3HOXK

Complete rna polymerase ii elongation complex v
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoxK00
2PMZD 4QIWD 3WODA 4Q4ZA 1TWGK 3GTJK 3HOVK 5C44C 4BBSC 1HQMA 1WCMC 2BE5A 3HKZL 5C3EK 4A3KC 1Y1VC 4XLPA 1Y1WK 4A3BC 5IYDC 2WB1D 1IW7A 3HOXK 3I4NC 4A3BK 3FKIC 5M3MK 2Y0SL 3K7AC 4OIPA 4A3CC 4A3KK 4KN4A 3HOYC 3HOUC 4BBRC 4G7OA 2NVQC 4YFNA 5TMCA 4JK1A 3GTLC 3S1NC 2NVQK 5C4JK 4OIRA 3GTMK 3HOZK 3HKZD 2JA7K 4G7ZA 3PO2K 2A6HA 3DXJA 3FKIK 4AYBD 3GTGK 1TWCC 1ZYRA 1Y1WC 2E2IK 2O5JA 3RZDK 2WAQL 5C3EC 4GZYA 4C3IK 2JA8C 1YNJA 1XPPA 2R92C 3PO3C 4OIQA 2A68A 2NVXK 3S2HC 5IYBC 4XLNA 4AYBL 1R9TK 1I50C 2Y0SD 2R7ZK 1TWAC 3S2DC 4YFKA 2R93K 5M5YK 4Y7NC 4A3IK 2O5IA 1SFOK 3RZDC 3GTOC 3S1RK 2YU9C 1I3QK 2PA8D 5M5WK 3S1RC 5C4XK 4QIWL 3GTQC 2JA6K 1TWGC 3GTJC 4YFXA 2VUMK 3I4MK 5IP9C 4XSZA 2WB1L 4MEXA 3GTKC 2JA5C 5IP9K 2NVXC 3S2HK 4QJVB 4BBRK 5M5XK 3M3YC 3GTQK 5FLMC 3S2DK 3S14C 3S1MK 5C4XC 4LLGA 4C2MK 4A3CK 1I6HK 2WAQD 1K83C 4LJZA 4MEYA 1SFOC 3M3YK 3HOZC 3H3VD 5IYCK 3HOWC 4A3MK 3S15K 4OINA 1R9TC 2NVTC 1SMYA 3M4OC 2B63C 1I6VA 2NVTK 3I4MC 2PPBA 4BY7K 5IP7C 2JA6C 4A3LK 4A3DC 4A3FC 3RZOC 3S1QC 4BXXK 4KMUA 4MQ9A 3GTGC 3H0GK 3I4NK 4X6AC 4BXXC 4X6AK 3S1MC 2A69A 1Y1VK 4A3DK 1BDFA 1WCMK 3EQLA 2E2HK 5IP7K 1TWAK 4BY1C 5C4JC 3GTMC 3HOVC 2NVYK 3S16C 2E2JK 2JA5K 3S1NK 5TMFA 2E2JC 4A3MC 3S15C 2VUMC 3HOUK 3M4OK 4A93K 4C3HK 4C3JK 1K83K 3K7AK 4A3EC 1I6HC 1TWCK 1I3QC 2A6EA 2CW0A 3CQZK 5D4DA 5FJ8K 3HOXC 4Q5SA 2PMZL 4QJVA 4G7HA 4A3JK 2JA7C 4Y7NK 2R7ZC 4BBSK 4A3GK 2B63K 3GTKK 4A3GC 2NVYC 5IYCC 3GTPC 3HOYK 2E2HC 4BY1K 3S16K 2JA8K 4A3JC 2R93C 3S17C 5IYDK 4A3EK 3S14K 4A3FK 4LK0A 3RZOK 3PO2C 5M3FK 5FLMK 4Y52K 4BY7C 4OIOA 3H3VL 4A93C 1TWFK 4NOIA 5IYBK 3GTLK 1TWFC 4KN7A 4LK1A 4XSXA 3HOWK 4YG2A 2R92K 3PO3K 4Y52C 4ZH4A 2E2IC 1TWHK 3CQZC 3H0GC 2YU9K 1TWHC 3S17K 3S1QK 3GTOK 4A3IC 5C44K 1YNNA 4A3LC 3GTPK 1I50K 2PA8L
chains in the Genus database with same CATH superfamily
3WODA 3L4KA 4KMHA 4BBSC 1TWGK 1KQ4A 1WQFA 4LR2A 2BE5A 5C3EK 1WOPA 1HI9A 1Y1WK 4A3BC 5IYDC 1JQWA 2GAGC 1IW7A 4A3CC 4A3KK 1UV7A 2XCQA 3HOYC 3OPFA 3HOUC 3GTGA 4G7OA 2NVQC 4YFNA 3AQPA 3HOZK 2A6HA 4AYBD 1O27A 3GTGK 1WQHA 3ADAC 2E2IK 3HXAA 4G0VA 1DCPA 1EI6A 4C3IK 1I50C 4YFKA 4A3IK 1SFOK 3BP8C 1J98A 1TWGA 4BKWA 3S1RC 4QIWL 2VUMK 4XSZA 3N3YA 2NVXC 3S2HK 3CQZA 5FLMC 4P5BA 3S14C 4C2MK 4KARA 3TFHA 4MEYA 3M4OC 4OINA 4WJ4A 2NVTK 1USMA 4BY7K 1EFWA 2JA6C 1XZPB 2CFAB 1BJTA 1WOOA 5CJ9A 1XXAA 4XCHA 4A3FC 2RGRA 4KMUA 4X6AC 3GTGC 2B63A 3S1MC 1AB4A 4KB4A 1O25A 1TWHA 4DDQA 1F7UA 4PABA 4ILDA 3HOUK 4A93K 3VA7A 3T02A 1DCHA 4C3JK 3MMLB 1L0WA 4A3EC 2VUMA 4J3NA 3HOXC 3GTQA 3S0XA 3LAJA 1I3QA 2R7ZC 4BBSK 1IQ0A 4A3GC 1C0AA 1O2AA 3GEEA 4RMFA 2E2HC 4BY1K 4C3IC 3T00A 4LK0A 3G4AA 4Y52K 2CFAA 2GSOA 4A93C 1TWFK 4NOIA 3GTLK 1X31C 4KN7A 3FKIA 4WJ3M 4Y52C 4ZH4A 3GSIA 2E2IC 1YX2A 3S17K 1USOA 5C44K 4OIRA 2PMZD 3HOVK 1HQMA 3HKZL 4KDDA 3HOXK 4BLBA 4A3BK 3FKIC 2Y0SL 1R9TA 5E68A 1JVIA 1WSRA 4KN4A 3T01A 5TMCA 4JK1A 3FOFA 4PAAA 5IOTA 1EQRA 1WOSA 1XZQB 3DXJA 3ERED 3PO2K 1B4AA 3RZDK 2WAQL 4GZYA 2JA8C 2ZFZA 5HL8A 4OIQA 2A68A 4XLNA 4AYBL 2Y0SD 3AH5A 5M5YK 4Y7NC 2O5IA 2E2HA 3LAPA 3RZDC 3GTOC 4G0UA 1I50A 3GTJA 1I3QK 3JSTA 3GTKA 1ZVUA 1TWGC 4MEXA 3GTOA 4FM9A 5M5XK 3GTQK 3IPJA 2WAQD 1SFOC 1Y1WA 1WIHA 4GTLA 4LQYA 3H0GA 3HOWC 1SMYA 1I6VA 3I4MC 4A3LK 1IE0A 4A3DC 3RZOC 4MQ9A 2P5MA 3I4NK 4X6AK 2A69A 1Y1VK 1SFOA 1WCMK 3A8KA 1BGWA 1TWAK 3S2DK 2R93C 2NVYK 4O2DA 5TMFA 2E2JC 3M4OK 2P8TA 5JFEA 1WCMA 2JH3A 1I6HC 1TWCK 2CW0A 2PMZL 4G7HA 4GTDA 3A8IA 4A3JK 3GEHA 4A3GK 4KASA 1ISEA 3TFJA 5IYCC 3GTPC 3S16K 1J6VA 2GSUA 3Q3QA 4A3EK 5IOSA 3FOEA 5M3FK 2FQTA 1XZQA 4OIOA 4GTAA 3LPXA 4XSXA 1O2BA 2R92K 3GTPA 1IBAA 4P9SA 1F93A 3L4JA 4KAWX 1G51A 2RH6A 3H0GC 2YU9K 3TTGA 3S1QK 3GTOK 4GTEA 1YNNA 4KATA 4GFQA 1VH2A 2PA8L 4QIWD 4Q4ZA 4M1XA 1O28A 4A3KC 2R93A 1DCOA 3I4NC 3K7AC 3G4CA 3S1NC 3HKZD 5EGHA 2R92A 1TWCC 1PJ5A 1YCLA 1ZYRA 2O5JA 3GIRA 1XPPA 3PO3C 2ZUFA 4GT9A 2GSNA 1R9TK 5IORA 1TWAC 1EK8A 2GAHC 1Y1VA 3S2DC 2R93K 2YU9C 2PA8D 4AH6A 4C45A 5C4XK 4KM8A 4GTFA 2V6UA 4FZBA 3GTJC 3BP3A 3I4MK 3SZZA 5IP9C 2WB1L 3GTKC 2JA5C 1TWCA 4BBRK 5C4XC 4A3CK 4BLAA 1K83C 2KWAA 2Y3PA 4LJZA 1DD5A 3H3VD 5IYCK 4A3MK 2PHCB 1R9TC 3AD9C 2EBBA 5IP7C 1VRQC 2JA6A 5CHPA 4BXXK 4G0WA 1J6WA 2XCRB 3S16C 5IP7K 3AD8C 5C4JC 3GTMC 1F9NA 3HOVC 2E2JK 2JA5K 3S15C 1V5VA 4C3HK 1ZXOA 3A8JA 1K83K 2A6EA 3OEPA 4QJVA 1VLOA 4Y7NK 4C3HC 3GTKK 1PJ6A 4GTCA 2NVYC 1GE9A 3HOYK 4KB2A 1WSVA 3S14K 3RZOK 1ZBSA 1XZPA 5IYBK 4LK1A 3OREA 4YG2A 3PO3K 4GTBA 1IS1A 4KMAA 5L46A 1TWHC 3V4GA 2JA7A 1INNA 3SZYA 1BS2A 1K83A 4A3IC 1RU0A 1I50K 3GTJK 5C44C 2NVXA 1WCMC 4KMDA 1Y1VC 4XLPA 2WB1D 5M3MK 5TJ3A 4OIPA 1B4BA 4BBRC 3GTLC 2NVQK 2V6TA 5C4JK 3GTMK 2JA7K 4G7ZA 1J6XA 3FKIK 3CAGA 1Y1WC 3GTLA 1IL2A 5C3EC 1YNJA 2R92C 1PJ7A 2NVXK 3S2HC 5IYBC 2R7ZK 3AD7C 3QX3A 1WORA 3S1RK 5M5WK 1VGXA 4C3JC 3BUEA 3GTQC 2JA6K 5IOQA 2YU9A 4YFXA 5IP9K 4QJVB 3M3YC 4P5AA 2JA5A 3S1MK 4LLGA 2ZUEA 1I6HK 4C2MC 3M3YK 3HOZC 3S15K 2NVTC 2B63C 2PPBA 2XCOA 4WILA 2FQOA 1O29A 3N0BA 3S1QC 3N0CA 3H0GK 1EH1A 4BXXC 3NUHA 4A3DK 2R7ZA 1BDFA 3AQOA 3EQLA 2E2HK 4BY1C 4A3LC 1XXCA 3S1NK 4A3MC 2VUMC 1VJEA 2W7VA 3K7AK 3GEIA 1I3QC 1TWAA 5FJ8K 1TWFA 3CQZK 5D4DA 4Q5SA 2JA7C 4KC6A 1JOEA 2B63K 1O2FB 2JA8K 5JVOA 1XXBA 4LOWA 4A3JC 4KM9A 2V6SA 3S17C 5IYDK 4A3FK 2D6FC 3PO2C 5FLMK 4BY7C 3H3VL 3GDZA 2E2IA 1TWFC 3HOWK 1O24A 2NVYA 1ZQ1C 3FHZA 1O26A 1TWHK 3CQZC 1F7VA 3GTMA 5EGEA 3GTPK 3TFIA 1WQGA
chains in the Genus database with same CATH topology
2PMZD 4QIWD 3WODA 4Q4ZA 1TWGK 3GTJK 3HOVK 5C44C 4BBSC 1HQMA 1WCMC 2BE5A 3HKZL 5C3EK 4A3KC 1Y1VC 4XLPA 1Y1WK 4A3BC 5IYDC 2WB1D 1IW7A 3HOXK 3I4NC 4A3BK 3FKIC 5M3MK 2Y0SL 3K7AC 4OIPA 4A3CC 4A3KK 4KN4A 3HOYC 3HOUC 4BBRC 4G7OA 2NVQC 4YFNA 5TMCA 4JK1A 3GTLC 3S1NC 2NVQK 5C4JK 4OIRA 3GTMK 3HOZK 3HKZD 2JA7K 4G7ZA 3PO2K 2A6HA 3DXJA 3FKIK 4AYBD 3GTGK 1TWCC 1ZYRA 1Y1WC 2E2IK 2O5JA 3RZDK 2WAQL 5C3EC 4GZYA 4C3IK 2JA8C 1YNJA 1XPPA 2R92C 3PO3C 4OIQA 2A68A 2NVXK 3S2HC 5IYBC 4XLNA 4AYBL 1R9TK 1I50C 2Y0SD 2R7ZK 1TWAC 3S2DC 4YFKA 2R93K 5M5YK 4Y7NC 4A3IK 2O5IA 1SFOK 3RZDC 3GTOC 3S1RK 2YU9C 1I3QK 2PA8D 5M5WK 3S1RC 5C4XK 4QIWL 3GTQC 2JA6K 1TWGC 3GTJC 4YFXA 2VUMK 3I4MK 5IP9C 4XSZA 2WB1L 4MEXA 3GTKC 2JA5C 5IP9K 2NVXC 3S2HK 4QJVB 4BBRK 5M5XK 3M3YC 3GTQK 5FLMC 3S2DK 3S14C 3S1MK 5C4XC 4LLGA 4C2MK 4A3CK 1I6HK 2WAQD 1K83C 4LJZA 4MEYA 1SFOC 3M3YK 3HOZC 3H3VD 5IYCK 3HOWC 4A3MK 3S15K 4OINA 1R9TC 2NVTC 1SMYA 3M4OC 2B63C 1I6VA 2NVTK 3I4MC 2PPBA 4BY7K 5IP7C 2JA6C 4A3LK 4A3DC 4A3FC 3RZOC 3S1QC 4BXXK 4KMUA 4MQ9A 3GTGC 3H0GK 3I4NK 4X6AC 4BXXC 4X6AK 3S1MC 2A69A 1Y1VK 4A3DK 1BDFA 1WCMK 3EQLA 2E2HK 5IP7K 1TWAK 4BY1C 5C4JC 3GTMC 3HOVC 2NVYK 3S16C 2E2JK 2JA5K 3S1NK 5TMFA 2E2JC 4A3MC 3S15C 2VUMC 3HOUK 3M4OK 4A93K 4C3HK 4C3JK 1K83K 3K7AK 4A3EC 1I6HC 1TWCK 1I3QC 2A6EA 2CW0A 3CQZK 5D4DA 5FJ8K 3HOXC 4Q5SA 2PMZL 4QJVA 4G7HA 4A3JK 2JA7C 4Y7NK 2R7ZC 4BBSK 4A3GK 2B63K 3GTKK 4A3GC 2NVYC 5IYCC 3GTPC 3HOYK 2E2HC 4BY1K 3S16K 2JA8K 4A3JC 2R93C 3S17C 5IYDK 4A3EK 3S14K 4A3FK 4LK0A 3RZOK 3PO2C 5M3FK 5FLMK 4Y52K 4BY7C 4OIOA 3H3VL 4A93C 1TWFK 4NOIA 5IYBK 3GTLK 1TWFC 4KN7A 4LK1A 4XSXA 3HOWK 4YG2A 2R92K 3PO3K 4Y52C 4ZH4A 2E2IC 1TWHK 3CQZC 3H0GC 2YU9K 1TWHC 3S17K 3S1QK 3GTOK 4A3IC 5C44K 1YNNA 4A3LC 3GTPK 1I50K 2PA8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ D;  4QIW D;  3WOD A;  4Q4Z A;  1TWG K;  3GTJ K;  3HOV K;  5C44 C;  4BBS C;  1HQM A;  1WCM C;  2BE5 A;  3HKZ L;  5C3E K;  4A3K C;  1Y1V C;  4XLP A;  1Y1W K;  4A3B C;  5IYD C;  2WB1 D;  1IW7 A;  3HOX K;  3I4N C;  4A3B K;  3FKI C;  5M3M K;  2Y0S L;  3K7A C;  4OIP A;  4A3C C;  4A3K K;  4KN4 A;  3HOY C;  3HOU C;  4BBR C;  4G7O A;  2NVQ C;  4YFN A;  5TMC A;  4JK1 A;  3GTL C;  3S1N C;  2NVQ K;  5C4J K;  4OIR A;  3GTM K;  3HOZ K;  3HKZ D;  2JA7 K;  4G7Z A;  3PO2 K;  2A6H A;  3DXJ A;  3FKI K;  4AYB D;  3GTG K;  1TWC C;  1ZYR A;  1Y1W C;  2E2I K;  2O5J A;  3RZD K;  2WAQ L;  5C3E C;  4GZY A;  4C3I K;  2JA8 C;  1YNJ A;  1XPP A;  2R92 C;  3PO3 C;  4OIQ A;  2A68 A;  2NVX K;  3S2H C;  5IYB C;  4XLN A;  4AYB L;  1R9T K;  1I50 C;  2Y0S D;  2R7Z K;  1TWA C;  3S2D C;  4YFK A;  2R93 K;  5M5Y K;  4Y7N C;  4A3I K;  2O5I A;  1SFO K;  3RZD C;  3GTO C;  3S1R K;  2YU9 C;  1I3Q K;  2PA8 D;  5M5W K;  3S1R C;  5C4X K;  4QIW L;  3GTQ C;  2JA6 K;  1TWG C;  3GTJ C;  4YFX A;  2VUM K;  3I4M K;  5IP9 C;  4XSZ A;  2WB1 L;  4MEX A;  3GTK C;  2JA5 C;  5IP9 K;  2NVX C;  3S2H K;  4QJV B;  4BBR K;  5M5X K;  3M3Y C;  3GTQ K;  5FLM C;  3S2D K;  3S14 C;  3S1M K;  5C4X C;  4LLG A;  4C2M K;  4A3C K;  1I6H K;  2WAQ D;  1K83 C;  4LJZ A;  4MEY A;  1SFO C;  3M3Y K;  3HOZ C;  3H3V D;  5IYC K;  3HOW C;  4A3M K;  3S15 K;  4OIN A;  1R9T C;  2NVT C;  1SMY A;  3M4O C;  2B63 C;  1I6V A;  2NVT K;  3I4M C;  2PPB A;  4BY7 K;  5IP7 C;  2JA6 C;  4A3L K;  4A3D C;  4A3F C;  3RZO C;  3S1Q C;  4BXX K;  4KMU A;  4MQ9 A;  3GTG C;  3H0G K;  3I4N K;  4X6A C;  4BXX C;  4X6A K;  3S1M C;  2A69 A;  1Y1V K;  4A3D K;  1BDF A;  1WCM K;  3EQL A;  2E2H K;  5IP7 K;  1TWA K;  4BY1 C;  5C4J C;  3GTM C;  3HOV C;  2NVY K;  3S16 C;  2E2J K;  2JA5 K;  3S1N K;  5TMF A;  2E2J C;  4A3M C;  3S15 C;  2VUM C;  3HOU K;  3M4O K;  4A93 K;  4C3H K;  4C3J K;  1K83 K;  3K7A K;  4A3E C;  1I6H C;  1TWC K;  1I3Q C;  2A6E A;  2CW0 A;  3CQZ K;  5D4D A;  5FJ8 K;  3HOX C;  4Q5S A;  2PMZ L;  4QJV A;  4G7H A;  4A3J K;  2JA7 C;  4Y7N K;  2R7Z C;  4BBS K;  4A3G K;  2B63 K;  3GTK K;  4A3G C;  2NVY C;  5IYC C;  3GTP C;  3HOY K;  2E2H C;  4BY1 K;  3S16 K;  2JA8 K;  4A3J C;  2R93 C;  3S17 C;  5IYD K;  4A3E K;  3S14 K;  4A3F K;  4LK0 A;  3RZO K;  3PO2 C;  5M3F K;  5FLM K;  4Y52 K;  4BY7 C;  4OIO A;  3H3V L;  4A93 C;  1TWF K;  4NOI A;  5IYB K;  3GTL K;  1TWF C;  4KN7 A;  4LK1 A;  4XSX A;  3HOW K;  4YG2 A;  2R92 K;  3PO3 K;  4Y52 C;  4ZH4 A;  2E2I C;  1TWH K;  3CQZ C;  3H0G C;  2YU9 K;  1TWH C;  3S17 K;  3S1Q K;  3GTO K;  4A3I C;  5C44 K;  1YNN A;  4A3L C;  3GTP K;  1I50 K;  2PA8 L; 
#chains in the Genus database with same CATH topology
 3WOD A;  3L4K A;  4KMH A;  4BBS C;  1TWG K;  1KQ4 A;  1WQF A;  4LR2 A;  2BE5 A;  5C3E K;  1WOP A;  1HI9 A;  1Y1W K;  4A3B C;  5IYD C;  1JQW A;  2GAG C;  1IW7 A;  4A3C C;  4A3K K;  1UV7 A;  2XCQ A;  3HOY C;  3OPF A;  3HOU C;  3GTG A;  4G7O A;  2NVQ C;  4YFN A;  3AQP A;  3HOZ K;  2A6H A;  4AYB D;  1O27 A;  3GTG K;  1WQH A;  3ADA C;  2E2I K;  3HXA A;  4G0V A;  1DCP A;  1EI6 A;  4C3I K;  1I50 C;  4YFK A;  4A3I K;  1SFO K;  3BP8 C;  1J98 A;  1TWG A;  4BKW A;  3S1R C;  4QIW L;  2VUM K;  4XSZ A;  3N3Y A;  2NVX C;  3S2H K;  3CQZ A;  5FLM C;  4P5B A;  3S14 C;  4C2M K;  4KAR A;  3TFH A;  4MEY A;  3M4O C;  4OIN A;  4WJ4 A;  2NVT K;  1USM A;  4BY7 K;  1EFW A;  2JA6 C;  1XZP B;  2CFA B;  1BJT A;  1WOO A;  5CJ9 A;  1XXA A;  4XCH A;  4A3F C;  2RGR A;  4KMU A;  4X6A C;  3GTG C;  2B63 A;  3S1M C;  1AB4 A;  4KB4 A;  1O25 A;  1TWH A;  4DDQ A;  1F7U A;  4PAB A;  4ILD A;  3HOU K;  4A93 K;  3VA7 A;  3T02 A;  1DCH A;  4C3J K;  3MML B;  1L0W A;  4A3E C;  2VUM A;  4J3N A;  3HOX C;  3GTQ A;  3S0X A;  3LAJ A;  1I3Q A;  2R7Z C;  4BBS K;  1IQ0 A;  4A3G C;  1C0A A;  1O2A A;  3GEE A;  4RMF A;  2E2H C;  4BY1 K;  4C3I C;  3T00 A;  4LK0 A;  3G4A A;  4Y52 K;  2CFA A;  2GSO A;  4A93 C;  1TWF K;  4NOI A;  3GTL K;  1X31 C;  4KN7 A;  3FKI A;  4WJ3 M;  4Y52 C;  4ZH4 A;  3GSI A;  2E2I C;  1YX2 A;  3S17 K;  1USO A;  5C44 K;  4OIR A;  2PMZ D;  3HOV K;  1HQM A;  3HKZ L;  4KDD A;  3HOX K;  4BLB A;  4A3B K;  3FKI C;  2Y0S L;  1R9T A;  5E68 A;  1JVI A;  1WSR A;  4KN4 A;  3T01 A;  5TMC A;  4JK1 A;  3FOF A;  4PAA A;  5IOT A;  1EQR A;  1WOS A;  1XZQ B;  3DXJ A;  3ERE D;  3PO2 K;  1B4A A;  3RZD K;  2WAQ L;  4GZY A;  2JA8 C;  2ZFZ A;  5HL8 A;  4OIQ A;  2A68 A;  4XLN A;  4AYB L;  2Y0S D;  3AH5 A;  5M5Y K;  4Y7N C;  2O5I A;  2E2H A;  3LAP A;  3RZD C;  3GTO C;  4G0U A;  1I50 A;  3GTJ A;  1I3Q K;  3JST A;  3GTK A;  1ZVU A;  1TWG C;  4MEX A;  3GTO A;  4FM9 A;  5M5X K;  3GTQ K;  3IPJ A;  2WAQ D;  1SFO C;  1Y1W A;  1WIH A;  4GTL A;  4LQY A;  3H0G A;  3HOW C;  1SMY A;  1I6V A;  3I4M C;  4A3L K;  1IE0 A;  4A3D C;  3RZO C;  4MQ9 A;  2P5M A;  3I4N K;  4X6A K;  2A69 A;  1Y1V K;  1SFO A;  1WCM K;  3A8K A;  1BGW A;  1TWA K;  3S2D K;  2R93 C;  2NVY K;  4O2D A;  5TMF A;  2E2J C;  3M4O K;  2P8T A;  5JFE A;  1WCM A;  2JH3 A;  1I6H C;  1TWC K;  2CW0 A;  2PMZ L;  4G7H A;  4GTD A;  3A8I A;  4A3J K;  3GEH A;  4A3G K;  4KAS A;  1ISE A;  3TFJ A;  5IYC C;  3GTP C;  3S16 K;  1J6V A;  2GSU A;  3Q3Q A;  4A3E K;  5IOS A;  3FOE A;  5M3F K;  2FQT A;  1XZQ A;  4OIO A;  4GTA A;  3LPX A;  4XSX A;  1O2B A;  2R92 K;  3GTP A;  1IBA A;  4P9S A;  1F93 A;  3L4J A;  4KAW X;  1G51 A;  2RH6 A;  3H0G C;  2YU9 K;  3TTG A;  3S1Q K;  3GTO K;  4GTE A;  1YNN A;  4KAT A;  4GFQ A;  1VH2 A;  2PA8 L;  4QIW D;  4Q4Z A;  4M1X A;  1O28 A;  4A3K C;  2R93 A;  1DCO A;  3I4N C;  3K7A C;  3G4C A;  3S1N C;  3HKZ D;  5EGH A;  2R92 A;  1TWC C;  1PJ5 A;  1YCL A;  1ZYR A;  2O5J A;  3GIR A;  1XPP A;  3PO3 C;  2ZUF A;  4GT9 A;  2GSN A;  1R9T K;  5IOR A;  1TWA C;  1EK8 A;  2GAH C;  1Y1V A;  3S2D C;  2R93 K;  2YU9 C;  2PA8 D;  4AH6 A;  4C45 A;  5C4X K;  4KM8 A;  4GTF A;  2V6U A;  4FZB A;  3GTJ C;  3BP3 A;  3I4M K;  3SZZ A;  5IP9 C;  2WB1 L;  3GTK C;  2JA5 C;  1TWC A;  4BBR K;  5C4X C;  4A3C K;  4BLA A;  1K83 C;  2KWA A;  2Y3P A;  4LJZ A;  1DD5 A;  3H3V D;  5IYC K;  4A3M K;  2PHC B;  1R9T C;  3AD9 C;  2EBB A;  5IP7 C;  1VRQ C;  2JA6 A;  5CHP A;  4BXX K;  4G0W A;  1J6W A;  2XCR B;  3S16 C;  5IP7 K;  3AD8 C;  5C4J C;  3GTM C;  1F9N A;  3HOV C;  2E2J K;  2JA5 K;  3S15 C;  1V5V A;  4C3H K;  1ZXO A;  3A8J A;  1K83 K;  2A6E A;  3OEP A;  4QJV A;  1VLO A;  4Y7N K;  4C3H C;  3GTK K;  1PJ6 A;  4GTC A;  2NVY C;  1GE9 A;  3HOY K;  4KB2 A;  1WSV A;  3S14 K;  3RZO K;  1ZBS A;  1XZP A;  5IYB K;  4LK1 A;  3ORE A;  4YG2 A;  3PO3 K;  4GTB A;  1IS1 A;  4KMA A;  5L46 A;  1TWH C;  3V4G A;  2JA7 A;  1INN A;  3SZY A;  1BS2 A;  1K83 A;  4A3I C;  1RU0 A;  1I50 K;  3GTJ K;  5C44 C;  2NVX A;  1WCM C;  4KMD A;  1Y1V C;  4XLP A;  2WB1 D;  5M3M K;  5TJ3 A;  4OIP A;  1B4B A;  4BBR C;  3GTL C;  2NVQ K;  2V6T A;  5C4J K;  3GTM K;  2JA7 K;  4G7Z A;  1J6X A;  3FKI K;  3CAG A;  1Y1W C;  3GTL A;  1IL2 A;  5C3E C;  1YNJ A;  2R92 C;  1PJ7 A;  2NVX K;  3S2H C;  5IYB C;  2R7Z K;  3AD7 C;  3QX3 A;  1WOR A;  3S1R K;  5M5W K;  1VGX A;  4C3J C;  3BUE A;  3GTQ C;  2JA6 K;  5IOQ A;  2YU9 A;  4YFX A;  5IP9 K;  4QJV B;  3M3Y C;  4P5A A;  2JA5 A;  3S1M K;  4LLG A;  2ZUE A;  1I6H K;  4C2M C;  3M3Y K;  3HOZ C;  3S15 K;  2NVT C;  2B63 C;  2PPB A;  2XCO A;  4WIL A;  2FQO A;  1O29 A;  3N0B A;  3S1Q C;  3N0C A;  3H0G K;  1EH1 A;  4BXX C;  3NUH A;  4A3D K;  2R7Z A;  1BDF A;  3AQO A;  3EQL A;  2E2H K;  4BY1 C;  4A3L C;  1XXC A;  3S1N K;  4A3M C;  2VUM C;  1VJE A;  2W7V A;  3K7A K;  3GEI A;  1I3Q C;  1TWA A;  5FJ8 K;  1TWF A;  3CQZ K;  5D4D A;  4Q5S A;  2JA7 C;  4KC6 A;  1JOE A;  2B63 K;  1O2F B;  2JA8 K;  5JVO A;  1XXB A;  4LOW A;  4A3J C;  4KM9 A;  2V6S A;  3S17 C;  5IYD K;  4A3F K;  2D6F C;  3PO2 C;  5FLM K;  4BY7 C;  3H3V L;  3GDZ A;  2E2I A;  1TWF C;  3HOW K;  1O24 A;  2NVY A;  1ZQ1 C;  3FHZ A;  1O26 A;  1TWH K;  3CQZ C;  1F7V A;  3GTM A;  5EGE A;  3GTP K;  3TFI A;  1WQG A; 
#chains in the Genus database with same CATH homology
 2PMZ D;  4QIW D;  3WOD A;  4Q4Z A;  1TWG K;  3GTJ K;  3HOV K;  5C44 C;  4BBS C;  1HQM A;  1WCM C;  2BE5 A;  3HKZ L;  5C3E K;  4A3K C;  1Y1V C;  4XLP A;  1Y1W K;  4A3B C;  5IYD C;  2WB1 D;  1IW7 A;  3HOX K;  3I4N C;  4A3B K;  3FKI C;  5M3M K;  2Y0S L;  3K7A C;  4OIP A;  4A3C C;  4A3K K;  4KN4 A;  3HOY C;  3HOU C;  4BBR C;  4G7O A;  2NVQ C;  4YFN A;  5TMC A;  4JK1 A;  3GTL C;  3S1N C;  2NVQ K;  5C4J K;  4OIR A;  3GTM K;  3HOZ K;  3HKZ D;  2JA7 K;  4G7Z A;  3PO2 K;  2A6H A;  3DXJ A;  3FKI K;  4AYB D;  3GTG K;  1TWC C;  1ZYR A;  1Y1W C;  2E2I K;  2O5J A;  3RZD K;  2WAQ L;  5C3E C;  4GZY A;  4C3I K;  2JA8 C;  1YNJ A;  1XPP A;  2R92 C;  3PO3 C;  4OIQ A;  2A68 A;  2NVX K;  3S2H C;  5IYB C;  4XLN A;  4AYB L;  1R9T K;  1I50 C;  2Y0S D;  2R7Z K;  1TWA C;  3S2D C;  4YFK A;  2R93 K;  5M5Y K;  4Y7N C;  4A3I K;  2O5I A;  1SFO K;  3RZD C;  3GTO C;  3S1R K;  2YU9 C;  1I3Q K;  2PA8 D;  5M5W K;  3S1R C;  5C4X K;  4QIW L;  3GTQ C;  2JA6 K;  1TWG C;  3GTJ C;  4YFX A;  2VUM K;  3I4M K;  5IP9 C;  4XSZ A;  2WB1 L;  4MEX A;  3GTK C;  2JA5 C;  5IP9 K;  2NVX C;  3S2H K;  4QJV B;  4BBR K;  5M5X K;  3M3Y C;  3GTQ K;  5FLM C;  3S2D K;  3S14 C;  3S1M K;  5C4X C;  4LLG A;  4C2M K;  4A3C K;  1I6H K;  2WAQ D;  1K83 C;  4LJZ A;  4MEY A;  1SFO C;  3M3Y K;  3HOZ C;  3H3V D;  5IYC K;  3HOW C;  4A3M K;  3S15 K;  4OIN A;  1R9T C;  2NVT C;  1SMY A;  3M4O C;  2B63 C;  1I6V A;  2NVT K;  3I4M C;  2PPB A;  4BY7 K;  5IP7 C;  2JA6 C;  4A3L K;  4A3D C;  4A3F C;  3RZO C;  3S1Q C;  4BXX K;  4KMU A;  4MQ9 A;  3GTG C;  3H0G K;  3I4N K;  4X6A C;  4BXX C;  4X6A K;  3S1M C;  2A69 A;  1Y1V K;  4A3D K;  1BDF A;  1WCM K;  3EQL A;  2E2H K;  5IP7 K;  1TWA K;  4BY1 C;  5C4J C;  3GTM C;  3HOV C;  2NVY K;  3S16 C;  2E2J K;  2JA5 K;  3S1N K;  5TMF A;  2E2J C;  4A3M C;  3S15 C;  2VUM C;  3HOU K;  3M4O K;  4A93 K;  4C3H K;  4C3J K;  1K83 K;  3K7A K;  4A3E C;  1I6H C;  1TWC K;  1I3Q C;  2A6E A;  2CW0 A;  3CQZ K;  5D4D A;  5FJ8 K;  3HOX C;  4Q5S A;  2PMZ L;  4QJV A;  4G7H A;  4A3J K;  2JA7 C;  4Y7N K;  2R7Z C;  4BBS K;  4A3G K;  2B63 K;  3GTK K;  4A3G C;  2NVY C;  5IYC C;  3GTP C;  3HOY K;  2E2H C;  4BY1 K;  3S16 K;  2JA8 K;  4A3J C;  2R93 C;  3S17 C;  5IYD K;  4A3E K;  3S14 K;  4A3F K;  4LK0 A;  3RZO K;  3PO2 C;  5M3F K;  5FLM K;  4Y52 K;  4BY7 C;  4OIO A;  3H3V L;  4A93 C;  1TWF K;  4NOI A;  5IYB K;  3GTL K;  1TWF C;  4KN7 A;  4LK1 A;  4XSX A;  3HOW K;  4YG2 A;  2R92 K;  3PO3 K;  4Y52 C;  4ZH4 A;  2E2I C;  1TWH K;  3CQZ C;  3H0G C;  2YU9 K;  1TWH C;  3S17 K;  3S1Q K;  3GTO K;  4A3I C;  5C44 K;  1YNN A;  4A3L C;  3GTP K;  1I50 K;  2PA8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...