7 K;  3PO2 C;  4Q4Z A;  3HKZ D;  3I4M C;  3S17 C;  5IYD K;  3RZO K;  1K83 C;  1XPP A;  4A3I K;  2JA7 K;  2R93 C;  2BE5 A;  4KN4 A;  2E2J C;  2PA8 D;  1I6V A;  3DXJ A;  2VUM K;  5M3F K;  4A3C K;  4A93 C;  2Y0S D;  4C3H K;  4A3M K;  2PMZ L;  2E2I K;  4OIP A;  2E2H K;  1TWC C;  5IYB C;  3GTO C;  1TWH K;  2NVY C;  2WB1 D;  3S2D C;  4MEY A;  2A68 A;  3HOU K;  2NVT C;  3HOY K;  1I3Q K;  1TWA K;  3S1N K;  3S2H C;  3GTG K;  5TMC A;  4LLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...