4A3EK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3eK00
2NVYK 1IW7A 3H0GK 3GTGC 2PPBA 4A3CK 1TWFK 5IYDK 3S2HK 2E2IC 3PO3C 2O5JA 1BDFA 2R7ZC 4G7HA 3HOYK 5TMFA 3PO2K 3GTKK 3RZOK 5IYBC 2R93C 4XSZA 3HOZC 3HKZD 4A3BC 2PMZD 2Y0SD 2JA8K 3M3YK 4Y52K 2E2JK 4KN7A 1TWGC 2B63C 4G7OA 1I6HC 5IP9K 5M3MK 5C44K 2YU9K 1WCMC 4C3HK 3S14C 3HOWC 4X6AC 5IP7K 3S16K 4A3JK 2CW0A 2WAQD 1TWHC 2JA5C 2NVTC 4QJVA 4MEYA 3S15K 3S1MK 1I6VA 3S1QC 1TWAK 4BBRK 3GTQC 2A68A 3K7AC 4C2MK 3RZDK 3GTPK 4A93K 4MEXA 4XSXA 2JA6K 4Y7NC 3CQZK 4C3IK 5IYCK 3S2HC 4YG2A 3HOUK 1HQMA 4BBSK 4A3CC 5C4XK 4BXXC 1K83K 1SMYA 2O5IA 2NVXK 5M5XK 4A3LK 2R92K 2E2HK 4A3KK 4NOIA 3PO2C 4BY7K 3HKZL 1Y1VC 2PMZL 1YNJA 2Y0SL 5M5WK 4Y52C 5M3FK 4A3FK 2JA8C 1Y1WC 2VUMK 3GTMK 2E2JC 3S17K 2NVQK 4A3MC 4AYBD 4A3DK 3GTOC 4A3IK 4QJVB 1SFOK 1I6HK 4C3JK 5C44C 4LLGA 3GTGK 4OIOA 3HOXC 3S2DC 4A3EC 3S1NC 4G7ZA 3PO3K 5C3EK 4ZH4A 2R7ZK 3FKIC 5IP7C 1R9TC 5FLMC 2WAQL 3M4OC 5FJ8K 1I3QC 1I50C 1YNNA 4YFKA 2PA8D 3S15C 3HOZK 3HOVC 4A3BK 1TWAC 4QIWD 3I4MK 1XPPA 3GTJC 5TMCA 4BY1K 3GTPC 4A93C 4A3GK 4OIRA 2NVYC 3H0GC 5IYDC 1TWFC 5IYCC 2BE5A 5C4JK 3GTLC 3I4NK 4XLPA 4BBSC 3HOYC 5C4XC 1TWCK 3S14K 3HOWK 4KN4A 3RZOC 4X6AK 3S1RK 2NVXC 3GTKC 4A3LC 1TWHK 2WB1D 2JA5K 5D4DA 2NVTK 3M3YC 4LK0A 4KMUA 4A3FC 3S1QK 2VUMC 3H3VD 3GTMC 3GTQK 4AYBL 5IP9C 3EQLA 3K7AK 3S17C 2NVQC 2JA7K 2YU9C 4Q4ZA 4A3DC 2A69A 4Y7NK 2E2IK 1ZYRA 3S16C 4A3JC 4BXXK 4OIPA 5C3EC 4JK1A 5IYBK 3S1MC 2R93K 2A6EA 2PA8L 4BBRC 3DXJA 3GTLK 1Y1VK 3RZDC 1TWGK 4QIWL 2B63K 1Y1WK 2JA6C 3CQZC 3I4MC 4A3MK 4BY1C 4Q5SA 4A3GC 3GTOK 1WCMK 3WODA 3HOUC 4YFNA 5M5YK 4OIQA 1K83C 4MQ9A 5C4JC 3I4NC 3HOXK 3S2DK 4LK1A 4A3EK 3S1NK 1TWCC 2R92C 2E2HC 3FKIK 4LJZA 4A3KC 5FLMK 3S1RC 1R9TK 2WB1L 3M4OK 4BY7C 1I3QK 1I50K 4XLNA 4GZYA 3H3VL 4YFXA 3HOVK 4A3IC 1SFOC 2A6HA 3GTJK 4OINA 2JA7C
chains in the Genus database with same CATH superfamily
1X31C 4LQYA 1YX2A 1EK8A 4GFQA 5IYBC 1O27A 3CAGA 3LPXA 3A8IA 1USOA 1WCMC 3Q3QA 3S14C 1J98A 2V6TA 5IP7K 2R92A 4P9SA 2WAQD 2NVTC 3NUHA 4KMAA 3S0XA 4XCHA 4C2MK 3K7AC 1SFOA 4MEXA 2JA6K 4Y7NC 3CQZK 1EI6A 2V6UA 3T02A 1IBAA 1AB4A 3HOUK 3SZYA 1KQ4A 3AQOA 4A3LK 1F7UA 3PO2C 4BY7K 3RZOC 3S17K 4A3DK 3GTOC 1XZPB 1C0AA 4A3EC 3S1NC 4RMFA 2R7ZK 2XCOA 3FKIC 1R9TC 5FLMC 2WAQL 5FJ8K 1I3QC 1BJTA 4YFKA 2PA8D 3S15C 4KASA 3HOZK 3HOVC 3GTQA 1ISEA 1TWAC 4BY1K 4G0VA 3GTPC 1ZXOA 4OIRA 1WQHA 4J3NA 1TWFC 4BBSC 3HOYC 3T01A 1TWCK 2NVXC 5EGEA 1TWHK 2WB1D 5D4DA 2VUMC 3GTMC 1WCMA 3A8KA 2NVQC 2V6SA 4GTBA 5JFEA 2R93K 2PA8L 3GTLK 1Y1VK 3RZDC 1TWGK 1VH2A 3GTJA 3I4MC 2NVYA 3GSIA 4YFNA 3FOFA 1ZQ1C 2R92C 3GTKA 4A3KC 2FQOA 3S1RC 3M4OK 2WB1L 1PJ6A 1I50K 4GZYA 3GEHA 4OINA 1SFOC 2A6HA 2YU9A 3GEEA 3S2HK 1JOEA 1IW7A 3H0GK 4AH6A 5IYDK 1V5VA 3SZZA 2Y3PA 2O5JA 4KMHA 5TMFA 1TWAA 1IL2A 4A3BC 2JA8K 2Y0SD 3M3YK 3GTPA 1IE0A 3ADAC 3GEIA 1XXAA 2EBBA 5IP9K 5C44K 4KB4A 5E68A 4GTFA 4BLBA 3FHZA 3S16K 1TWCA 4A3JK 2E2HA 2CW0A 2VUMA 1XZPA 3S1MK 2GAHC 1USMA 3GTQC 2JH3A 1YCLA 1WQGA 4KATA 5IYCK 3GTGA 4BXXC 1K83K 2R93A 5M3FK 2Y0SL 4KAWX 3N0BA 3TFJA 4A3MC 3JSTA 4C3JK 3HOXC 2GSUA 1IS1A 4ZH4A 2PHCB 5IP7C 2JA5A 1YNNA 3GTJC 3OEPA 2NVYC 1DCPA 3ERED 1L0WA 1WIHA 4GTEA 3I4NK 2P8TA 1DCOA 1XXBA 3S14K 4KN4A 2GSOA 1WORA 3GTKC 4A3LC 2NVTK 3BUEA 4LOWA 4LK0A 4KMUA 1Y1WA 3H3VD 3K7AK 3S17C 2JA7K 5HL8A 4LR2A 2YU9C 4A3DC 4WJ3M 2A69A 4Y7NK 2E2IK 2D6FC 2A6EA 4BBRC 2B63K 4BY1C 3GTOK 3WODA 5M5YK 4OIQA 4MQ9A 4A3EK 3S1NK 4KM9A 1WOPA 1TWCC 2E2HC 3FKIK 1R9TK 2P5MA 5FLMK 1GE9A 1I3QK 1RU0A 3QX3A 1JQWA 1XZQB 3H3VL 1O24A 3GDZA 3HOVK 3G4AA 4A3IC 1I6HC 4PAAA 3GTGC 4A3CK 1TWFK 1B4AA 1WQFA 3PO3C 4G7HA 3HOYK 1VGXA 4XSZA 2R93C 5EGHA 1JVIA 3G4CA 2PMZD 4Y52K 2E2JK 2JA6A 4FZBA 3V4GA 1TWGC 3CQZA 1O28A 1F9NA 3N0CA 4C3HK 4KARA 3HOWC 4X6AC 1O2BA 5JVOA 4G0UA 2JA5C 3AH5A 4DDQA 1I6VA 3S1QC 4M1XA 2A68A 3FOEA 3RZDK 4A93K 4C3IK 2JA7A 5TJ3A 4P5AA 4ILDA 3S2HC 2E2IA 5C4XK 2R7ZA 1SMYA 3TFHA 2R92K 1F93A 4A3KK 2PMZL 5M5WK 4A3FK 2GAGC 3LAJA 4KM8A 1Y1WC 2JA8C 2B63A 1WSVA 4BKWA 3TFIA 4QJVB 1SFOK 3LAPA 2RH6A 5C44C 4LLGA 3AD9C 4WILA 4OIOA 3S2DC 1J6WA 5C3EK 5CJ9A 4GTCA 1F7VA 1TWHA 4C45A 5CHPA 4A3BK 1XPPA 4A3GK 2ZUEA 3OREA 2BE5A 5IYCC 5C4JK 3L4KA 4XLPA 4KMDA 3GTLA 1Y1VA 3AQPA 3BP3A 1TWGA 4GTDA 3GTQK 1DCHA 4BXXK 1XZQA 4G0WA 1I50A 4JK1A 5IYBK 3DXJA 4C2MC 2JA6C 1BGWA 3CQZC 4A3MK 3H0GA 1HI9A 1WCMK 3HOUC 1VJEA 3I4NC 2RGRA 3HOXK 4LK1A 1DD5A 4LJZA 2XCRB 4BY7C 1J6VA 1O2AA 4YFXA 1EFWA 3GTJK 3AD7C 5IOTA 2JA7C 2NVYK 2PPBA 2E2IC 5L46A 1BDFA 2R7ZC 1O26A 3PO2K 3GTKK 3RZOK 3VA7A 3HOZC 3HKZD 4KN7A 2XCQA 2B63C 3MMLB 2KWAA 1EQRA 4G7OA 5M3MK 1VRQC 2YU9K 1K83A 2W7VA 4P5BA 2CFAB 1TWHC 1UV7A 4QJVA 1WOSA 4MEYA 3S15K 1TWAK 4BBRK 3GTPK 4FM9A 4XSXA 3A8JA 1ZBSA 1PJ7A 1INNA 4YG2A 1HQMA 4BBSK 4A3CC 5IORA 1PJ5A 2O5IA 2NVXK 4KB2A 5IOQA 5M5XK 2E2HK 4NOIA 3T00A 3HXAA 3HKZL 1Y1VC 3GTLC 1YNJA 2VUMK 3IPJA 4Y52C 1WOOA 3GTMK 2GSNA 2E2JC 2NVQK 4KDDA 4AYBD 4PABA 3GIRA 4A3IK 1I6HK 3AD8C 1BS2A 3GTGK 4C3HC 1XXCA 4G7ZA 3PO3K 4GTLA 3M4OC 1I50C 1WSRA 4QIWD 3I4MK 5TMCA 4A93C 1VLOA 3H0GC 1J6XA 5IYDC 4C3IC 4O2DA 5C4XC 3HOWK 4X6AK 3S1RK 1IQ0A 4WJ4A 2FQTA 2JA5K 3M3YC 1EH1A 4A3FC 3S1QK 4AYBL 5IP9C 3EQLA 3GTOA 1O29A 4Q4ZA 1ZVUA 1O2FB 4GTAA 2ZFZA 1ZYRA 3S16C 4A3JC 1G51A 3FKIA 4OIPA 5IOSA 5C3EC 1R9TA 3BP8C 1O25A 3L4JA 1I3QA 3S1MC 4GT9A 4BLAA 4QIWL 1Y1WK 3N3YA 4Q5SA 4A3GC 1TWFA 3TTGA 1K83C 5C4JC 3S2DK 1B4BA 2NVXA 4XLNA 3GTMA 4KC6A 2CFAA 3OPFA 2ZUFA 4C3JC
chains in the Genus database with same CATH topology
2NVYK 1IW7A 3H0GK 3GTGC 2PPBA 4A3CK 1TWFK 5IYDK 3S2HK 2E2IC 3PO3C 2O5JA 1BDFA 2R7ZC 4G7HA 3HOYK 5TMFA 3PO2K 3GTKK 3RZOK 5IYBC 2R93C 4XSZA 3HOZC 3HKZD 4A3BC 2PMZD 2Y0SD 2JA8K 3M3YK 4Y52K 2E2JK 4KN7A 1TWGC 2B63C 4G7OA 1I6HC 5IP9K 5M3MK 5C44K 2YU9K 1WCMC 4C3HK 3S14C 3HOWC 4X6AC 5IP7K 3S16K 4A3JK 2CW0A 2WAQD 1TWHC 2JA5C 2NVTC 4QJVA 4MEYA 3S15K 3S1MK 1I6VA 3S1QC 1TWAK 4BBRK 3GTQC 2A68A 3K7AC 4C2MK 3RZDK 3GTPK 4A93K 4MEXA 4XSXA 2JA6K 4Y7NC 3CQZK 4C3IK 5IYCK 3S2HC 4YG2A 3HOUK 1HQMA 4BBSK 4A3CC 5C4XK 4BXXC 1K83K 1SMYA 2O5IA 2NVXK 5M5XK 4A3LK 2R92K 2E2HK 4A3KK 4NOIA 3PO2C 4BY7K 3HKZL 1Y1VC 2PMZL 1YNJA 2Y0SL 5M5WK 4Y52C 5M3FK 4A3FK 2JA8C 1Y1WC 2VUMK 3GTMK 2E2JC 3S17K 2NVQK 4A3MC 4AYBD 4A3DK 3GTOC 4A3IK 4QJVB 1SFOK 1I6HK 4C3JK 5C44C 4LLGA 3GTGK 4OIOA 3HOXC 3S2DC 4A3EC 3S1NC 4G7ZA 3PO3K 5C3EK 4ZH4A 2R7ZK 3FKIC 5IP7C 1R9TC 5FLMC 2WAQL 3M4OC 5FJ8K 1I3QC 1I50C 1YNNA 4YFKA 2PA8D 3S15C 3HOZK 3HOVC 4A3BK 1TWAC 4QIWD 3I4MK 1XPPA 3GTJC 5TMCA 4BY1K 3GTPC 4A93C 4A3GK 4OIRA 2NVYC 3H0GC 5IYDC 1TWFC 5IYCC 2BE5A 5C4JK 3GTLC 3I4NK 4XLPA 4BBSC 3HOYC 5C4XC 1TWCK 3S14K 3HOWK 4KN4A 3RZOC 4X6AK 3S1RK 2NVXC 3GTKC 4A3LC 1TWHK 2WB1D 2JA5K 5D4DA 2NVTK 3M3YC 4LK0A 4KMUA 4A3FC 3S1QK 2VUMC 3H3VD 3GTMC 3GTQK 4AYBL 5IP9C 3EQLA 3K7AK 3S17C 2NVQC 2JA7K 2YU9C 4Q4ZA 4A3DC 2A69A 4Y7NK 2E2IK 1ZYRA 3S16C 4A3JC 4BXXK 4OIPA 5C3EC 4JK1A 5IYBK 3S1MC 2R93K 2A6EA 2PA8L 4BBRC 3DXJA 3GTLK 1Y1VK 3RZDC 1TWGK 4QIWL 2B63K 1Y1WK 2JA6C 3CQZC 3I4MC 4A3MK 4BY1C 4Q5SA 4A3GC 3GTOK 1WCMK 3WODA 3HOUC 4YFNA 5M5YK 4OIQA 1K83C 4MQ9A 5C4JC 3I4NC 3HOXK 3S2DK 4LK1A 4A3EK 3S1NK 1TWCC 2R92C 2E2HC 3FKIK 4LJZA 4A3KC 5FLMK 3S1RC 1R9TK 2WB1L 3M4OK 4BY7C 1I3QK 1I50K 4XLNA 4GZYA 3H3VL 4YFXA 3HOVK 4A3IC 1SFOC 2A6HA 3GTJK 4OINA 2JA7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY K;  1IW7 A;  3H0G K;  3GTG C;  2PPB A;  4A3C K;  1TWF K;  5IYD K;  3S2H K;  2E2I C;  3PO3 C;  2O5J A;  1BDF A;  2R7Z C;  4G7H A;  3HOY K;  5TMF A;  3PO2 K;  3GTK K;  3RZO K;  5IYB C;  2R93 C;  4XSZ A;  3HOZ C;  3HKZ D;  4A3B C;  2PMZ D;  2Y0S D;  2JA8 K;  3M3Y K;  4Y52 K;  2E2J K;  4KN7 A;  1TWG C;  2B63 C;  4G7O A;  1I6H C;  5IP9 K;  5M3M K;  5C44 K;  2YU9 K;  1WCM C;  4C3H K;  3S14 C;  3HOW C;  4X6A C;  5IP7 K;  3S16 K;  4A3J K;  2CW0 A;  2WAQ D;  1TWH C;  2JA5 C;  2NVT C;  4QJV A;  4MEY A;  3S15 K;  3S1M K;  1I6V A;  3S1Q C;  1TWA K;  4BBR K;  3GTQ C;  2A68 A;  3K7A C;  4C2M K;  3RZD K;  3GTP K;  4A93 K;  4MEX A;  4XSX A;  2JA6 K;  4Y7N C;  3CQZ K;  4C3I K;  5IYC K;  3S2H C;  4YG2 A;  3HOU K;  1HQM A;  4BBS K;  4A3C C;  5C4X K;  4BXX C;  1K83 K;  1SMY A;  2O5I A;  2NVX K;  5M5X K;  4A3L K;  2R92 K;  2E2H K;  4A3K K;  4NOI A;  3PO2 C;  4BY7 K;  3HKZ L;  1Y1V C;  2PMZ L;  1YNJ A;  2Y0S L;  5M5W K;  4Y52 C;  5M3F K;  4A3F K;  2JA8 C;  1Y1W C;  2VUM K;  3GTM K;  2E2J C;  3S17 K;  2NVQ K;  4A3M C;  4AYB D;  4A3D K;  3GTO C;  4A3I K;  4QJV B;  1SFO K;  1I6H K;  4C3J K;  5C44 C;  4LLG A;  3GTG K;  4OIO A;  3HOX C;  3S2D C;  4A3E C;  3S1N C;  4G7Z A;  3PO3 K;  5C3E K;  4ZH4 A;  2R7Z K;  3FKI C;  5IP7 C;  1R9T C;  5FLM C;  2WAQ L;  3M4O C;  5FJ8 K;  1I3Q C;  1I50 C;  1YNN A;  4YFK A;  2PA8 D;  3S15 C;  3HOZ K;  3HOV C;  4A3B K;  1TWA C;  4QIW D;  3I4M K;  1XPP A;  3GTJ C;  5TMC A;  4BY1 K;  3GTP C;  4A93 C;  4A3G K;  4OIR A;  2NVY C;  3H0G C;  5IYD C;  1TWF C;  5IYC C;  2BE5 A;  5C4J K;  3GTL C;  3I4N K;  4XLP A;  4BBS C;  3HOY C;  5C4X C;  1TWC K;  3S14 K;  3HOW K;  4KN4 A;  3RZO C;  4X6A K;  3S1R K;  2NVX C;  3GTK C;  4A3L C;  1TWH K;  2WB1 D;  2JA5 K;  5D4D A;  2NVT K;  3M3Y C;  4LK0 A;  4KMU A;  4A3F C;  3S1Q K;  2VUM C;  3H3V D;  3GTM C;  3GTQ K;  4AYB L;  5IP9 C;  3EQL A;  3K7A K;  3S17 C;  2NVQ C;  2JA7 K;  2YU9 C;  4Q4Z A;  4A3D C;  2A69 A;  4Y7N K;  2E2I K;  1ZYR A;  3S16 C;  4A3J C;  4BXX K;  4OIP A;  5C3E C;  4JK1 A;  5IYB K;  3S1M C;  2R93 K;  2A6E A;  2PA8 L;  4BBR C;  3DXJ A;  3GTL K;  1Y1V K;  3RZD C;  1TWG K;  4QIW L;  2B63 K;  1Y1W K;  2JA6 C;  3CQZ C;  3I4M C;  4A3M K;  4BY1 C;  4Q5S A;  4A3G C;  3GTO K;  1WCM K;  3WOD A;  3HOU C;  4YFN A;  5M5Y K;  4OIQ A;  1K83 C;  4MQ9 A;  5C4J C;  3I4N C;  3HOX K;  3S2D K;  4LK1 A;  4A3E K;  3S1N K;  1TWC C;  2R92 C;  2E2H C;  3FKI K;  4LJZ A;  4A3K C;  5FLM K;  3S1R C;  1R9T K;  2WB1 L;  3M4O K;  4BY7 C;  1I3Q K;  1I50 K;  4XLN A;  4GZY A;  3H3V L;  4YFX A;  3HOV K;  4A3I C;  1SFO C;  2A6H A;  3GTJ K;  4OIN A;  2JA7 C; 
#chains in the Genus database with same CATH topology
 1X31 C;  4LQY A;  1YX2 A;  1EK8 A;  4GFQ A;  5IYB C;  1O27 A;  3CAG A;  3LPX A;  3A8I A;  1USO A;  1WCM C;  3Q3Q A;  3S14 C;  1J98 A;  2V6T A;  5IP7 K;  2R92 A;  4P9S A;  2WAQ D;  2NVT C;  3NUH A;  4KMA A;  3S0X A;  4XCH A;  4C2M K;  3K7A C;  1SFO A;  4MEX A;  2JA6 K;  4Y7N C;  3CQZ K;  1EI6 A;  2V6U A;  3T02 A;  1IBA A;  1AB4 A;  3HOU K;  3SZY A;  1KQ4 A;  3AQO A;  4A3L K;  1F7U A;  3PO2 C;  4BY7 K;  3RZO C;  3S17 K;  4A3D K;  3GTO C;  1XZP B;  1C0A A;  4A3E C;  3S1N C;  4RMF A;  2R7Z K;  2XCO A;  3FKI C;  1R9T C;  5FLM C;  2WAQ L;  5FJ8 K;  1I3Q C;  1BJT A;  4YFK A;  2PA8 D;  3S15 C;  4KAS A;  3HOZ K;  3HOV C;  3GTQ A;  1ISE A;  1TWA C;  4BY1 K;  4G0V A;  3GTP C;  1ZXO A;  4OIR A;  1WQH A;  4J3N A;  1TWF C;  4BBS C;  3HOY C;  3T01 A;  1TWC K;  2NVX C;  5EGE A;  1TWH K;  2WB1 D;  5D4D A;  2VUM C;  3GTM C;  1WCM A;  3A8K A;  2NVQ C;  2V6S A;  4GTB A;  5JFE A;  2R93 K;  2PA8 L;  3GTL K;  1Y1V K;  3RZD C;  1TWG K;  1VH2 A;  3GTJ A;  3I4M C;  2NVY A;  3GSI A;  4YFN A;  3FOF A;  1ZQ1 C;  2R92 C;  3GTK A;  4A3K C;  2FQO A;  3S1R C;  3M4O K;  2WB1 L;  1PJ6 A;  1I50 K;  4GZY A;  3GEH A;  4OIN A;  1SFO C;  2A6H A;  2YU9 A;  3GEE A;  3S2H K;  1JOE A;  1IW7 A;  3H0G K;  4AH6 A;  5IYD K;  1V5V A;  3SZZ A;  2Y3P A;  2O5J A;  4KMH A;  5TMF A;  1TWA A;  1IL2 A;  4A3B C;  2JA8 K;  2Y0S D;  3M3Y K;  3GTP A;  1IE0 A;  3ADA C;  3GEI A;  1XXA A;  2EBB A;  5IP9 K;  5C44 K;  4KB4 A;  5E68 A;  4GTF A;  4BLB A;  3FHZ A;  3S16 K;  1TWC A;  4A3J K;  2E2H A;  2CW0 A;  2VUM A;  1XZP A;  3S1M K;  2GAH C;  1USM A;  3GTQ C;  2JH3 A;  1YCL A;  1WQG A;  4KAT A;  5IYC K;  3GTG A;  4BXX C;  1K83 K;  2R93 A;  5M3F K;  2Y0S L;  4KAW X;  3N0B A;  3TFJ A;  4A3M C;  3JST A;  4C3J K;  3HOX C;  2GSU A;  1IS1 A;  4ZH4 A;  2PHC B;  5IP7 C;  2JA5 A;  1YNN A;  3GTJ C;  3OEP A;  2NVY C;  1DCP A;  3ERE D;  1L0W A;  1WIH A;  4GTE A;  3I4N K;  2P8T A;  1DCO A;  1XXB A;  3S14 K;  4KN4 A;  2GSO A;  1WOR A;  3GTK C;  4A3L C;  2NVT K;  3BUE A;  4LOW A;  4LK0 A;  4KMU A;  1Y1W A;  3H3V D;  3K7A K;  3S17 C;  2JA7 K;  5HL8 A;  4LR2 A;  2YU9 C;  4A3D C;  4WJ3 M;  2A69 A;  4Y7N K;  2E2I K;  2D6F C;  2A6E A;  4BBR C;  2B63 K;  4BY1 C;  3GTO K;  3WOD A;  5M5Y K;  4OIQ A;  4MQ9 A;  4A3E K;  3S1N K;  4KM9 A;  1WOP A;  1TWC C;  2E2H C;  3FKI K;  1R9T K;  2P5M A;  5FLM K;  1GE9 A;  1I3Q K;  1RU0 A;  3QX3 A;  1JQW A;  1XZQ B;  3H3V L;  1O24 A;  3GDZ A;  3HOV K;  3G4A A;  4A3I C;  1I6H C;  4PAA A;  3GTG C;  4A3C K;  1TWF K;  1B4A A;  1WQF A;  3PO3 C;  4G7H A;  3HOY K;  1VGX A;  4XSZ A;  2R93 C;  5EGH A;  1JVI A;  3G4C A;  2PMZ D;  4Y52 K;  2E2J K;  2JA6 A;  4FZB A;  3V4G A;  1TWG C;  3CQZ A;  1O28 A;  1F9N A;  3N0C A;  4C3H K;  4KAR A;  3HOW C;  4X6A C;  1O2B A;  5JVO A;  4G0U A;  2JA5 C;  3AH5 A;  4DDQ A;  1I6V A;  3S1Q C;  4M1X A;  2A68 A;  3FOE A;  3RZD K;  4A93 K;  4C3I K;  2JA7 A;  5TJ3 A;  4P5A A;  4ILD A;  3S2H C;  2E2I A;  5C4X K;  2R7Z A;  1SMY A;  3TFH A;  2R92 K;  1F93 A;  4A3K K;  2PMZ L;  5M5W K;  4A3F K;  2GAG C;  3LAJ A;  4KM8 A;  1Y1W C;  2JA8 C;  2B63 A;  1WSV A;  4BKW A;  3TFI A;  4QJV B;  1SFO K;  3LAP A;  2RH6 A;  5C44 C;  4LLG A;  3AD9 C;  4WIL A;  4OIO A;  3S2D C;  1J6W A;  5C3E K;  5CJ9 A;  4GTC A;  1F7V A;  1TWH A;  4C45 A;  5CHP A;  4A3B K;  1XPP A;  4A3G K;  2ZUE A;  3ORE A;  2BE5 A;  5IYC C;  5C4J K;  3L4K A;  4XLP A;  4KMD A;  3GTL A;  1Y1V A;  3AQP A;  3BP3 A;  1TWG A;  4GTD A;  3GTQ K;  1DCH A;  4BXX K;  1XZQ A;  4G0W A;  1I50 A;  4JK1 A;  5IYB K;  3DXJ A;  4C2M C;  2JA6 C;  1BGW A;  3CQZ C;  4A3M K;  3H0G A;  1HI9 A;  1WCM K;  3HOU C;  1VJE A;  3I4N C;  2RGR A;  3HOX K;  4LK1 A;  1DD5 A;  4LJZ A;  2XCR B;  4BY7 C;  1J6V A;  1O2A A;  4YFX A;  1EFW A;  3GTJ K;  3AD7 C;  5IOT A;  2JA7 C;  2NVY K;  2PPB A;  2E2I C;  5L46 A;  1BDF A;  2R7Z C;  1O26 A;  3PO2 K;  3GTK K;  3RZO K;  3VA7 A;  3HOZ C;  3HKZ D;  4KN7 A;  2XCQ A;  2B63 C;  3MML B;  2KWA A;  1EQR A;  4G7O A;  5M3M K;  1VRQ C;  2YU9 K;  1K83 A;  2W7V A;  4P5B A;  2CFA B;  1TWH C;  1UV7 A;  4QJV A;  1WOS A;  4MEY A;  3S15 K;  1TWA K;  4BBR K;  3GTP K;  4FM9 A;  4XSX A;  3A8J A;  1ZBS A;  1PJ7 A;  1INN A;  4YG2 A;  1HQM A;  4BBS K;  4A3C C;  5IOR A;  1PJ5 A;  2O5I A;  2NVX K;  4KB2 A;  5IOQ A;  5M5X K;  2E2H K;  4NOI A;  3T00 A;  3HXA A;  3HKZ L;  1Y1V C;  3GTL C;  1YNJ A;  2VUM K;  3IPJ A;  4Y52 C;  1WOO A;  3GTM K;  2GSN A;  2E2J C;  2NVQ K;  4KDD A;  4AYB D;  4PAB A;  3GIR A;  4A3I K;  1I6H K;  3AD8 C;  1BS2 A;  3GTG K;  4C3H C;  1XXC A;  4G7Z A;  3PO3 K;  4GTL A;  3M4O C;  1I50 C;  1WSR A;  4QIW D;  3I4M K;  5TMC A;  4A93 C;  1VLO A;  3H0G C;  1J6X A;  5IYD C;  4C3I C;  4O2D A;  5C4X C;  3HOW K;  4X6A K;  3S1R K;  1IQ0 A;  4WJ4 A;  2FQT A;  2JA5 K;  3M3Y C;  1EH1 A;  4A3F C;  3S1Q K;  4AYB L;  5IP9 C;  3EQL A;  3GTO A;  1O29 A;  4Q4Z A;  1ZVU A;  1O2F B;  4GTA A;  2ZFZ A;  1ZYR A;  3S16 C;  4A3J C;  1G51 A;  3FKI A;  4OIP A;  5IOS A;  5C3E C;  1R9T A;  3BP8 C;  1O25 A;  3L4J A;  1I3Q A;  3S1M C;  4GT9 A;  4BLA A;  4QIW L;  1Y1W K;  3N3Y A;  4Q5S A;  4A3G C;  1TWF A;  3TTG A;  1K83 C;  5C4J C;  3S2D K;  1B4B A;  2NVX A;  4XLN A;  3GTM A;  4KC6 A;  2CFA A;  3OPF A;  2ZUF A;  4C3J C; 
#chains in the Genus database with same CATH homology
 2NVY K;  1IW7 A;  3H0G K;  3GTG C;  2PPB A;  4A3C K;  1TWF K;  5IYD K;  3S2H K;  2E2I C;  3PO3 C;  2O5J A;  1BDF A;  2R7Z C;  4G7H A;  3HOY K;  5TMF A;  3PO2 K;  3GTK K;  3RZO K;  5IYB C;  2R93 C;  4XSZ A;  3HOZ C;  3HKZ D;  4A3B C;  2PMZ D;  2Y0S D;  2JA8 K;  3M3Y K;  4Y52 K;  2E2J K;  4KN7 A;  1TWG C;  2B63 C;  4G7O A;  1I6H C;  5IP9 K;  5M3M K;  5C44 K;  2YU9 K;  1WCM C;  4C3H K;  3S14 C;  3HOW C;  4X6A C;  5IP7 K;  3S16 K;  4A3J K;  2CW0 A;  2WAQ D;  1TWH C;  2JA5 C;  2NVT C;  4QJV A;  4MEY A;  3S15 K;  3S1M K;  1I6V A;  3S1Q C;  1TWA K;  4BBR K;  3GTQ C;  2A68 A;  3K7A C;  4C2M K;  3RZD K;  3GTP K;  4A93 K;  4MEX A;  4XSX A;  2JA6 K;  4Y7N C;  3CQZ K;  4C3I K;  5IYC K;  3S2H C;  4YG2 A;  3HOU K;  1HQM A;  4BBS K;  4A3C C;  5C4X K;  4BXX C;  1K83 K;  1SMY A;  2O5I A;  2NVX K;  5M5X K;  4A3L K;  2R92 K;  2E2H K;  4A3K K;  4NOI A;  3PO2 C;  4BY7 K;  3HKZ L;  1Y1V C;  2PMZ L;  1YNJ A;  2Y0S L;  5M5W K;  4Y52 C;  5M3F K;  4A3F K;  2JA8 C;  1Y1W C;  2VUM K;  3GTM K;  2E2J C;  3S17 K;  2NVQ K;  4A3M C;  4AYB D;  4A3D K;  3GTO C;  4A3I K;  4QJV B;  1SFO K;  1I6H K;  4C3J K;  5C44 C;  4LLG A;  3GTG K;  4OIO A;  3HOX C;  3S2D C;  4A3E C;  3S1N C;  4G7Z A;  3PO3 K;  5C3E K;  4ZH4 A;  2R7Z K;  3FKI C;  5IP7 C;  1R9T C;  5FLM C;  2WAQ L;  3M4O C;  5FJ8 K;  1I3Q C;  1I50 C;  1YNN A;  4YFK A;  2PA8 D;  3S15 C;  3HOZ K;  3HOV C;  4A3B K;  1TWA C;  4QIW D;  3I4M K;  1XPP A;  3GTJ C;  5TMC A;  4BY1 K;  3GTP C;  4A93 C;  4A3G K;  4OIR A;  2NVY C;  3H0G C;  5IYD C;  1TWF C;  5IYC C;  2BE5 A;  5C4J K;  3GTL C;  3I4N K;  4XLP A;  4BBS C;  3HOY C;  5C4X C;  1TWC K;  3S14 K;  3HOW K;  4KN4 A;  3RZO C;  4X6A K;  3S1R K;  2NVX C;  3GTK C;  4A3L C;  1TWH K;  2WB1 D;  2JA5 K;  5D4D A;  2NVT K;  3M3Y C;  4LK0 A;  4KMU A;  4A3F C;  3S1Q K;  2VUM C;  3H3V D;  3GTM C;  3GTQ K;  4AYB L;  5IP9 C;  3EQL A;  3K7A K;  3S17 C;  2NVQ C;  2JA7 K;  2YU9 C;  4Q4Z A;  4A3D C;  2A69 A;  4Y7N K;  2E2I K;  1ZYR A;  3S16 C;  4A3J C;  4BXX K;  4OIP A;  5C3E C;  4JK1 A;  5IYB K;  3S1M C;  2R93 K;  2A6E A;  2PA8 L;  4BBR C;  3DXJ A;  3GTL K;  1Y1V K;  3RZD C;  1TWG K;  4QIW L;  2B63 K;  1Y1W K;  2JA6 C;  3CQZ C;  3I4M C;  4A3M K;  4BY1 C;  4Q5S A;  4A3G C;  3GTO K;  1WCM K;  3WOD A;  3HOU C;  4YFN A;  5M5Y K;  4OIQ A;  1K83 C;  4MQ9 A;  5C4J C;  3I4N C;  3HOX K;  3S2D K;  4LK1 A;  4A3E K;  3S1N K;  1TWC C;  2R92 C;  2E2H C;  3FKI K;  4LJZ A;  4A3K C;  5FLM K;  3S1R C;  1R9T K;  2WB1 L;  3M4O K;  4BY7 C;  1I3Q K;  1I50 K;  4XLN A;  4GZY A;  3H3V L;  4YFX A;  3HOV K;  4A3I C;  1SFO C;  2A6H A;  3GTJ K;  4OIN A;  2JA7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...