3HOXK

Complete rna polymerase ii elongation complex v
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoxK00
2E2HC 3FKIC 5IP7K 3S1NK 4A3GK 5IYDK 1TWFK 2A69A 2NVYK 5IP7C 2NVXK 3S1NC 4C3IK 2NVXC 4A3IK 1SMYA 1TWAK 4BBRK 2A68A 2NVTK 4OIOA 4BBRC 2PMZL 4A3FK 4BY1K 2JA7K 3H3VD 4MQ9A 1Y1WK 3GTOK 4G7HA 4Y7NC 1I6HC 1BDFA 4OIPA 4X6AK 3I4MC 4A3MK 1Y1VK 2A6EA 4MEYA 1YNNA 3S1QK 2B63K 4BY7C 3S1RK 4G7ZA 2JA8K 1TWCK 3M3YK 2B63C 3GTQK 5C3EK 2R7ZK 1K83K 3S1RC 3K7AK 1SFOK 2JA8C 3M3YC 3GTQC 4BBSK 4Q4ZA 4ZH4A 2E2HK 2E2JC 4A3EC 4Y52C 4XSZA 3I4NC 3GTGK 5IYCK 2VUMC 3GTGC 5IYCC 1ZYRA 3HOWC 2PA8L 2WB1L 4YG2A 3HOYK 2Y0SL 3EQLA 3HOVK 5C4JC 3HOYC 2NVQC 3PO2K 5IYBK 3HOVC 5M3MK 2E2IK 4LK0A 5IYBC 3PO2C 2E2IC 4Y7NK 1I6HK 4NOIA 3HKZL 4LK1A 5C4XK 4A3KC 2R92C 3I4MK 1R9TC 2WAQL 3GTJK 3GTPK 2R93C 1I6VA 5C4XC 3DXJA 3M4OK 5M5WK 3GTJC 3GTPC 4YFKA 4BXXK 4BY7K 3M4OC 4QIWL 5M5YK 3PO3C 4GZYA 2E2JK 4A3EK 4Y52K 3GTMK 3S14C 4A3JC 4AYBD 3I4NK 4C2MK 3GTMC 4A93C 2VUMK 3HOXK 2O5JA 3RZOC 3S2HK 3HOWK 4LLGA 5M3FK 3S17C 4KN4A 3HOXC 3GTLK 3HOUC 3S2HC 5FJ8K 4A3DC 3S2DC 5C4JK 4JK1A 4XLPA 3CQZC 2NVQK 4BXXC 4MEXA 3H3VL 1TWHK 1I50K 3S1MC 2PMZD 4OIQA 1TWHC 1I50C 2JA6C 4A3KK 2R92K 3HOZC 3S15C 4A3CK 1R9TK 2R93K 2YU9C 4A3CC 4G7OA 5IP9K 4OIRA 1I3QC 4C3JK 4A3BK 3S16K 5IP9C 3GTKK 4A3BC 3S16C 3GTKC 3GTLC 3PO3K 4QJVA 3S14K 2O5IA 4A3JK 4A3LK 4XLNA 2JA5C 4A3LC 1HQMA 4A93K 2A6HA 4A3GC 5IYDC 3RZOK 1TWFC 2NVYC 5TMCA 3S17K 3HOUK 2PPBA 4A3DK 4A3IC 3S1QC 1TWAC 5TMFA 2PA8D 2BE5A 2WB1D 3CQZK 3S2DK 4LJZA 2Y0SD 3RZDK 2NVTC 4QJVB 3RZDC 4KN7A 4C3HK 3S1MK 4A3FC 4BY1C 3H0GK 1YNJA 2CW0A 1Y1WC 2JA7C 3GTOC 5C44K 4YFXA 2JA6K 3H0GC 1IW7A 3HOZK 5C44C 3S15K 4X6AC 1TWGK 1WCMK 4Q5SA 2YU9K 3HKZD 1Y1VC 4A3MC 1I3QK 1TWGC 1WCMC 2WAQD 4YFNA 4OINA 1XPPA 5D4DA 5M5XK 1TWCC 3WODA 5FLMK 2R7ZC 4XSXA 5C3EC 1K83C 4KMUA 3K7AC 4QIWD 5FLMC 3FKIK 1SFOC 4AYBL 4BBSC 2JA5K
chains in the Genus database with same CATH superfamily
3S1NK 5IYDK 1EQRA 2V6TA 4PABA 5IP7C 2NVXK 1O2AA 4A3IK 1SMYA 1TWAK 2R93A 2PHCB 4OIOA 2FQTA 1WOOA 4A3FK 4KARA 3H3VD 3SZYA 1DCHA 1O26A 3I4MC 1F7UA 4MEYA 5IOTA 2B63K 4DDQA 4G7ZA 3S1RK 1WSRA 3M3YC 3GTQC 4ZH4A 5EGEA 3GTGK 5IYCK 1J98A 4P5BA 2PA8L 2YU9A 1I3QA 1USOA 1DCOA 2E2IK 1VJEA 4LK0A 2GAHC 3PO2C 1XZQA 4NOIA 3HKZL 4LK1A 5C4XK 2WAQL 3GTPK 2R93C 1UV7A 4C3JC 1J6XA 2P5MA 1TWAA 1ZVUA 4GT9A 4A3EK 3GDZA 4A3JC 1BGWA 3NUHA 4G0VA 2VUMK 3RZOC 3S2HK 3N0BA 4KN4A 4G0WA 4KDDA 1TWGA 3S2DC 5C4JK 4XCHA 2NVQK 3TFJA 5CJ9A 3S1MC 1B4BA 2PMZD 4OIQA 4A3KK 1IE0A 4A3CK 3A8IA 1R9TK 2YU9C 5IP9K 2NVYA 4OIRA 1I3QC 1F7VA 4P9SA 3FOFA 2W7VA 3PO3K 4QJVA 4A93K 4GTLA 3GIRA 5IYDC 4A3IC 4KATA 1TWAC 5TMFA 3BUEA 2BE5A 2WB1D 3CQZK 3OREA 4A3FC 4AH6A 3OEPA 1IW7A 4WJ4A 2VUMA 1EH1A 1TWGC 1L0WA 4QIWD 5FLMC 3FKIK 2RH6A 1XPPA 1XXCA 4A3GK 5IOSA 2A69A 4C3IK 1R9TA 3A8JA 3T02A 4BBRK 3GEHA 1YCLA 3TFIA 5JFEA 4OIPA 3GTMA 2Y3PA 1WSVA 2A6EA 1O2FB 1O27A 4KAWX 5IOQA 3S1QC 5C3EK 3CQZA 3K7AK 2JA8C 3BP8C 4A3EC 1TWHA 3GSIA 1I50A 4KMAA 2VUMC 1ZXOA 4GTBA 4YG2A 2Y0SL 2GSUA 3OPFA 3HOVK 5C4JC 3HOYC 2NVQC 1J6VA 3G4AA 5IYBK 1WIHA 3GTKA 1O28A 4Y7NK 4KMHA 2XCRB 1I6HK 2GSOA 4A3KC 1XZPA 2CFAA 1R9TC 3GTJK 3M4OK 5M5WK 4BY7K 1WQGA 3LPXA 4BXXK 3V4GA 3AQOA 3PO3C 4GZYA 4Y52K 4AYBD 1XZQB 3GTMC 4A93C 1J6WA 2O5JA 4C2MC 2EBBA 4FM9A 5M3FK 3HOXC 1C0AA 1AB4A 1USMA 3SZZA 3CQZC 3IPJA 4BLBA 1X31C 4C45A 1TWHC 1I50C 2R92K 3N3YA 2NVXA 3N0CA 3S16K 3L4JA 4A3BC 3GTKC 4FZBA 5CHPA 3S14K 4XLNA 1INNA 4LQYA 4A3GC 1V5VA 3BP3A 3HOUK 1VGXA 4KB4A 2PPBA 4GTAA 3S0XA 2PA8D 2B63A 4QJVB 3RZDC 4C3HK 4KM8A 3H0GK 2CW0A 5C44K 4PAAA 1PJ5A 1WCMK 3GTGA 3HKZD 2WAQD 4YFNA 5D4DA 4KASA 5M5XK 4KM9A 5C3EC 4KMUA 3K7AC 5E68A 3LAPA 4A3LK 1IBAA 4KC6A 5IP7K 2E2IA 3S1NC 2R92A 1BS2A 2NVXC 1ZBSA 2V6SA 3GTPA 4GTDA 4BY1K 2JA7K 3GTOK 4G7HA 1IS1A 4Y7NC 1EFWA 1I6HC 4X6AK 2KWAA 4A3MK 3TFHA 1DD5A 1YNNA 2XCQA 5L46A 4BY7C 4BXXC 1TWCK 3M3YK 2B63C 3GTQK 2R7ZK 4BBSK 3AQPA 3S1RC 1B4AA 2E2HK 1YX2A 1RU0A 4Y52C 4XSZA 3HXAA 3FHZA 1JQWA 3GTGC 5IYCC 1ZYRA 1WQHA 3EQLA 3MMLB 3PO2K 1WOSA 1O2BA 3T01A 2E2IC 2P8TA 1WORA 1O29A 4KMDA 2R92C 5C4XC 3GTPC 4RMFA 5M5YK 2E2JK 3S14C 3I4NK 2JA7A 3GTOA 1XZPB 2CFAB 3HOWK 3HOUC 3S2HC 3H3VL 1TWCA 2R7ZA 3LAJA 3GEIA 2E2HA 3FKIA 1IQ0A 1WQFA 3L4KA 5TJ3A 4G7OA 4A3CC 5IORA 1VLOA 4ILDA 4M1XA 5IP9C 3ERED 3A8KA 3QX3A 4BLAA 4A3LC 3Q3QA 1EK8A 2A6HA 2RGRA 5TMCA 3S17K 3AD7C 4A3DK 4LJZA 2Y0SD 2ZUFA 4GTFA 4KN7A 1KQ4A 4BY1C 2JA7C 1YNJA 3GTOC 1DCPA 2JA6K 1PJ7A 3HOZK 3S15K 4X6AC 1TWGK 4Q5SA 4P5AA 1JOEA 4GTCA 4A3MC 4G0UA 4OINA 3GEEA 4J3NA 5FLMK 1TWCC 3GTLK 2R7ZC 4XSXA 4BBSC 2FQOA 2JH3A 3AH5A 2JA5K 2E2HC 1O25A 3FKIC 2ZUEA 1TWFK 2NVYK 1BJTA 4C3IC 2XCOA 2GAGC 2A68A 3GTJA 2NVTK 4BBRC 2PMZL 1F93A 1O24A 4MQ9A 1Y1WK 1VRQC 5JVOA 2ZFZA 1WOPA 1BDFA 1Y1VK 3S1QK 3TTGA 2JA8K 1K83K 1SFOK 4Q4ZA 2E2JC 3CAGA 3I4NC 1EI6A 3JSTA 2JA6A 1F9NA 3HOWC 2WB1L 3HOYK 3HOVC 3GTLA 5M3MK 5IYBC 1XXBA 2JA5A 4LOWA 1XXAA 3I4MK 1TWFA 1I6VA 3DXJA 3GTJC 4YFKA 3AD9C 2D6FC 3M4OC 4QIWL 4WJ3M 4WILA 3GTMK 1Y1WA 4C2MK 3G4CA 3H0GA 3HOXK 1GE9A 1G51A 4LLGA 3S17C 1Y1VA 5FJ8K 1WCMA 3VA7A 4A3DC 2V6UA 1JVIA 4JK1A 4XLPA 4MEXA 1TWHK 1K83A 1SFOA 1I50K 1ZQ1C 4BKWA 1VH2A 3ADAC 3T00A 2JA6C 3HOZC 3FOEA 3S15C 5HL8A 2R93K 4C3JK 4A3BK 3GTKK 3S16C 3GTLC 2O5IA 4A3JK 2JA5C 4GTEA 1HQMA 1ISEA 4GFQA 3RZOK 1TWFC 2NVYC 1IL2A 4O2DA 3S2DK 4KB2A 1HI9A 3RZDK 3AD8C 2NVTC 3S1MK 3GTQA 1Y1WC 4C3HC 4YFXA 3H0GC 5EGHA 5C44C 2GSNA 2YU9K 1Y1VC 1I3QK 1WCMC 1PJ6A 4LR2A 3WODA 1K83C 1SFOC 4AYBL
chains in the Genus database with same CATH topology
2E2HC 3FKIC 5IP7K 3S1NK 4A3GK 5IYDK 1TWFK 2A69A 2NVYK 5IP7C 2NVXK 3S1NC 4C3IK 2NVXC 4A3IK 1SMYA 1TWAK 4BBRK 2A68A 2NVTK 4OIOA 4BBRC 2PMZL 4A3FK 4BY1K 2JA7K 3H3VD 4MQ9A 1Y1WK 3GTOK 4G7HA 4Y7NC 1I6HC 1BDFA 4OIPA 4X6AK 3I4MC 4A3MK 1Y1VK 2A6EA 4MEYA 1YNNA 3S1QK 2B63K 4BY7C 3S1RK 4G7ZA 2JA8K 1TWCK 3M3YK 2B63C 3GTQK 5C3EK 2R7ZK 1K83K 3S1RC 3K7AK 1SFOK 2JA8C 3M3YC 3GTQC 4BBSK 4Q4ZA 4ZH4A 2E2HK 2E2JC 4A3EC 4Y52C 4XSZA 3I4NC 3GTGK 5IYCK 2VUMC 3GTGC 5IYCC 1ZYRA 3HOWC 2PA8L 2WB1L 4YG2A 3HOYK 2Y0SL 3EQLA 3HOVK 5C4JC 3HOYC 2NVQC 3PO2K 5IYBK 3HOVC 5M3MK 2E2IK 4LK0A 5IYBC 3PO2C 2E2IC 4Y7NK 1I6HK 4NOIA 3HKZL 4LK1A 5C4XK 4A3KC 2R92C 3I4MK 1R9TC 2WAQL 3GTJK 3GTPK 2R93C 1I6VA 5C4XC 3DXJA 3M4OK 5M5WK 3GTJC 3GTPC 4YFKA 4BXXK 4BY7K 3M4OC 4QIWL 5M5YK 3PO3C 4GZYA 2E2JK 4A3EK 4Y52K 3GTMK 3S14C 4A3JC 4AYBD 3I4NK 4C2MK 3GTMC 4A93C 2VUMK 3HOXK 2O5JA 3RZOC 3S2HK 3HOWK 4LLGA 5M3FK 3S17C 4KN4A 3HOXC 3GTLK 3HOUC 3S2HC 5FJ8K 4A3DC 3S2DC 5C4JK 4JK1A 4XLPA 3CQZC 2NVQK 4BXXC 4MEXA 3H3VL 1TWHK 1I50K 3S1MC 2PMZD 4OIQA 1TWHC 1I50C 2JA6C 4A3KK 2R92K 3HOZC 3S15C 4A3CK 1R9TK 2R93K 2YU9C 4A3CC 4G7OA 5IP9K 4OIRA 1I3QC 4C3JK 4A3BK 3S16K 5IP9C 3GTKK 4A3BC 3S16C 3GTKC 3GTLC 3PO3K 4QJVA 3S14K 2O5IA 4A3JK 4A3LK 4XLNA 2JA5C 4A3LC 1HQMA 4A93K 2A6HA 4A3GC 5IYDC 3RZOK 1TWFC 2NVYC 5TMCA 3S17K 3HOUK 2PPBA 4A3DK 4A3IC 3S1QC 1TWAC 5TMFA 2PA8D 2BE5A 2WB1D 3CQZK 3S2DK 4LJZA 2Y0SD 3RZDK 2NVTC 4QJVB 3RZDC 4KN7A 4C3HK 3S1MK 4A3FC 4BY1C 3H0GK 1YNJA 2CW0A 1Y1WC 2JA7C 3GTOC 5C44K 4YFXA 2JA6K 3H0GC 1IW7A 3HOZK 5C44C 3S15K 4X6AC 1TWGK 1WCMK 4Q5SA 2YU9K 3HKZD 1Y1VC 4A3MC 1I3QK 1TWGC 1WCMC 2WAQD 4YFNA 4OINA 1XPPA 5D4DA 5M5XK 1TWCC 3WODA 5FLMK 2R7ZC 4XSXA 5C3EC 1K83C 4KMUA 3K7AC 4QIWD 5FLMC 3FKIK 1SFOC 4AYBL 4BBSC 2JA5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H C;  3FKI C;  5IP7 K;  3S1N K;  4A3G K;  5IYD K;  1TWF K;  2A69 A;  2NVY K;  5IP7 C;  2NVX K;  3S1N C;  4C3I K;  2NVX C;  4A3I K;  1SMY A;  1TWA K;  4BBR K;  2A68 A;  2NVT K;  4OIO A;  4BBR C;  2PMZ L;  4A3F K;  4BY1 K;  2JA7 K;  3H3V D;  4MQ9 A;  1Y1W K;  3GTO K;  4G7H A;  4Y7N C;  1I6H C;  1BDF A;  4OIP A;  4X6A K;  3I4M C;  4A3M K;  1Y1V K;  2A6E A;  4MEY A;  1YNN A;  3S1Q K;  2B63 K;  4BY7 C;  3S1R K;  4G7Z A;  2JA8 K;  1TWC K;  3M3Y K;  2B63 C;  3GTQ K;  5C3E K;  2R7Z K;  1K83 K;  3S1R C;  3K7A K;  1SFO K;  2JA8 C;  3M3Y C;  3GTQ C;  4BBS K;  4Q4Z A;  4ZH4 A;  2E2H K;  2E2J C;  4A3E C;  4Y52 C;  4XSZ A;  3I4N C;  3GTG K;  5IYC K;  2VUM C;  3GTG C;  5IYC C;  1ZYR A;  3HOW C;  2PA8 L;  2WB1 L;  4YG2 A;  3HOY K;  2Y0S L;  3EQL A;  3HOV K;  5C4J C;  3HOY C;  2NVQ C;  3PO2 K;  5IYB K;  3HOV C;  5M3M K;  2E2I K;  4LK0 A;  5IYB C;  3PO2 C;  2E2I C;  4Y7N K;  1I6H K;  4NOI A;  3HKZ L;  4LK1 A;  5C4X K;  4A3K C;  2R92 C;  3I4M K;  1R9T C;  2WAQ L;  3GTJ K;  3GTP K;  2R93 C;  1I6V A;  5C4X C;  3DXJ A;  3M4O K;  5M5W K;  3GTJ C;  3GTP C;  4YFK A;  4BXX K;  4BY7 K;  3M4O C;  4QIW L;  5M5Y K;  3PO3 C;  4GZY A;  2E2J K;  4A3E K;  4Y52 K;  3GTM K;  3S14 C;  4A3J C;  4AYB D;  3I4N K;  4C2M K;  3GTM C;  4A93 C;  2VUM K;  3HOX K;  2O5J A;  3RZO C;  3S2H K;  3HOW K;  4LLG A;  5M3F K;  3S17 C;  4KN4 A;  3HOX C;  3GTL K;  3HOU C;  3S2H C;  5FJ8 K;  4A3D C;  3S2D C;  5C4J K;  4JK1 A;  4XLP A;  3CQZ C;  2NVQ K;  4BXX C;  4MEX A;  3H3V L;  1TWH K;  1I50 K;  3S1M C;  2PMZ D;  4OIQ A;  1TWH C;  1I50 C;  2JA6 C;  4A3K K;  2R92 K;  3HOZ C;  3S15 C;  4A3C K;  1R9T K;  2R93 K;  2YU9 C;  4A3C C;  4G7O A;  5IP9 K;  4OIR A;  1I3Q C;  4C3J K;  4A3B K;  3S16 K;  5IP9 C;  3GTK K;  4A3B C;  3S16 C;  3GTK C;  3GTL C;  3PO3 K;  4QJV A;  3S14 K;  2O5I A;  4A3J K;  4A3L K;  4XLN A;  2JA5 C;  4A3L C;  1HQM A;  4A93 K;  2A6H A;  4A3G C;  5IYD C;  3RZO K;  1TWF C;  2NVY C;  5TMC A;  3S17 K;  3HOU K;  2PPB A;  4A3D K;  4A3I C;  3S1Q C;  1TWA C;  5TMF A;  2PA8 D;  2BE5 A;  2WB1 D;  3CQZ K;  3S2D K;  4LJZ A;  2Y0S D;  3RZD K;  2NVT C;  4QJV B;  3RZD C;  4KN7 A;  4C3H K;  3S1M K;  4A3F C;  4BY1 C;  3H0G K;  1YNJ A;  2CW0 A;  1Y1W C;  2JA7 C;  3GTO C;  5C44 K;  4YFX A;  2JA6 K;  3H0G C;  1IW7 A;  3HOZ K;  5C44 C;  3S15 K;  4X6A C;  1TWG K;  1WCM K;  4Q5S A;  2YU9 K;  3HKZ D;  1Y1V C;  4A3M C;  1I3Q K;  1TWG C;  1WCM C;  2WAQ D;  4YFN A;  4OIN A;  1XPP A;  5D4D A;  5M5X K;  1TWC C;  3WOD A;  5FLM K;  2R7Z C;  4XSX A;  5C3E C;  1K83 C;  4KMU A;  3K7A C;  4QIW D;  5FLM C;  3FKI K;  1SFO C;  4AYB L;  4BBS C;  2JA5 K; 
#chains in the Genus database with same CATH topology
 3S1N K;  5IYD K;  1EQR A;  2V6T A;  4PAB A;  5IP7 C;  2NVX K;  1O2A A;  4A3I K;  1SMY A;  1TWA K;  2R93 A;  2PHC B;  4OIO A;  2FQT A;  1WOO A;  4A3F K;  4KAR A;  3H3V D;  3SZY A;  1DCH A;  1O26 A;  3I4M C;  1F7U A;  4MEY A;  5IOT A;  2B63 K;  4DDQ A;  4G7Z A;  3S1R K;  1WSR A;  3M3Y C;  3GTQ C;  4ZH4 A;  5EGE A;  3GTG K;  5IYC K;  1J98 A;  4P5B A;  2PA8 L;  2YU9 A;  1I3Q A;  1USO A;  1DCO A;  2E2I K;  1VJE A;  4LK0 A;  2GAH C;  3PO2 C;  1XZQ A;  4NOI A;  3HKZ L;  4LK1 A;  5C4X K;  2WAQ L;  3GTP K;  2R93 C;  1UV7 A;  4C3J C;  1J6X A;  2P5M A;  1TWA A;  1ZVU A;  4GT9 A;  4A3E K;  3GDZ A;  4A3J C;  1BGW A;  3NUH A;  4G0V A;  2VUM K;  3RZO C;  3S2H K;  3N0B A;  4KN4 A;  4G0W A;  4KDD A;  1TWG A;  3S2D C;  5C4J K;  4XCH A;  2NVQ K;  3TFJ A;  5CJ9 A;  3S1M C;  1B4B A;  2PMZ D;  4OIQ A;  4A3K K;  1IE0 A;  4A3C K;  3A8I A;  1R9T K;  2YU9 C;  5IP9 K;  2NVY A;  4OIR A;  1I3Q C;  1F7V A;  4P9S A;  3FOF A;  2W7V A;  3PO3 K;  4QJV A;  4A93 K;  4GTL A;  3GIR A;  5IYD C;  4A3I C;  4KAT A;  1TWA C;  5TMF A;  3BUE A;  2BE5 A;  2WB1 D;  3CQZ K;  3ORE A;  4A3F C;  4AH6 A;  3OEP A;  1IW7 A;  4WJ4 A;  2VUM A;  1EH1 A;  1TWG C;  1L0W A;  4QIW D;  5FLM C;  3FKI K;  2RH6 A;  1XPP A;  1XXC A;  4A3G K;  5IOS A;  2A69 A;  4C3I K;  1R9T A;  3A8J A;  3T02 A;  4BBR K;  3GEH A;  1YCL A;  3TFI A;  5JFE A;  4OIP A;  3GTM A;  2Y3P A;  1WSV A;  2A6E A;  1O2F B;  1O27 A;  4KAW X;  5IOQ A;  3S1Q C;  5C3E K;  3CQZ A;  3K7A K;  2JA8 C;  3BP8 C;  4A3E C;  1TWH A;  3GSI A;  1I50 A;  4KMA A;  2VUM C;  1ZXO A;  4GTB A;  4YG2 A;  2Y0S L;  2GSU A;  3OPF A;  3HOV K;  5C4J C;  3HOY C;  2NVQ C;  1J6V A;  3G4A A;  5IYB K;  1WIH A;  3GTK A;  1O28 A;  4Y7N K;  4KMH A;  2XCR B;  1I6H K;  2GSO A;  4A3K C;  1XZP A;  2CFA A;  1R9T C;  3GTJ K;  3M4O K;  5M5W K;  4BY7 K;  1WQG A;  3LPX A;  4BXX K;  3V4G A;  3AQO A;  3PO3 C;  4GZY A;  4Y52 K;  4AYB D;  1XZQ B;  3GTM C;  4A93 C;  1J6W A;  2O5J A;  4C2M C;  2EBB A;  4FM9 A;  5M3F K;  3HOX C;  1C0A A;  1AB4 A;  1USM A;  3SZZ A;  3CQZ C;  3IPJ A;  4BLB A;  1X31 C;  4C45 A;  1TWH C;  1I50 C;  2R92 K;  3N3Y A;  2NVX A;  3N0C A;  3S16 K;  3L4J A;  4A3B C;  3GTK C;  4FZB A;  5CHP A;  3S14 K;  4XLN A;  1INN A;  4LQY A;  4A3G C;  1V5V A;  3BP3 A;  3HOU K;  1VGX A;  4KB4 A;  2PPB A;  4GTA A;  3S0X A;  2PA8 D;  2B63 A;  4QJV B;  3RZD C;  4C3H K;  4KM8 A;  3H0G K;  2CW0 A;  5C44 K;  4PAA A;  1PJ5 A;  1WCM K;  3GTG A;  3HKZ D;  2WAQ D;  4YFN A;  5D4D A;  4KAS A;  5M5X K;  4KM9 A;  5C3E C;  4KMU A;  3K7A C;  5E68 A;  3LAP A;  4A3L K;  1IBA A;  4KC6 A;  5IP7 K;  2E2I A;  3S1N C;  2R92 A;  1BS2 A;  2NVX C;  1ZBS A;  2V6S A;  3GTP A;  4GTD A;  4BY1 K;  2JA7 K;  3GTO K;  4G7H A;  1IS1 A;  4Y7N C;  1EFW A;  1I6H C;  4X6A K;  2KWA A;  4A3M K;  3TFH A;  1DD5 A;  1YNN A;  2XCQ A;  5L46 A;  4BY7 C;  4BXX C;  1TWC K;  3M3Y K;  2B63 C;  3GTQ K;  2R7Z K;  4BBS K;  3AQP A;  3S1R C;  1B4A A;  2E2H K;  1YX2 A;  1RU0 A;  4Y52 C;  4XSZ A;  3HXA A;  3FHZ A;  1JQW A;  3GTG C;  5IYC C;  1ZYR A;  1WQH A;  3EQL A;  3MML B;  3PO2 K;  1WOS A;  1O2B A;  3T01 A;  2E2I C;  2P8T A;  1WOR A;  1O29 A;  4KMD A;  2R92 C;  5C4X C;  3GTP C;  4RMF A;  5M5Y K;  2E2J K;  3S14 C;  3I4N K;  2JA7 A;  3GTO A;  1XZP B;  2CFA B;  3HOW K;  3HOU C;  3S2H C;  3H3V L;  1TWC A;  2R7Z A;  3LAJ A;  3GEI A;  2E2H A;  3FKI A;  1IQ0 A;  1WQF A;  3L4K A;  5TJ3 A;  4G7O A;  4A3C C;  5IOR A;  1VLO A;  4ILD A;  4M1X A;  5IP9 C;  3ERE D;  3A8K A;  3QX3 A;  4BLA A;  4A3L C;  3Q3Q A;  1EK8 A;  2A6H A;  2RGR A;  5TMC A;  3S17 K;  3AD7 C;  4A3D K;  4LJZ A;  2Y0S D;  2ZUF A;  4GTF A;  4KN7 A;  1KQ4 A;  4BY1 C;  2JA7 C;  1YNJ A;  3GTO C;  1DCP A;  2JA6 K;  1PJ7 A;  3HOZ K;  3S15 K;  4X6A C;  1TWG K;  4Q5S A;  4P5A A;  1JOE A;  4GTC A;  4A3M C;  4G0U A;  4OIN A;  3GEE A;  4J3N A;  5FLM K;  1TWC C;  3GTL K;  2R7Z C;  4XSX A;  4BBS C;  2FQO A;  2JH3 A;  3AH5 A;  2JA5 K;  2E2H C;  1O25 A;  3FKI C;  2ZUE A;  1TWF K;  2NVY K;  1BJT A;  4C3I C;  2XCO A;  2GAG C;  2A68 A;  3GTJ A;  2NVT K;  4BBR C;  2PMZ L;  1F93 A;  1O24 A;  4MQ9 A;  1Y1W K;  1VRQ C;  5JVO A;  2ZFZ A;  1WOP A;  1BDF A;  1Y1V K;  3S1Q K;  3TTG A;  2JA8 K;  1K83 K;  1SFO K;  4Q4Z A;  2E2J C;  3CAG A;  3I4N C;  1EI6 A;  3JST A;  2JA6 A;  1F9N A;  3HOW C;  2WB1 L;  3HOY K;  3HOV C;  3GTL A;  5M3M K;  5IYB C;  1XXB A;  2JA5 A;  4LOW A;  1XXA A;  3I4M K;  1TWF A;  1I6V A;  3DXJ A;  3GTJ C;  4YFK A;  3AD9 C;  2D6F C;  3M4O C;  4QIW L;  4WJ3 M;  4WIL A;  3GTM K;  1Y1W A;  4C2M K;  3G4C A;  3H0G A;  3HOX K;  1GE9 A;  1G51 A;  4LLG A;  3S17 C;  1Y1V A;  5FJ8 K;  1WCM A;  3VA7 A;  4A3D C;  2V6U A;  1JVI A;  4JK1 A;  4XLP A;  4MEX A;  1TWH K;  1K83 A;  1SFO A;  1I50 K;  1ZQ1 C;  4BKW A;  1VH2 A;  3ADA C;  3T00 A;  2JA6 C;  3HOZ C;  3FOE A;  3S15 C;  5HL8 A;  2R93 K;  4C3J K;  4A3B K;  3GTK K;  3S16 C;  3GTL C;  2O5I A;  4A3J K;  2JA5 C;  4GTE A;  1HQM A;  1ISE A;  4GFQ A;  3RZO K;  1TWF C;  2NVY C;  1IL2 A;  4O2D A;  3S2D K;  4KB2 A;  1HI9 A;  3RZD K;  3AD8 C;  2NVT C;  3S1M K;  3GTQ A;  1Y1W C;  4C3H C;  4YFX A;  3H0G C;  5EGH A;  5C44 C;  2GSN A;  2YU9 K;  1Y1V C;  1I3Q K;  1WCM C;  1PJ6 A;  4LR2 A;  3WOD A;  1K83 C;  1SFO C;  4AYB L; 
#chains in the Genus database with same CATH homology
 2E2H C;  3FKI C;  5IP7 K;  3S1N K;  4A3G K;  5IYD K;  1TWF K;  2A69 A;  2NVY K;  5IP7 C;  2NVX K;  3S1N C;  4C3I K;  2NVX C;  4A3I K;  1SMY A;  1TWA K;  4BBR K;  2A68 A;  2NVT K;  4OIO A;  4BBR C;  2PMZ L;  4A3F K;  4BY1 K;  2JA7 K;  3H3V D;  4MQ9 A;  1Y1W K;  3GTO K;  4G7H A;  4Y7N C;  1I6H C;  1BDF A;  4OIP A;  4X6A K;  3I4M C;  4A3M K;  1Y1V K;  2A6E A;  4MEY A;  1YNN A;  3S1Q K;  2B63 K;  4BY7 C;  3S1R K;  4G7Z A;  2JA8 K;  1TWC K;  3M3Y K;  2B63 C;  3GTQ K;  5C3E K;  2R7Z K;  1K83 K;  3S1R C;  3K7A K;  1SFO K;  2JA8 C;  3M3Y C;  3GTQ C;  4BBS K;  4Q4Z A;  4ZH4 A;  2E2H K;  2E2J C;  4A3E C;  4Y52 C;  4XSZ A;  3I4N C;  3GTG K;  5IYC K;  2VUM C;  3GTG C;  5IYC C;  1ZYR A;  3HOW C;  2PA8 L;  2WB1 L;  4YG2 A;  3HOY K;  2Y0S L;  3EQL A;  3HOV K;  5C4J C;  3HOY C;  2NVQ C;  3PO2 K;  5IYB K;  3HOV C;  5M3M K;  2E2I K;  4LK0 A;  5IYB C;  3PO2 C;  2E2I C;  4Y7N K;  1I6H K;  4NOI A;  3HKZ L;  4LK1 A;  5C4X K;  4A3K C;  2R92 C;  3I4M K;  1R9T C;  2WAQ L;  3GTJ K;  3GTP K;  2R93 C;  1I6V A;  5C4X C;  3DXJ A;  3M4O K;  5M5W K;  3GTJ C;  3GTP C;  4YFK A;  4BXX K;  4BY7 K;  3M4O C;  4QIW L;  5M5Y K;  3PO3 C;  4GZY A;  2E2J K;  4A3E K;  4Y52 K;  3GTM K;  3S14 C;  4A3J C;  4AYB D;  3I4N K;  4C2M K;  3GTM C;  4A93 C;  2VUM K;  3HOX K;  2O5J A;  3RZO C;  3S2H K;  3HOW K;  4LLG A;  5M3F K;  3S17 C;  4KN4 A;  3HOX C;  3GTL K;  3HOU C;  3S2H C;  5FJ8 K;  4A3D C;  3S2D C;  5C4J K;  4JK1 A;  4XLP A;  3CQZ C;  2NVQ K;  4BXX C;  4MEX A;  3H3V L;  1TWH K;  1I50 K;  3S1M C;  2PMZ D;  4OIQ A;  1TWH C;  1I50 C;  2JA6 C;  4A3K K;  2R92 K;  3HOZ C;  3S15 C;  4A3C K;  1R9T K;  2R93 K;  2YU9 C;  4A3C C;  4G7O A;  5IP9 K;  4OIR A;  1I3Q C;  4C3J K;  4A3B K;  3S16 K;  5IP9 C;  3GTK K;  4A3B C;  3S16 C;  3GTK C;  3GTL C;  3PO3 K;  4QJV A;  3S14 K;  2O5I A;  4A3J K;  4A3L K;  4XLN A;  2JA5 C;  4A3L C;  1HQM A;  4A93 K;  2A6H A;  4A3G C;  5IYD C;  3RZO K;  1TWF C;  2NVY C;  5TMC A;  3S17 K;  3HOU K;  2PPB A;  4A3D K;  4A3I C;  3S1Q C;  1TWA C;  5TMF A;  2PA8 D;  2BE5 A;  2WB1 D;  3CQZ K;  3S2D K;  4LJZ A;  2Y0S D;  3RZD K;  2NVT C;  4QJV B;  3RZD C;  4KN7 A;  4C3H K;  3S1M K;  4A3F C;  4BY1 C;  3H0G K;  1YNJ A;  2CW0 A;  1Y1W C;  2JA7 C;  3GTO C;  5C44 K;  4YFX A;  2JA6 K;  3H0G C;  1IW7 A;  3HOZ K;  5C44 C;  3S15 K;  4X6A C;  1TWG K;  1WCM K;  4Q5S A;  2YU9 K;  3HKZ D;  1Y1V C;  4A3M C;  1I3Q K;  1TWG C;  1WCM C;  2WAQ D;  4YFN A;  4OIN A;  1XPP A;  5D4D A;  5M5X K;  1TWC C;  3WOD A;  5FLM K;  2R7Z C;  4XSX A;  5C3E C;  1K83 C;  4KMU A;  3K7A C;  4QIW D;  5FLM C;  3FKI K;  1SFO C;  4AYB L;  4BBS C;  2JA5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...