3HOXK

Complete rna polymerase ii elongation complex v
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hoxK00
2R7ZC 1TWCK 3GTPK 4Q5SA 2CW0A 3S15C 5C3EK 1IW7A 4C2MK 3K7AC 2E2JC 2JA6C 4YFKA 1HQMA 3DXJA 4A3JK 4A3IC 2E2IC 2E2HK 3S2HC 3S17C 4BY7K 1WCMC 4A3KC 4Y52C 4A3FK 3S16C 2WAQD 3WODA 3GTJK 1I6HC 4OIQA 4MQ9A 4Y7NK 2NVYC 3S2DK 3GTLK 3H0GC 2PMZL 3HKZD 1ZYRA 2YU9C 3HOWC 2NVXK 5FJ8K 2O5IA 4KN4A 2VUMC 2A6EA 1K83K 1I3QK 3GTOK 4QIWD 5C4JK 4QJVA 4A3EC 3CQZC 2Y0SD 4A3MC 3HOUC 1TWFC 5IYCC 2WAQL 3RZDK 5C4XK 5C44K 1TWGC 2B63C 3GTMC 3HOZK 4QJVB 4BBRK 4OIRA 4BBSK 2A69A 2PA8L 4LJZA 4AYBD 3S1RK 1I50C 4G7HA 4A3BC 4A3DK 1Y1VK 5FLMC 2JA8K 2JA5K 2E2HC 4A93K 1Y1WK 1TWHC 5IYBK 3S1QK 4X6AK 4A3LC 3I4MK 4NOIA 3S1NK 4A3GK 4QIWL 3M3YK 4OIPA 1BDFA 5TMCA 3HOXC 3HOYK 4GZYA 2Y0SL 4BXXC 3FKIK 4LLGA 5M3MK 4YFNA 1R9TC 4BY1C 2NVQK 2NVTK 1SMYA 5IP9K 5TMFA 4KMUA 4XLPA 1SFOK 3GTGC 2R7ZK 1K83C 3PO2K 2R93C 3S15K 2R92C 1I3QC 5IP7K 3HOVC 3GTOC 5M3FK 3S14K 5C4JC 1YNJA 1TWAC 4MEYA 2A68A 3H3VD 3M4OC 2E2IK 4C3IK 4A3IK 3RZOK 1XPPA 3S2HK 2WB1D 3S17K 1WCMK 4A3KK 3PO3K 3S16K 4Y52K 3S1MC 1TWCC 3GTPC 4LK1A 2JA7K 5C4XC 5C3EC 2O5JA 4G7ZA 3S1RC 3HKZL 4A3DC 1Y1VC 4A3JC 2YU9K 3GTQK 5D4DA 4BY7C 4A3FC 5IYBC 3GTJC 1YNNA 4XLNA 4Y7NC 5IYDK 3S2DC 1I6VA 3GTLC 4A3CK 3S1NC 4A3EK 3M3YC 3GTKK 3I4NK 3HOYC 2PMZD 4XSXA 2NVXC 4A3MK 2NVQC 2WB1L 5M5YK 4G7OA 4YG2A 5IP9C 1TWGK 4OIOA 4C3JK 4AYBL 4LK0A 3K7AK 2A6HA 5IP7C 2E2JK 1I50K 2JA6K 4A3BK 3S14C 5FLMK 4OINA 3RZOC 4ZH4A 5M5XK 1TWHK 4Q4ZA 4JK1A 4KN7A 3RZDC 3PO3C 5C44C 4A3LK 1I6HK 3HOZC 4BBRC 2JA7C 4BBSC 2NVYK 4XSZA 3PO2C 4YFXA 2PA8D 3EQLA 3H0GK 3HOXK 4MEXA 2JA8C 3HOWK 2JA5C 3GTQC 4BXXK 4A93C 2VUMK 1R9TK 1Y1WC 4BY1K 3S1QC 4X6AC 3I4MC 3GTGK 2R93K 3GTMK 4C3HK 2PPBA 2R92K 3HOVK 4A3GC 5IYDC 4A3CC 3CQZK 1TWAK 3H3VL 3GTKC 3I4NC 3M4OK 3FKIC 3HOUK 2BE5A 1TWFK 5IYCK 2NVTC 5M5WK 2B63K 1SFOC 3S1MK
chains in the Genus database with same CATH superfamily
4Q5SA 3S15C 4C2MK 3K7AC 2E2JC 2JA6C 1HQMA 1WCMC 4Y52C 3GEEA 2WAQD 4G0WA 2ZFZA 4GTFA 4P5BA 4KB2A 3H0GC 1EQRA 1G51A 1WOSA 3HOWC 2EBBA 1F7UA 4GFQA 1SFOA 4QIWD 3AH5A 1IS1A 3BP3A 1XZQA 4AH6A 2Y0SD 1INNA 1WCMA 5C44K 2W7VA 3GTMC 2A69A 2PA8L 1DCPA 2PHCB 4LJZA 1I50C 1JQWA 3N0CA 2E2HC 1EH1A 1Y1WK 5JFEA 3I4MK 4KDDA 3SZZA 3G4CA 4OIPA 1C0AA 2NVQK 4G0VA 4YFNA 1R9TC 2JH3A 4BY1C 3FOFA 3GIRA 3PO2K 1SFOK 1PJ5A 1K83C 3S15K 4C3HC 1I3QC 5IP7K 3GTOC 1WQHA 2ZUEA 5C4JC 4MEYA 1I50A 3BUEA 4WILA 1WCMK 4Y52K 2V6SA 3GTPC 5C4XC 5L46A 2NVYA 3L4KA 3S1RC 4A3DC 4A3JC 2YU9A 4P5AA 2VUMA 1R9TA 5IOTA 3FHZA 1VH2A 2XCRB 3S2DC 1HI9A 3HOYC 3LAPA 2WB1L 2P8TA 4BLBA 4AYBL 3GTPA 2A6HA 1I50K 1WOOA 1KQ4A 4PAAA 1TWHA 4KN7A 1I6HK 3L4JA 5IORA 4BBRC 2NVYK 3T02A 3PO2C 2PA8D 4MEXA 2FQOA 4A93C 1WOPA 2VUMK 1R9TK 4BY1K 2Y3PA 1XZPA 1O24A 4C3HK 4A3GC 5IYDC 3I4NC 3FKIC 3HOUK 5EGHA 2GSOA 4KC6A 3GSIA 2R7ZC 3GTPK 2CW0A 1VGXA 1PJ7A 4BLAA 1XXBA 3DXJA 1Y1VA 3A8KA 4A3JK 4A3IC 2E2IC 3S17C 2P5MA 4WJ4A 4MQ9A 4DDQA 3S2DK 1IL2A 1ZYRA 1O28A 3SZYA 5E68A 5FJ8K 4KN4A 3FKIA 3T00A 2V6TA 4KMDA 3OPFA 4RMFA 3QX3A 1JOEA 3ADAC 2E2IA 1F9NA 4J3NA 5IYCC 4KMHA 2B63C 1TWGC 4BBRK 4KAWX 2JA7A 4AYBD 4G7HA 1Y1VK 1DD5A 4A93K 3TFJA 4LR2A 5IYBK 1Y1WA 4A3LC 5IOSA 3BP8C 1J6XA 3S1NK 4A3GK 4GTDA 3NUHA 3HOXC 4BXXC 3FKIK 4BKWA 1B4BA 2GSUA 2R7ZK 4FZBA 1TWGA 3S14K 2D6FC 1O27A 1YNJA 2JA6A 3M4OC 2E2IK 4A3IK 3RZOK 3S17K 1TWCC 4KMAA 2JA7K 4GTEA 1X31C 5C3EC 4G7ZA 3N3YA 2FQTA 3HKZL 3H0GA 5D4DA 3FOEA 3GTJC 4XLNA 4Y7NC 1VJEA 1YX2A 3GTLC 4A3CK 3M3YC 1O2BA 4XSXA 1USOA 4GTBA 5TJ3A 1BJTA 4G7OA 4YG2A 5IP9C 1TWGK 1BGWA 3GTMA 1TWCA 1UV7A 3K7AK 2E2JK 2JA6K 4OINA 4C3IC 2E2HA 1ISEA 5CJ9A 4JK1A 3PO3C 3RZDC 1F7VA 4A3LK 3GTJA 4BBSC 4YFXA 3H0GK 3HOXK 3HOWK 1O29A 2JA5C 3GTQC 1ZVUA 4BXXK 3S1QC 1WQGA 4X6AC 2ZUFA 4LOWA 1K83A 2PPBA 1I3QA 3GTOA 3AQOA 3H3VL 3GTKC 3M4OK 2BE5A 5M5WK 3GTMK 1TWCK 5C3EK 1XZQB 1O26A 1USMA 3S2HC 2E2HK 4A3KC 2JA5A 4M1XA 3GTJK 1J6WA 3AQPA 4Y7NK 3AD9C 3GTLK 2PMZL 1IE0A 3HKZD 2O5IA 3IPJA 1K83K 1I3QK 1O2AA 3TTGA 1L0WA 5HL8A 3GTOK 5C4JK 3CQZC 4KASA 4KM8A 1WSRA 4A3MC 2V6UA 1TWFC 2WAQL 3RZDK 5C4XK 4C3JC 4QJVB 4BBSK 3S1RK 4A3BC 4GTLA 4A3DK 2CFAB 2JA5K 3S1QK 4X6AK 4NOIA 3N0BA 4QIWL 4ILDA 3HOYK 4GZYA 1F93A 2Y0SL 4LLGA 1SMYA 5TMFA 4XLPA 4KMUA 2R93C 2R7ZA 2GSNA 5M3FK 3MMLB 2A68A 3H3VD 3S2HK 1XPPA 2WB1D 1AB4A 3T01A 4A3KK 1BS2A 4LK1A 3G4AA 5EGEA 1YCLA 4BY7C 4A3FC 2R93A 5IYDK 1I6VA 3TFIA 3I4NK 2PMZD 2NVXC 4A3MK 2NVQC 1V5VA 1XZPB 2B63A 4OIOA 4LQYA 4C3JK 1VLOA 5IP7C 4G0UA 4A3BK 3A8JA 4ZH4A 1GE9A 1J98A 3HOZC 3LAJA 3S0XA 4KARA 3EQLA 1ZBSA 4PABA 2JA8C 4O2DA 2NVXA 2XCQA 2R93K 4KB4A 1DCHA 1XXAA 5IYCK 2NVTC 3OEPA 2B63K 1EI6A 1IW7A 1PJ6A 1XXCA 4YFKA 1O2FB 4BY7K 3S16C 4A3FK 3WODA 1I6HC 1RU0A 4OIQA 4GTAA 1SFOC 4GTCA 2NVYC 4XCHA 3GTLA 2YU9C 4GT9A 2NVXK 2KWAA 2VUMC 2A6EA 3A8IA 5CHPA 3LPXA 3ERED 4A3EC 4QJVA 1DCOA 1WORA 3HOUC 1EFWA 2CFAA 1J6VA 3HOZK 4OIRA 4KM9A 5FLMC 1WIHA 4C45A 2JA8K 3GTQA 1TWHC 2RH6A 1O25A 3HXAA 3V4GA 3M3YK 1BDFA 1IQ0A 5TMCA 2GAGC 5JVOA 3GTKA 5M3MK 3GEHA 1ZXOA 2NVTK 5IP9K 3GTGC 2R92C 3HOVC 1TWAC 1EK8A 1JVIA 4C3IK 4FM9A 2RGRA 3PO3K 3S16K 3S1MC 2O5JA 4C2MC 3GDZA 1VRQC 1WSVA 1Y1VC 2YU9K 3GTQK 2XCOA 5IYBC 1YNNA 3TFHA 3GTGA 3S1NC 2R92A 4A3EK 3GTKK 3CQZA 1TWAA 5IOQA 1TWFA 5M5YK 3OREA 4LK0A 3AD8C 4P9SA 3AD7C 3S14C 5FLMK 3JSTA 3RZOC 5M5XK 1TWHK 1ZQ1C 4Q4ZA 4KATA 5C44C 2JA7C 4XSZA 3CAGA 3VA7A 2GAHC 1WQFA 1Y1WC 1IBAA 3I4MC 3GTGK 2R92K 3HOVK 4WJ3M 4A3CC 3CQZK 1TWAK 1B4AA 1TWFK 3Q3QA 3GEIA 3S1MK
chains in the Genus database with same CATH topology
2R7ZC 1TWCK 3GTPK 4Q5SA 2CW0A 3S15C 5C3EK 1IW7A 4C2MK 3K7AC 2E2JC 2JA6C 4YFKA 1HQMA 3DXJA 4A3JK 4A3IC 2E2IC 2E2HK 3S2HC 3S17C 4BY7K 1WCMC 4A3KC 4Y52C 4A3FK 3S16C 2WAQD 3WODA 3GTJK 1I6HC 4OIQA 4MQ9A 4Y7NK 2NVYC 3S2DK 3GTLK 3H0GC 2PMZL 3HKZD 1ZYRA 2YU9C 3HOWC 2NVXK 5FJ8K 2O5IA 4KN4A 2VUMC 2A6EA 1K83K 1I3QK 3GTOK 4QIWD 5C4JK 4QJVA 4A3EC 3CQZC 2Y0SD 4A3MC 3HOUC 1TWFC 5IYCC 2WAQL 3RZDK 5C4XK 5C44K 1TWGC 2B63C 3GTMC 3HOZK 4QJVB 4BBRK 4OIRA 4BBSK 2A69A 2PA8L 4LJZA 4AYBD 3S1RK 1I50C 4G7HA 4A3BC 4A3DK 1Y1VK 5FLMC 2JA8K 2JA5K 2E2HC 4A93K 1Y1WK 1TWHC 5IYBK 3S1QK 4X6AK 4A3LC 3I4MK 4NOIA 3S1NK 4A3GK 4QIWL 3M3YK 4OIPA 1BDFA 5TMCA 3HOXC 3HOYK 4GZYA 2Y0SL 4BXXC 3FKIK 4LLGA 5M3MK 4YFNA 1R9TC 4BY1C 2NVQK 2NVTK 1SMYA 5IP9K 5TMFA 4KMUA 4XLPA 1SFOK 3GTGC 2R7ZK 1K83C 3PO2K 2R93C 3S15K 2R92C 1I3QC 5IP7K 3HOVC 3GTOC 5M3FK 3S14K 5C4JC 1YNJA 1TWAC 4MEYA 2A68A 3H3VD 3M4OC 2E2IK 4C3IK 4A3IK 3RZOK 1XPPA 3S2HK 2WB1D 3S17K 1WCMK 4A3KK 3PO3K 3S16K 4Y52K 3S1MC 1TWCC 3GTPC 4LK1A 2JA7K 5C4XC 5C3EC 2O5JA 4G7ZA 3S1RC 3HKZL 4A3DC 1Y1VC 4A3JC 2YU9K 3GTQK 5D4DA 4BY7C 4A3FC 5IYBC 3GTJC 1YNNA 4XLNA 4Y7NC 5IYDK 3S2DC 1I6VA 3GTLC 4A3CK 3S1NC 4A3EK 3M3YC 3GTKK 3I4NK 3HOYC 2PMZD 4XSXA 2NVXC 4A3MK 2NVQC 2WB1L 5M5YK 4G7OA 4YG2A 5IP9C 1TWGK 4OIOA 4C3JK 4AYBL 4LK0A 3K7AK 2A6HA 5IP7C 2E2JK 1I50K 2JA6K 4A3BK 3S14C 5FLMK 4OINA 3RZOC 4ZH4A 5M5XK 1TWHK 4Q4ZA 4JK1A 4KN7A 3RZDC 3PO3C 5C44C 4A3LK 1I6HK 3HOZC 4BBRC 2JA7C 4BBSC 2NVYK 4XSZA 3PO2C 4YFXA 2PA8D 3EQLA 3H0GK 3HOXK 4MEXA 2JA8C 3HOWK 2JA5C 3GTQC 4BXXK 4A93C 2VUMK 1R9TK 1Y1WC 4BY1K 3S1QC 4X6AC 3I4MC 3GTGK 2R93K 3GTMK 4C3HK 2PPBA 2R92K 3HOVK 4A3GC 5IYDC 4A3CC 3CQZK 1TWAK 3H3VL 3GTKC 3I4NC 3M4OK 3FKIC 3HOUK 2BE5A 1TWFK 5IYCK 2NVTC 5M5WK 2B63K 1SFOC 3S1MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z C;  1TWC K;  3GTP K;  4Q5S A;  2CW0 A;  3S15 C;  5C3E K;  1IW7 A;  4C2M K;  3K7A C;  2E2J C;  2JA6 C;  4YFK A;  1HQM A;  3DXJ A;  4A3J K;  4A3I C;  2E2I C;  2E2H K;  3S2H C;  3S17 C;  4BY7 K;  1WCM C;  4A3K C;  4Y52 C;  4A3F K;  3S16 C;  2WAQ D;  3WOD A;  3GTJ K;  1I6H C;  4OIQ A;  4MQ9 A;  4Y7N K;  2NVY C;  3S2D K;  3GTL K;  3H0G C;  2PMZ L;  3HKZ D;  1ZYR A;  2YU9 C;  3HOW C;  2NVX K;  5FJ8 K;  2O5I A;  4KN4 A;  2VUM C;  2A6E A;  1K83 K;  1I3Q K;  3GTO K;  4QIW D;  5C4J K;  4QJV A;  4A3E C;  3CQZ C;  2Y0S D;  4A3M C;  3HOU C;  1TWF C;  5IYC C;  2WAQ L;  3RZD K;  5C4X K;  5C44 K;  1TWG C;  2B63 C;  3GTM C;  3HOZ K;  4QJV B;  4BBR K;  4OIR A;  4BBS K;  2A69 A;  2PA8 L;  4LJZ A;  4AYB D;  3S1R K;  1I50 C;  4G7H A;  4A3B C;  4A3D K;  1Y1V K;  5FLM C;  2JA8 K;  2JA5 K;  2E2H C;  4A93 K;  1Y1W K;  1TWH C;  5IYB K;  3S1Q K;  4X6A K;  4A3L C;  3I4M K;  4NOI A;  3S1N K;  4A3G K;  4QIW L;  3M3Y K;  4OIP A;  1BDF A;  5TMC A;  3HOX C;  3HOY K;  4GZY A;  2Y0S L;  4BXX C;  3FKI K;  4LLG A;  5M3M K;  4YFN A;  1R9T C;  4BY1 C;  2NVQ K;  2NVT K;  1SMY A;  5IP9 K;  5TMF A;  4KMU A;  4XLP A;  1SFO K;  3GTG C;  2R7Z K;  1K83 C;  3PO2 K;  2R93 C;  3S15 K;  2R92 C;  1I3Q C;  5IP7 K;  3HOV C;  3GTO C;  5M3F K;  3S14 K;  5C4J C;  1YNJ A;  1TWA C;  4MEY A;  2A68 A;  3H3V D;  3M4O C;  2E2I K;  4C3I K;  4A3I K;  3RZO K;  1XPP A;  3S2H K;  2WB1 D;  3S17 K;  1WCM K;  4A3K K;  3PO3 K;  3S16 K;  4Y52 K;  3S1M C;  1TWC C;  3GTP C;  4LK1 A;  2JA7 K;  5C4X C;  5C3E C;  2O5J A;  4G7Z A;  3S1R C;  3HKZ L;  4A3D C;  1Y1V C;  4A3J C;  2YU9 K;  3GTQ K;  5D4D A;  4BY7 C;  4A3F C;  5IYB C;  3GTJ C;  1YNN A;  4XLN A;  4Y7N C;  5IYD K;  3S2D C;  1I6V A;  3GTL C;  4A3C K;  3S1N C;  4A3E K;  3M3Y C;  3GTK K;  3I4N K;  3HOY C;  2PMZ D;  4XSX A;  2NVX C;  4A3M K;  2NVQ C;  2WB1 L;  5M5Y K;  4G7O A;  4YG2 A;  5IP9 C;  1TWG K;  4OIO A;  4C3J K;  4AYB L;  4LK0 A;  3K7A K;  2A6H A;  5IP7 C;  2E2J K;  1I50 K;  2JA6 K;  4A3B K;  3S14 C;  5FLM K;  4OIN A;  3RZO C;  4ZH4 A;  5M5X K;  1TWH K;  4Q4Z A;  4JK1 A;  4KN7 A;  3RZD C;  3PO3 C;  5C44 C;  4A3L K;  1I6H K;  3HOZ C;  4BBR C;  2JA7 C;  4BBS C;  2NVY K;  4XSZ A;  3PO2 C;  4YFX A;  2PA8 D;  3EQL A;  3H0G K;  3HOX K;  4MEX A;  2JA8 C;  3HOW K;  2JA5 C;  3GTQ C;  4BXX K;  4A93 C;  2VUM K;  1R9T K;  1Y1W C;  4BY1 K;  3S1Q C;  4X6A C;  3I4M C;  3GTG K;  2R93 K;  3GTM K;  4C3H K;  2PPB A;  2R92 K;  3HOV K;  4A3G C;  5IYD C;  4A3C C;  3CQZ K;  1TWA K;  3H3V L;  3GTK C;  3I4N C;  3M4O K;  3FKI C;  3HOU K;  2BE5 A;  1TWF K;  5IYC K;  2NVT C;  5M5W K;  2B63 K;  1SFO C;  3S1M K; 
#chains in the Genus database with same CATH topology
 4Q5S A;  3S15 C;  4C2M K;  3K7A C;  2E2J C;  2JA6 C;  1HQM A;  1WCM C;  4Y52 C;  3GEE A;  2WAQ D;  4G0W A;  2ZFZ A;  4GTF A;  4P5B A;  4KB2 A;  3H0G C;  1EQR A;  1G51 A;  1WOS A;  3HOW C;  2EBB A;  1F7U A;  4GFQ A;  1SFO A;  4QIW D;  3AH5 A;  1IS1 A;  3BP3 A;  1XZQ A;  4AH6 A;  2Y0S D;  1INN A;  1WCM A;  5C44 K;  2W7V A;  3GTM C;  2A69 A;  2PA8 L;  1DCP A;  2PHC B;  4LJZ A;  1I50 C;  1JQW A;  3N0C A;  2E2H C;  1EH1 A;  1Y1W K;  5JFE A;  3I4M K;  4KDD A;  3SZZ A;  3G4C A;  4OIP A;  1C0A A;  2NVQ K;  4G0V A;  4YFN A;  1R9T C;  2JH3 A;  4BY1 C;  3FOF A;  3GIR A;  3PO2 K;  1SFO K;  1PJ5 A;  1K83 C;  3S15 K;  4C3H C;  1I3Q C;  5IP7 K;  3GTO C;  1WQH A;  2ZUE A;  5C4J C;  4MEY A;  1I50 A;  3BUE A;  4WIL A;  1WCM K;  4Y52 K;  2V6S A;  3GTP C;  5C4X C;  5L46 A;  2NVY A;  3L4K A;  3S1R C;  4A3D C;  4A3J C;  2YU9 A;  4P5A A;  2VUM A;  1R9T A;  5IOT A;  3FHZ A;  1VH2 A;  2XCR B;  3S2D C;  1HI9 A;  3HOY C;  3LAP A;  2WB1 L;  2P8T A;  4BLB A;  4AYB L;  3GTP A;  2A6H A;  1I50 K;  1WOO A;  1KQ4 A;  4PAA A;  1TWH A;  4KN7 A;  1I6H K;  3L4J A;  5IOR A;  4BBR C;  2NVY K;  3T02 A;  3PO2 C;  2PA8 D;  4MEX A;  2FQO A;  4A93 C;  1WOP A;  2VUM K;  1R9T K;  4BY1 K;  2Y3P A;  1XZP A;  1O24 A;  4C3H K;  4A3G C;  5IYD C;  3I4N C;  3FKI C;  3HOU K;  5EGH A;  2GSO A;  4KC6 A;  3GSI A;  2R7Z C;  3GTP K;  2CW0 A;  1VGX A;  1PJ7 A;  4BLA A;  1XXB A;  3DXJ A;  1Y1V A;  3A8K A;  4A3J K;  4A3I C;  2E2I C;  3S17 C;  2P5M A;  4WJ4 A;  4MQ9 A;  4DDQ A;  3S2D K;  1IL2 A;  1ZYR A;  1O28 A;  3SZY A;  5E68 A;  5FJ8 K;  4KN4 A;  3FKI A;  3T00 A;  2V6T A;  4KMD A;  3OPF A;  4RMF A;  3QX3 A;  1JOE A;  3ADA C;  2E2I A;  1F9N A;  4J3N A;  5IYC C;  4KMH A;  2B63 C;  1TWG C;  4BBR K;  4KAW X;  2JA7 A;  4AYB D;  4G7H A;  1Y1V K;  1DD5 A;  4A93 K;  3TFJ A;  4LR2 A;  5IYB K;  1Y1W A;  4A3L C;  5IOS A;  3BP8 C;  1J6X A;  3S1N K;  4A3G K;  4GTD A;  3NUH A;  3HOX C;  4BXX C;  3FKI K;  4BKW A;  1B4B A;  2GSU A;  2R7Z K;  4FZB A;  1TWG A;  3S14 K;  2D6F C;  1O27 A;  1YNJ A;  2JA6 A;  3M4O C;  2E2I K;  4A3I K;  3RZO K;  3S17 K;  1TWC C;  4KMA A;  2JA7 K;  4GTE A;  1X31 C;  5C3E C;  4G7Z A;  3N3Y A;  2FQT A;  3HKZ L;  3H0G A;  5D4D A;  3FOE A;  3GTJ C;  4XLN A;  4Y7N C;  1VJE A;  1YX2 A;  3GTL C;  4A3C K;  3M3Y C;  1O2B A;  4XSX A;  1USO A;  4GTB A;  5TJ3 A;  1BJT A;  4G7O A;  4YG2 A;  5IP9 C;  1TWG K;  1BGW A;  3GTM A;  1TWC A;  1UV7 A;  3K7A K;  2E2J K;  2JA6 K;  4OIN A;  4C3I C;  2E2H A;  1ISE A;  5CJ9 A;  4JK1 A;  3PO3 C;  3RZD C;  1F7V A;  4A3L K;  3GTJ A;  4BBS C;  4YFX A;  3H0G K;  3HOX K;  3HOW K;  1O29 A;  2JA5 C;  3GTQ C;  1ZVU A;  4BXX K;  3S1Q C;  1WQG A;  4X6A C;  2ZUF A;  4LOW A;  1K83 A;  2PPB A;  1I3Q A;  3GTO A;  3AQO A;  3H3V L;  3GTK C;  3M4O K;  2BE5 A;  5M5W K;  3GTM K;  1TWC K;  5C3E K;  1XZQ B;  1O26 A;  1USM A;  3S2H C;  2E2H K;  4A3K C;  2JA5 A;  4M1X A;  3GTJ K;  1J6W A;  3AQP A;  4Y7N K;  3AD9 C;  3GTL K;  2PMZ L;  1IE0 A;  3HKZ D;  2O5I A;  3IPJ A;  1K83 K;  1I3Q K;  1O2A A;  3TTG A;  1L0W A;  5HL8 A;  3GTO K;  5C4J K;  3CQZ C;  4KAS A;  4KM8 A;  1WSR A;  4A3M C;  2V6U A;  1TWF C;  2WAQ L;  3RZD K;  5C4X K;  4C3J C;  4QJV B;  4BBS K;  3S1R K;  4A3B C;  4GTL A;  4A3D K;  2CFA B;  2JA5 K;  3S1Q K;  4X6A K;  4NOI A;  3N0B A;  4QIW L;  4ILD A;  3HOY K;  4GZY A;  1F93 A;  2Y0S L;  4LLG A;  1SMY A;  5TMF A;  4XLP A;  4KMU A;  2R93 C;  2R7Z A;  2GSN A;  5M3F K;  3MML B;  2A68 A;  3H3V D;  3S2H K;  1XPP A;  2WB1 D;  1AB4 A;  3T01 A;  4A3K K;  1BS2 A;  4LK1 A;  3G4A A;  5EGE A;  1YCL A;  4BY7 C;  4A3F C;  2R93 A;  5IYD K;  1I6V A;  3TFI A;  3I4N K;  2PMZ D;  2NVX C;  4A3M K;  2NVQ C;  1V5V A;  1XZP B;  2B63 A;  4OIO A;  4LQY A;  4C3J K;  1VLO A;  5IP7 C;  4G0U A;  4A3B K;  3A8J A;  4ZH4 A;  1GE9 A;  1J98 A;  3HOZ C;  3LAJ A;  3S0X A;  4KAR A;  3EQL A;  1ZBS A;  4PAB A;  2JA8 C;  4O2D A;  2NVX A;  2XCQ A;  2R93 K;  4KB4 A;  1DCH A;  1XXA A;  5IYC K;  2NVT C;  3OEP A;  2B63 K;  1EI6 A;  1IW7 A;  1PJ6 A;  1XXC A;  4YFK A;  1O2F B;  4BY7 K;  3S16 C;  4A3F K;  3WOD A;  1I6H C;  1RU0 A;  4OIQ A;  4GTA A;  1SFO C;  4GTC A;  2NVY C;  4XCH A;  3GTL A;  2YU9 C;  4GT9 A;  2NVX K;  2KWA A;  2VUM C;  2A6E A;  3A8I A;  5CHP A;  3LPX A;  3ERE D;  4A3E C;  4QJV A;  1DCO A;  1WOR A;  3HOU C;  1EFW A;  2CFA A;  1J6V A;  3HOZ K;  4OIR A;  4KM9 A;  5FLM C;  1WIH A;  4C45 A;  2JA8 K;  3GTQ A;  1TWH C;  2RH6 A;  1O25 A;  3HXA A;  3V4G A;  3M3Y K;  1BDF A;  1IQ0 A;  5TMC A;  2GAG C;  5JVO A;  3GTK A;  5M3M K;  3GEH A;  1ZXO A;  2NVT K;  5IP9 K;  3GTG C;  2R92 C;  3HOV C;  1TWA C;  1EK8 A;  1JVI A;  4C3I K;  4FM9 A;  2RGR A;  3PO3 K;  3S16 K;  3S1M C;  2O5J A;  4C2M C;  3GDZ A;  1VRQ C;  1WSV A;  1Y1V C;  2YU9 K;  3GTQ K;  2XCO A;  5IYB C;  1YNN A;  3TFH A;  3GTG A;  3S1N C;  2R92 A;  4A3E K;  3GTK K;  3CQZ A;  1TWA A;  5IOQ A;  1TWF A;  5M5Y K;  3ORE A;  4LK0 A;  3AD8 C;  4P9S A;  3AD7 C;  3S14 C;  5FLM K;  3JST A;  3RZO C;  5M5X K;  1TWH K;  1ZQ1 C;  4Q4Z A;  4KAT A;  5C44 C;  2JA7 C;  4XSZ A;  3CAG A;  3VA7 A;  2GAH C;  1WQF A;  1Y1W C;  1IBA A;  3I4M C;  3GTG K;  2R92 K;  3HOV K;  4WJ3 M;  4A3C C;  3CQZ K;  1TWA K;  1B4A A;  1TWF K;  3Q3Q A;  3GEI A;  3S1M K; 
#chains in the Genus database with same CATH homology
 2R7Z C;  1TWC K;  3GTP K;  4Q5S A;  2CW0 A;  3S15 C;  5C3E K;  1IW7 A;  4C2M K;  3K7A C;  2E2J C;  2JA6 C;  4YFK A;  1HQM A;  3DXJ A;  4A3J K;  4A3I C;  2E2I C;  2E2H K;  3S2H C;  3S17 C;  4BY7 K;  1WCM C;  4A3K C;  4Y52 C;  4A3F K;  3S16 C;  2WAQ D;  3WOD A;  3GTJ K;  1I6H C;  4OIQ A;  4MQ9 A;  4Y7N K;  2NVY C;  3S2D K;  3GTL K;  3H0G C;  2PMZ L;  3HKZ D;  1ZYR A;  2YU9 C;  3HOW C;  2NVX K;  5FJ8 K;  2O5I A;  4KN4 A;  2VUM C;  2A6E A;  1K83 K;  1I3Q K;  3GTO K;  4QIW D;  5C4J K;  4QJV A;  4A3E C;  3CQZ C;  2Y0S D;  4A3M C;  3HOU C;  1TWF C;  5IYC C;  2WAQ L;  3RZD K;  5C4X K;  5C44 K;  1TWG C;  2B63 C;  3GTM C;  3HOZ K;  4QJV B;  4BBR K;  4OIR A;  4BBS K;  2A69 A;  2PA8 L;  4LJZ A;  4AYB D;  3S1R K;  1I50 C;  4G7H A;  4A3B C;  4A3D K;  1Y1V K;  5FLM C;  2JA8 K;  2JA5 K;  2E2H C;  4A93 K;  1Y1W K;  1TWH C;  5IYB K;  3S1Q K;  4X6A K;  4A3L C;  3I4M K;  4NOI A;  3S1N K;  4A3G K;  4QIW L;  3M3Y K;  4OIP A;  1BDF A;  5TMC A;  3HOX C;  3HOY K;  4GZY A;  2Y0S L;  4BXX C;  3FKI K;  4LLG A;  5M3M K;  4YFN A;  1R9T C;  4BY1 C;  2NVQ K;  2NVT K;  1SMY A;  5IP9 K;  5TMF A;  4KMU A;  4XLP A;  1SFO K;  3GTG C;  2R7Z K;  1K83 C;  3PO2 K;  2R93 C;  3S15 K;  2R92 C;  1I3Q C;  5IP7 K;  3HOV C;  3GTO C;  5M3F K;  3S14 K;  5C4J C;  1YNJ A;  1TWA C;  4MEY A;  2A68 A;  3H3V D;  3M4O C;  2E2I K;  4C3I K;  4A3I K;  3RZO K;  1XPP A;  3S2H K;  2WB1 D;  3S17 K;  1WCM K;  4A3K K;  3PO3 K;  3S16 K;  4Y52 K;  3S1M C;  1TWC C;  3GTP C;  4LK1 A;  2JA7 K;  5C4X C;  5C3E C;  2O5J A;  4G7Z A;  3S1R C;  3HKZ L;  4A3D C;  1Y1V C;  4A3J C;  2YU9 K;  3GTQ K;  5D4D A;  4BY7 C;  4A3F C;  5IYB C;  3GTJ C;  1YNN A;  4XLN A;  4Y7N C;  5IYD K;  3S2D C;  1I6V A;  3GTL C;  4A3C K;  3S1N C;  4A3E K;  3M3Y C;  3GTK K;  3I4N K;  3HOY C;  2PMZ D;  4XSX A;  2NVX C;  4A3M K;  2NVQ C;  2WB1 L;  5M5Y K;  4G7O A;  4YG2 A;  5IP9 C;  1TWG K;  4OIO A;  4C3J K;  4AYB L;  4LK0 A;  3K7A K;  2A6H A;  5IP7 C;  2E2J K;  1I50 K;  2JA6 K;  4A3B K;  3S14 C;  5FLM K;  4OIN A;  3RZO C;  4ZH4 A;  5M5X K;  1TWH K;  4Q4Z A;  4JK1 A;  4KN7 A;  3RZD C;  3PO3 C;  5C44 C;  4A3L K;  1I6H K;  3HOZ C;  4BBR C;  2JA7 C;  4BBS C;  2NVY K;  4XSZ A;  3PO2 C;  4YFX A;  2PA8 D;  3EQL A;  3H0G K;  3HOX K;  4MEX A;  2JA8 C;  3HOW K;  2JA5 C;  3GTQ C;  4BXX K;  4A93 C;  2VUM K;  1R9T K;  1Y1W C;  4BY1 K;  3S1Q C;  4X6A C;  3I4M C;  3GTG K;  2R93 K;  3GTM K;  4C3H K;  2PPB A;  2R92 K;  3HOV K;  4A3G C;  5IYD C;  4A3C C;  3CQZ K;  1TWA K;  3H3V L;  3GTK C;  3I4N C;  3M4O K;  3FKI C;  3HOU K;  2BE5 A;  1TWF K;  5IYC K;  2NVT C;  5M5W K;  2B63 K;  1SFO C;  3S1M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...