4A3EK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3eK00
1Y1WK 1I6VA 3HOXK 4JK1A 3HOVC 1I50K 1TWHC 5C3EK 2B63C 2E2IC 3I4MC 3S17K 5C4XK 2NVXK 3GTKK 3M4OK 1I3QK 5TMFA 5IYBC 3CQZK 4A3KC 1TWGK 5M3FK 4KN4A 4QJVB 2JA5K 4OIRA 5C4JK 3S1RC 2R92C 4BXXK 4OINA 3S15K 3S16K 1TWCK 4QIWD 4YFNA 3I4NK 4A3MK 4A3GK 4A3CK 4BY7C 4A3FC 4AYBL 2R93C 4Y52C 4A3EK 3S1MK 5C44C 2A68A 2WB1L 4A3JC 3GTJK 3FKIC 3S15C 3H3VL 1K83K 4A3BK 3GTLK 5M5XK 4A3GC 3GTGK 2PMZL 5M5YK 3PO2C 4X6AC 3HOUC 2CW0A 4BBSK 1XPPA 4A3EC 2R7ZK 3RZOK 3S1MC 2PA8D 3HKZL 4XLPA 4YG2A 3S2HK 4A3DC 1WCMC 5IYDC 1K83C 4KMUA 2JA6K 3GTOK 2JA8K 2A69A 3WODA 3RZDC 3GTQC 3EQLA 3S14C 1TWAK 3HOYK 4GZYA 4XSXA 1SFOK 5D4DA 1Y1WC 3HOXC 3RZOC 1I50C 5C3EC 4LK0A 2NVYK 4BBRK 2O5IA 5IP9K 2NVQK 3S17C 5C4XC 1R9TK 2NVXC 4LK1A 3GTKC 1I6HK 3M4OC 4C3JK 4A3LK 1I3QC 4MQ9A 1TWFK 1ZYRA 2WAQL 3CQZC 1TWGC 3DXJA 4YFKA 5M5WK 2JA5C 5FLMK 5C4JC 2A6EA 2VUMK 3S1QK 4BXXC 4A93K 4LLGA 3GTMK 3S16C 4A3IK 1TWCC 3I4NC 4C3HK 4OIQA 4A3MC 2NVTK 4A3LC 1TWFC 4A3CC 3HOWK 2VUMC 2BE5A 3M3YK 4OIPA 4AYBD 3GTJC 2PPBA 3H0GK 4Q4ZA 3GTMC 3GTPK 4Y7NK 1YNJA 2WB1D 3K7AK 3GTLC 4A3BC 3GTGC 2JA7K 3H3VD 2E2HK 5IP7K 4BY1K 3PO3K 1YNNA 2Y0SL 2R7ZC 1Y1VK 4BBSC 2A6HA 2PMZD 3S2DK 3HOZK 3S2HC 2E2JK 4ZH4A 3GTOC 4OIOA 2JA6C 3HKZD 2JA8C 3HOVK 1TWHK 5IYCK 1HQMA 2B63K 1TWAC 2E2IK 3HOYC 1SFOC 5M3MK 4NOIA 2NVYC 4BBRC 5IYBK 4XLNA 2YU9K 5IP9C 2NVQC 1R9TC 1BDFA 1I6HC 5IYCC 4QIWL 3S1RK 2R92K 4G7HA 3S1NK 4MEXA 5FLMC 5TMCA 2WAQD 3S1QC 2YU9C 4YFXA 4A93C 4A3FK 4BY7K 4A3IC 2R93K 4Y52K 5C44K 4A3JK 2NVTC 5FJ8K 4XSZA 3FKIK 4C2MK 2O5JA 3HOWC 3S1NC 1IW7A 3M3YC 2PA8L 3PO2K 4X6AK 4LJZA 3H0GC 3HOUK 3GTPC 3S14K 4Y7NC 3K7AC 2JA7C 4G7OA 4C3IK 4A3DK 4KN7A 1WCMK 4MEYA 5IP7C 2E2HC 4BY1C 3I4MK 4QJVA 1Y1VC 3PO3C 5IYDK 4Q5SA 4G7ZA 3S2DC 3RZDK 1SMYA 3HOZC 2E2JC 3GTQK 2Y0SD 4A3KK
chains in the Genus database with same CATH superfamily
1Y1WK 5IOSA 1I50K 1B4AA 1IE0A 2RH6A 2NVXK 5IYBC 3GEIA 3LAPA 3BUEA 1TWCK 3I4NK 4A3GK 4A3CK 4XCHA 3H3VL 1K83K 4KMHA 3FHZA 3GTGK 2PMZL 3HOUC 2CW0A 4BBSK 4A3EC 1O29A 3RZOK 4GTAA 4G0UA 2JA8K 1F9NA 1DCHA 3RZDC 3S14C 3HOYK 1Y1WC 1I50C 2FQTA 4M1XA 1JOEA 1USMA 5IP9K 1O2FB 2GSUA 2NVXC 1I6HK 4C3JK 4MQ9A 1WOSA 3LPXA 5M5WK 2CFAA 4KM8A 4LLGA 1BJTA 1Y1WA 1TWCC 1I50A 3I4NC 1J6WA 1F7VA 4A3CC 3HOWK 2NVXA 2BE5A 4AYBD 3GTMC 4Y7NK 3GTGC 4O2DA 2CFAB 2E2HK 5IP7K 1PJ7A 1YX2A 1WIHA 1TWCA 4BBSC 1EQRA 1AB4A 4P5AA 2JA8C 3HOYC 3SZYA 4GT9A 1K83A 4LQYA 3ERED 3GTGA 4PABA 3G4CA 4XLNA 2YU9K 5IP9C 1WQGA 1I6HC 4C3JC 2R92K 1JQWA 3S1NK 5TMCA 2WAQD 4BY7K 3CQZA 4A3FK 4Y52K 4A3JK 2O5JA 3HOWC 1IS1A 3T00A 4P5BA 3TTGA 4Y7NC 3S14K 3AD7C 3TFHA 2E2HC 1WCMK 4MEYA 5IP7C 3HXAA 4G7ZA 1SMYA 3GTQK 1O2BA 2Y0SD 3GIRA 3ADAC 5C4XK 4P9SA 4G0WA 3GTKK 1L0WA 5TMFA 5M3FK 4KN4A 1VLOA 2R92C 3S16K 5E68A 4BY7C 4A3FC 4Y52C 4A3EK 3N3YA 4A3JC 2YU9A 3S15C 3LAJA 1YCLA 1VGXA 2R92A 4LR2A 3CAGA 2R7ZK 3S1MC 3Q3QA 4XLPA 1WCMC 2JA6K 1BS2A 1VH2A 3GTQC 1TWAK 1DCPA 1V5VA 2O5IA 3GEEA 5C4XC 1R9TK 3GTKC 1ZYRA 1ZQ1C 1WCMA 3L4JA 5FLMK 2A6EA 3GTQA 4ILDA 3GTMK 3S16C 1HI9A 3BP8C 1EI6A 3GTKA 5TJ3A 3M3YK 2D6FC 2PPBA 1JVIA 3H0GK 3GTPK 1YNJA 2W7VA 2V6SA 1RU0A 2XCOA 4RMFA 3H3VD 2R7ZC 1Y1VK 3JSTA 2PMZD 3N0CA 1ISEA 3S2DK 4KB4A 4OIOA 2JA6C 4WJ4A 3HOVK 4FZBA 2P5MA 1TWAC 3BP3A 2E2IK 2GSOA 3L4KA 1WQFA 4NOIA 2ZUFA 2ZUEA 2PHCB 1R9TC 2R7ZA 4KMAA 4QIWL 3S1RK 1F7UA 2JA6A 4G7HA 5FLMC 1O24A 1TWAA 1GE9A 4PAAA 4J3NA 1R9TA 1ZBSA 1O27A 3M3YC 2PA8L 3H0GC 3GTPC 1XXCA 1IBAA 4GTCA 4KB2A 4KC6A 3AQOA 4KN7A 3GTMA 1XXBA 5IYDK 1O2AA 1WOPA 1O28A 1Y1VC 4Q5SA 3S2DC 1I6VA 3HOXK 3OEPA 3HOVC 5C3EK 4GTLA 3AD9C 4KM9A 1EFWA 3H0GA 2E2IC 3I4MC 3S17K 3GTPA 1Y1VA 4OIRA 3S1RC 4BXXK 3GSIA 3S15K 1VRQC 1XZQA 2E2IA 2GSNA 2V6TA 3S1MK 2WB1L 5L46A 4A3BK 3MMLB 2FQOA 5M5YK 1PJ6A 1XPPA 1XZQB 3HKZL 4YG2A 4DDQA 5IYDC 4GTEA 4KARA 3EQLA 4GZYA 2E2HA 1J6XA 4XSXA 4KASA 1SFOK 5D4DA 3HOXC 5C3EC 2RGRA 4BBRK 3S17C 5HL8A 1WQHA 4LK1A 2JH3A 1XXAA 3N0BA 3DXJA 1BGWA 4BXXC 1UV7A 4A93K 4A3IK 2XCQA 1USOA 3T01A 2EBBA 4C3HK 3GDZA 1TWFC 2NVTK 4A3LC 2VUMC 4OIPA 1DD5A 5JFEA 4A3BC 3K7AK 1WSVA 2Y3PA 2JA7K 3V4GA 4BY1K 3PO3K 1ZXOA 1EH1A 2A6HA 1X31C 4FM9A 3HOZK 3NUHA 4ZH4A 2E2JK 1EK8A 1TWHK 1XZPA 1HQMA 2B63K 3TFJA 1SFOC 5M3MK 1IQ0A 4BBRC 1VJEA 4AH6A 4GTDA 1WORA 1WSRA 4WILA 5IYCC 4GTFA 1XZPB 5JVOA 4A93C 4YFXA 1SFOA 4A3IC 2R93K 3FOFA 5C44K 4C3HC 1F93A 2NVTC 2P8TA 3FKIK 4C2MK 1IW7A 1J6VA 1PJ5A 3PO2K 4X6AK 4LJZA 1DCOA 3VA7A 3K7AC 1O26A 2JA7C 4G7OA 4C3IK 4A3DK 5IOTA 3I4MK 4BY1C 3PO3C 4QJVA 3HOZC 2E2JC 1J98A 4JK1A 1TWHC 2GAGC 1O25A 2B63C 1C0AA 1KQ4A 3M4OK 2JA7A 1I3QK 3A8KA 3CQZK 4A3KC 1TWGK 4QJVB 2JA5K 5C4JK 4WJ3M 4BKWA 4OINA 4QIWD 1TWHA 5CHPA 4YFNA 5IOQA 4A3MK 2B63A 4AYBL 2R93C 2V6UA 5C44C 2A68A 4KMDA 3GTJK 3T02A 3FKIC 4C2MC 3GTLK 5M5XK 4A3GC 5EGEA 4KDDA 3PO2C 4X6AC 3AQPA 3QX3A 3S0XA 2PA8D 3FOEA 3S2HK 4C3IC 4A3DC 3GTOK 1K83C 3GEHA 4KMUA 1IL2A 4G0VA 2R93A 2A69A 3WODA 3FKIA 3OPFA 2KWAA 3RZOC 4LK0A 2NVYK 2NVQK 4BLBA 3M4OC 4A3LK 1I3QC 1TWFK 2WAQL 3CQZC 1TWGC 1WOOA 4YFKA 2JA5C 2VUMK 5C4JC 4KAWX 3S1QK 1ZVUA 4OIQA 2GAHC 4A3MC 4KATA 5IORA 3G4AA 1I3QA 3GTJC 4Q4ZA 1TWGA 4BLAA 4C45A 2WB1D 2JA5A 3GTLC 4LOWA 3A8IA 3TFIA 3A8JA 1YNNA 2Y0SL 3S2HC 3GTOC 3HKZD 2XCRB 5CJ9A 3SZZA 5IYCK 1INNA 3GTJA 3OREA 3GTLA 1B4BA 2NVYC 5IYBK 2NVQC 1BDFA 3GTOA 3AH5A 4MEXA 3S1QC 2YU9C 3AD8C 2NVYA 5FJ8K 4XSZA 3S1NC 4GTBA 4GFQA 1TWFA 3HOUK 2VUMA 2ZFZA 3IPJA 1G51A 3RZDK 5EGHA 4A3KK
chains in the Genus database with same CATH topology
1Y1WK 1I6VA 3HOXK 4JK1A 3HOVC 1I50K 1TWHC 5C3EK 2B63C 2E2IC 3I4MC 3S17K 5C4XK 2NVXK 3GTKK 3M4OK 1I3QK 5TMFA 5IYBC 3CQZK 4A3KC 1TWGK 5M3FK 4KN4A 4QJVB 2JA5K 4OIRA 5C4JK 3S1RC 2R92C 4BXXK 4OINA 3S15K 3S16K 1TWCK 4QIWD 4YFNA 3I4NK 4A3MK 4A3GK 4A3CK 4BY7C 4A3FC 4AYBL 2R93C 4Y52C 4A3EK 3S1MK 5C44C 2A68A 2WB1L 4A3JC 3GTJK 3FKIC 3S15C 3H3VL 1K83K 4A3BK 3GTLK 5M5XK 4A3GC 3GTGK 2PMZL 5M5YK 3PO2C 4X6AC 3HOUC 2CW0A 4BBSK 1XPPA 4A3EC 2R7ZK 3RZOK 3S1MC 2PA8D 3HKZL 4XLPA 4YG2A 3S2HK 4A3DC 1WCMC 5IYDC 1K83C 4KMUA 2JA6K 3GTOK 2JA8K 2A69A 3WODA 3RZDC 3GTQC 3EQLA 3S14C 1TWAK 3HOYK 4GZYA 4XSXA 1SFOK 5D4DA 1Y1WC 3HOXC 3RZOC 1I50C 5C3EC 4LK0A 2NVYK 4BBRK 2O5IA 5IP9K 2NVQK 3S17C 5C4XC 1R9TK 2NVXC 4LK1A 3GTKC 1I6HK 3M4OC 4C3JK 4A3LK 1I3QC 4MQ9A 1TWFK 1ZYRA 2WAQL 3CQZC 1TWGC 3DXJA 4YFKA 5M5WK 2JA5C 5FLMK 5C4JC 2A6EA 2VUMK 3S1QK 4BXXC 4A93K 4LLGA 3GTMK 3S16C 4A3IK 1TWCC 3I4NC 4C3HK 4OIQA 4A3MC 2NVTK 4A3LC 1TWFC 4A3CC 3HOWK 2VUMC 2BE5A 3M3YK 4OIPA 4AYBD 3GTJC 2PPBA 3H0GK 4Q4ZA 3GTMC 3GTPK 4Y7NK 1YNJA 2WB1D 3K7AK 3GTLC 4A3BC 3GTGC 2JA7K 3H3VD 2E2HK 5IP7K 4BY1K 3PO3K 1YNNA 2Y0SL 2R7ZC 1Y1VK 4BBSC 2A6HA 2PMZD 3S2DK 3HOZK 3S2HC 2E2JK 4ZH4A 3GTOC 4OIOA 2JA6C 3HKZD 2JA8C 3HOVK 1TWHK 5IYCK 1HQMA 2B63K 1TWAC 2E2IK 3HOYC 1SFOC 5M3MK 4NOIA 2NVYC 4BBRC 5IYBK 4XLNA 2YU9K 5IP9C 2NVQC 1R9TC 1BDFA 1I6HC 5IYCC 4QIWL 3S1RK 2R92K 4G7HA 3S1NK 4MEXA 5FLMC 5TMCA 2WAQD 3S1QC 2YU9C 4YFXA 4A93C 4A3FK 4BY7K 4A3IC 2R93K 4Y52K 5C44K 4A3JK 2NVTC 5FJ8K 4XSZA 3FKIK 4C2MK 2O5JA 3HOWC 3S1NC 1IW7A 3M3YC 2PA8L 3PO2K 4X6AK 4LJZA 3H0GC 3HOUK 3GTPC 3S14K 4Y7NC 3K7AC 2JA7C 4G7OA 4C3IK 4A3DK 4KN7A 1WCMK 4MEYA 5IP7C 2E2HC 4BY1C 3I4MK 4QJVA 1Y1VC 3PO3C 5IYDK 4Q5SA 4G7ZA 3S2DC 3RZDK 1SMYA 3HOZC 2E2JC 3GTQK 2Y0SD 4A3KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W K;  1I6V A;  3HOX K;  4JK1 A;  3HOV C;  1I50 K;  1TWH C;  5C3E K;  2B63 C;  2E2I C;  3I4M C;  3S17 K;  5C4X K;  2NVX K;  3GTK K;  3M4O K;  1I3Q K;  5TMF A;  5IYB C;  3CQZ K;  4A3K C;  1TWG K;  5M3F K;  4KN4 A;  4QJV B;  2JA5 K;  4OIR A;  5C4J K;  3S1R C;  2R92 C;  4BXX K;  4OIN A;  3S15 K;  3S16 K;  1TWC K;  4QIW D;  4YFN A;  3I4N K;  4A3M K;  4A3G K;  4A3C K;  4BY7 C;  4A3F C;  4AYB L;  2R93 C;  4Y52 C;  4A3E K;  3S1M K;  5C44 C;  2A68 A;  2WB1 L;  4A3J C;  3GTJ K;  3FKI C;  3S15 C;  3H3V L;  1K83 K;  4A3B K;  3GTL K;  5M5X K;  4A3G C;  3GTG K;  2PMZ L;  5M5Y K;  3PO2 C;  4X6A C;  3HOU C;  2CW0 A;  4BBS K;  1XPP A;  4A3E C;  2R7Z K;  3RZO K;  3S1M C;  2PA8 D;  3HKZ L;  4XLP A;  4YG2 A;  3S2H K;  4A3D C;  1WCM C;  5IYD C;  1K83 C;  4KMU A;  2JA6 K;  3GTO K;  2JA8 K;  2A69 A;  3WOD A;  3RZD C;  3GTQ C;  3EQL A;  3S14 C;  1TWA K;  3HOY K;  4GZY A;  4XSX A;  1SFO K;  5D4D A;  1Y1W C;  3HOX C;  3RZO C;  1I50 C;  5C3E C;  4LK0 A;  2NVY K;  4BBR K;  2O5I A;  5IP9 K;  2NVQ K;  3S17 C;  5C4X C;  1R9T K;  2NVX C;  4LK1 A;  3GTK C;  1I6H K;  3M4O C;  4C3J K;  4A3L K;  1I3Q C;  4MQ9 A;  1TWF K;  1ZYR A;  2WAQ L;  3CQZ C;  1TWG C;  3DXJ A;  4YFK A;  5M5W K;  2JA5 C;  5FLM K;  5C4J C;  2A6E A;  2VUM K;  3S1Q K;  4BXX C;  4A93 K;  4LLG A;  3GTM K;  3S16 C;  4A3I K;  1TWC C;  3I4N C;  4C3H K;  4OIQ A;  4A3M C;  2NVT K;  4A3L C;  1TWF C;  4A3C C;  3HOW K;  2VUM C;  2BE5 A;  3M3Y K;  4OIP A;  4AYB D;  3GTJ C;  2PPB A;  3H0G K;  4Q4Z A;  3GTM C;  3GTP K;  4Y7N K;  1YNJ A;  2WB1 D;  3K7A K;  3GTL C;  4A3B C;  3GTG C;  2JA7 K;  3H3V D;  2E2H K;  5IP7 K;  4BY1 K;  3PO3 K;  1YNN A;  2Y0S L;  2R7Z C;  1Y1V K;  4BBS C;  2A6H A;  2PMZ D;  3S2D K;  3HOZ K;  3S2H C;  2E2J K;  4ZH4 A;  3GTO C;  4OIO A;  2JA6 C;  3HKZ D;  2JA8 C;  3HOV K;  1TWH K;  5IYC K;  1HQM A;  2B63 K;  1TWA C;  2E2I K;  3HOY C;  1SFO C;  5M3M K;  4NOI A;  2NVY C;  4BBR C;  5IYB K;  4XLN A;  2YU9 K;  5IP9 C;  2NVQ C;  1R9T C;  1BDF A;  1I6H C;  5IYC C;  4QIW L;  3S1R K;  2R92 K;  4G7H A;  3S1N K;  4MEX A;  5FLM C;  5TMC A;  2WAQ D;  3S1Q C;  2YU9 C;  4YFX A;  4A93 C;  4A3F K;  4BY7 K;  4A3I C;  2R93 K;  4Y52 K;  5C44 K;  4A3J K;  2NVT C;  5FJ8 K;  4XSZ A;  3FKI K;  4C2M K;  2O5J A;  3HOW C;  3S1N C;  1IW7 A;  3M3Y C;  2PA8 L;  3PO2 K;  4X6A K;  4LJZ A;  3H0G C;  3HOU K;  3GTP C;  3S14 K;  4Y7N C;  3K7A C;  2JA7 C;  4G7O A;  4C3I K;  4A3D K;  4KN7 A;  1WCM K;  4MEY A;  5IP7 C;  2E2H C;  4BY1 C;  3I4M K;  4QJV A;  1Y1V C;  3PO3 C;  5IYD K;  4Q5S A;  4G7Z A;  3S2D C;  3RZD K;  1SMY A;  3HOZ C;  2E2J C;  3GTQ K;  2Y0S D;  4A3K K; 
#chains in the Genus database with same CATH topology
 1Y1W K;  5IOS A;  1I50 K;  1B4A A;  1IE0 A;  2RH6 A;  2NVX K;  5IYB C;  3GEI A;  3LAP A;  3BUE A;  1TWC K;  3I4N K;  4A3G K;  4A3C K;  4XCH A;  3H3V L;  1K83 K;  4KMH A;  3FHZ A;  3GTG K;  2PMZ L;  3HOU C;  2CW0 A;  4BBS K;  4A3E C;  1O29 A;  3RZO K;  4GTA A;  4G0U A;  2JA8 K;  1F9N A;  1DCH A;  3RZD C;  3S14 C;  3HOY K;  1Y1W C;  1I50 C;  2FQT A;  4M1X A;  1JOE A;  1USM A;  5IP9 K;  1O2F B;  2GSU A;  2NVX C;  1I6H K;  4C3J K;  4MQ9 A;  1WOS A;  3LPX A;  5M5W K;  2CFA A;  4KM8 A;  4LLG A;  1BJT A;  1Y1W A;  1TWC C;  1I50 A;  3I4N C;  1J6W A;  1F7V A;  4A3C C;  3HOW K;  2NVX A;  2BE5 A;  4AYB D;  3GTM C;  4Y7N K;  3GTG C;  4O2D A;  2CFA B;  2E2H K;  5IP7 K;  1PJ7 A;  1YX2 A;  1WIH A;  1TWC A;  4BBS C;  1EQR A;  1AB4 A;  4P5A A;  2JA8 C;  3HOY C;  3SZY A;  4GT9 A;  1K83 A;  4LQY A;  3ERE D;  3GTG A;  4PAB A;  3G4C A;  4XLN A;  2YU9 K;  5IP9 C;  1WQG A;  1I6H C;  4C3J C;  2R92 K;  1JQW A;  3S1N K;  5TMC A;  2WAQ D;  4BY7 K;  3CQZ A;  4A3F K;  4Y52 K;  4A3J K;  2O5J A;  3HOW C;  1IS1 A;  3T00 A;  4P5B A;  3TTG A;  4Y7N C;  3S14 K;  3AD7 C;  3TFH A;  2E2H C;  1WCM K;  4MEY A;  5IP7 C;  3HXA A;  4G7Z A;  1SMY A;  3GTQ K;  1O2B A;  2Y0S D;  3GIR A;  3ADA C;  5C4X K;  4P9S A;  4G0W A;  3GTK K;  1L0W A;  5TMF A;  5M3F K;  4KN4 A;  1VLO A;  2R92 C;  3S16 K;  5E68 A;  4BY7 C;  4A3F C;  4Y52 C;  4A3E K;  3N3Y A;  4A3J C;  2YU9 A;  3S15 C;  3LAJ A;  1YCL A;  1VGX A;  2R92 A;  4LR2 A;  3CAG A;  2R7Z K;  3S1M C;  3Q3Q A;  4XLP A;  1WCM C;  2JA6 K;  1BS2 A;  1VH2 A;  3GTQ C;  1TWA K;  1DCP A;  1V5V A;  2O5I A;  3GEE A;  5C4X C;  1R9T K;  3GTK C;  1ZYR A;  1ZQ1 C;  1WCM A;  3L4J A;  5FLM K;  2A6E A;  3GTQ A;  4ILD A;  3GTM K;  3S16 C;  1HI9 A;  3BP8 C;  1EI6 A;  3GTK A;  5TJ3 A;  3M3Y K;  2D6F C;  2PPB A;  1JVI A;  3H0G K;  3GTP K;  1YNJ A;  2W7V A;  2V6S A;  1RU0 A;  2XCO A;  4RMF A;  3H3V D;  2R7Z C;  1Y1V K;  3JST A;  2PMZ D;  3N0C A;  1ISE A;  3S2D K;  4KB4 A;  4OIO A;  2JA6 C;  4WJ4 A;  3HOV K;  4FZB A;  2P5M A;  1TWA C;  3BP3 A;  2E2I K;  2GSO A;  3L4K A;  1WQF A;  4NOI A;  2ZUF A;  2ZUE A;  2PHC B;  1R9T C;  2R7Z A;  4KMA A;  4QIW L;  3S1R K;  1F7U A;  2JA6 A;  4G7H A;  5FLM C;  1O24 A;  1TWA A;  1GE9 A;  4PAA A;  4J3N A;  1R9T A;  1ZBS A;  1O27 A;  3M3Y C;  2PA8 L;  3H0G C;  3GTP C;  1XXC A;  1IBA A;  4GTC A;  4KB2 A;  4KC6 A;  3AQO A;  4KN7 A;  3GTM A;  1XXB A;  5IYD K;  1O2A A;  1WOP A;  1O28 A;  1Y1V C;  4Q5S A;  3S2D C;  1I6V A;  3HOX K;  3OEP A;  3HOV C;  5C3E K;  4GTL A;  3AD9 C;  4KM9 A;  1EFW A;  3H0G A;  2E2I C;  3I4M C;  3S17 K;  3GTP A;  1Y1V A;  4OIR A;  3S1R C;  4BXX K;  3GSI A;  3S15 K;  1VRQ C;  1XZQ A;  2E2I A;  2GSN A;  2V6T A;  3S1M K;  2WB1 L;  5L46 A;  4A3B K;  3MML B;  2FQO A;  5M5Y K;  1PJ6 A;  1XPP A;  1XZQ B;  3HKZ L;  4YG2 A;  4DDQ A;  5IYD C;  4GTE A;  4KAR A;  3EQL A;  4GZY A;  2E2H A;  1J6X A;  4XSX A;  4KAS A;  1SFO K;  5D4D A;  3HOX C;  5C3E C;  2RGR A;  4BBR K;  3S17 C;  5HL8 A;  1WQH A;  4LK1 A;  2JH3 A;  1XXA A;  3N0B A;  3DXJ A;  1BGW A;  4BXX C;  1UV7 A;  4A93 K;  4A3I K;  2XCQ A;  1USO A;  3T01 A;  2EBB A;  4C3H K;  3GDZ A;  1TWF C;  2NVT K;  4A3L C;  2VUM C;  4OIP A;  1DD5 A;  5JFE A;  4A3B C;  3K7A K;  1WSV A;  2Y3P A;  2JA7 K;  3V4G A;  4BY1 K;  3PO3 K;  1ZXO A;  1EH1 A;  2A6H A;  1X31 C;  4FM9 A;  3HOZ K;  3NUH A;  4ZH4 A;  2E2J K;  1EK8 A;  1TWH K;  1XZP A;  1HQM A;  2B63 K;  3TFJ A;  1SFO C;  5M3M K;  1IQ0 A;  4BBR C;  1VJE A;  4AH6 A;  4GTD A;  1WOR A;  1WSR A;  4WIL A;  5IYC C;  4GTF A;  1XZP B;  5JVO A;  4A93 C;  4YFX A;  1SFO A;  4A3I C;  2R93 K;  3FOF A;  5C44 K;  4C3H C;  1F93 A;  2NVT C;  2P8T A;  3FKI K;  4C2M K;  1IW7 A;  1J6V A;  1PJ5 A;  3PO2 K;  4X6A K;  4LJZ A;  1DCO A;  3VA7 A;  3K7A C;  1O26 A;  2JA7 C;  4G7O A;  4C3I K;  4A3D K;  5IOT A;  3I4M K;  4BY1 C;  3PO3 C;  4QJV A;  3HOZ C;  2E2J C;  1J98 A;  4JK1 A;  1TWH C;  2GAG C;  1O25 A;  2B63 C;  1C0A A;  1KQ4 A;  3M4O K;  2JA7 A;  1I3Q K;  3A8K A;  3CQZ K;  4A3K C;  1TWG K;  4QJV B;  2JA5 K;  5C4J K;  4WJ3 M;  4BKW A;  4OIN A;  4QIW D;  1TWH A;  5CHP A;  4YFN A;  5IOQ A;  4A3M K;  2B63 A;  4AYB L;  2R93 C;  2V6U A;  5C44 C;  2A68 A;  4KMD A;  3GTJ K;  3T02 A;  3FKI C;  4C2M C;  3GTL K;  5M5X K;  4A3G C;  5EGE A;  4KDD A;  3PO2 C;  4X6A C;  3AQP A;  3QX3 A;  3S0X A;  2PA8 D;  3FOE A;  3S2H K;  4C3I C;  4A3D C;  3GTO K;  1K83 C;  3GEH A;  4KMU A;  1IL2 A;  4G0V A;  2R93 A;  2A69 A;  3WOD A;  3FKI A;  3OPF A;  2KWA A;  3RZO C;  4LK0 A;  2NVY K;  2NVQ K;  4BLB A;  3M4O C;  4A3L K;  1I3Q C;  1TWF K;  2WAQ L;  3CQZ C;  1TWG C;  1WOO A;  4YFK A;  2JA5 C;  2VUM K;  5C4J C;  4KAW X;  3S1Q K;  1ZVU A;  4OIQ A;  2GAH C;  4A3M C;  4KAT A;  5IOR A;  3G4A A;  1I3Q A;  3GTJ C;  4Q4Z A;  1TWG A;  4BLA A;  4C45 A;  2WB1 D;  2JA5 A;  3GTL C;  4LOW A;  3A8I A;  3TFI A;  3A8J A;  1YNN A;  2Y0S L;  3S2H C;  3GTO C;  3HKZ D;  2XCR B;  5CJ9 A;  3SZZ A;  5IYC K;  1INN A;  3GTJ A;  3ORE A;  3GTL A;  1B4B A;  2NVY C;  5IYB K;  2NVQ C;  1BDF A;  3GTO A;  3AH5 A;  4MEX A;  3S1Q C;  2YU9 C;  3AD8 C;  2NVY A;  5FJ8 K;  4XSZ A;  3S1N C;  4GTB A;  4GFQ A;  1TWF A;  3HOU K;  2VUM A;  2ZFZ A;  3IPJ A;  1G51 A;  3RZD K;  5EGH A;  4A3K K; 
#chains in the Genus database with same CATH homology
 1Y1W K;  1I6V A;  3HOX K;  4JK1 A;  3HOV C;  1I50 K;  1TWH C;  5C3E K;  2B63 C;  2E2I C;  3I4M C;  3S17 K;  5C4X K;  2NVX K;  3GTK K;  3M4O K;  1I3Q K;  5TMF A;  5IYB C;  3CQZ K;  4A3K C;  1TWG K;  5M3F K;  4KN4 A;  4QJV B;  2JA5 K;  4OIR A;  5C4J K;  3S1R C;  2R92 C;  4BXX K;  4OIN A;  3S15 K;  3S16 K;  1TWC K;  4QIW D;  4YFN A;  3I4N K;  4A3M K;  4A3G K;  4A3C K;  4BY7 C;  4A3F C;  4AYB L;  2R93 C;  4Y52 C;  4A3E K;  3S1M K;  5C44 C;  2A68 A;  2WB1 L;  4A3J C;  3GTJ K;  3FKI C;  3S15 C;  3H3V L;  1K83 K;  4A3B K;  3GTL K;  5M5X K;  4A3G C;  3GTG K;  2PMZ L;  5M5Y K;  3PO2 C;  4X6A C;  3HOU C;  2CW0 A;  4BBS K;  1XPP A;  4A3E C;  2R7Z K;  3RZO K;  3S1M C;  2PA8 D;  3HKZ L;  4XLP A;  4YG2 A;  3S2H K;  4A3D C;  1WCM C;  5IYD C;  1K83 C;  4KMU A;  2JA6 K;  3GTO K;  2JA8 K;  2A69 A;  3WOD A;  3RZD C;  3GTQ C;  3EQL A;  3S14 C;  1TWA K;  3HOY K;  4GZY A;  4XSX A;  1SFO K;  5D4D A;  1Y1W C;  3HOX C;  3RZO C;  1I50 C;  5C3E C;  4LK0 A;  2NVY K;  4BBR K;  2O5I A;  5IP9 K;  2NVQ K;  3S17 C;  5C4X C;  1R9T K;  2NVX C;  4LK1 A;  3GTK C;  1I6H K;  3M4O C;  4C3J K;  4A3L K;  1I3Q C;  4MQ9 A;  1TWF K;  1ZYR A;  2WAQ L;  3CQZ C;  1TWG C;  3DXJ A;  4YFK A;  5M5W K;  2JA5 C;  5FLM K;  5C4J C;  2A6E A;  2VUM K;  3S1Q K;  4BXX C;  4A93 K;  4LLG A;  3GTM K;  3S16 C;  4A3I K;  1TWC C;  3I4N C;  4C3H K;  4OIQ A;  4A3M C;  2NVT K;  4A3L C;  1TWF C;  4A3C C;  3HOW K;  2VUM C;  2BE5 A;  3M3Y K;  4OIP A;  4AYB D;  3GTJ C;  2PPB A;  3H0G K;  4Q4Z A;  3GTM C;  3GTP K;  4Y7N K;  1YNJ A;  2WB1 D;  3K7A K;  3GTL C;  4A3B C;  3GTG C;  2JA7 K;  3H3V D;  2E2H K;  5IP7 K;  4BY1 K;  3PO3 K;  1YNN A;  2Y0S L;  2R7Z C;  1Y1V K;  4BBS C;  2A6H A;  2PMZ D;  3S2D K;  3HOZ K;  3S2H C;  2E2J K;  4ZH4 A;  3GTO C;  4OIO A;  2JA6 C;  3HKZ D;  2JA8 C;  3HOV K;  1TWH K;  5IYC K;  1HQM A;  2B63 K;  1TWA C;  2E2I K;  3HOY C;  1SFO C;  5M3M K;  4NOI A;  2NVY C;  4BBR C;  5IYB K;  4XLN A;  2YU9 K;  5IP9 C;  2NVQ C;  1R9T C;  1BDF A;  1I6H C;  5IYC C;  4QIW L;  3S1R K;  2R92 K;  4G7H A;  3S1N K;  4MEX A;  5FLM C;  5TMC A;  2WAQ D;  3S1Q C;  2YU9 C;  4YFX A;  4A93 C;  4A3F K;  4BY7 K;  4A3I C;  2R93 K;  4Y52 K;  5C44 K;  4A3J K;  2NVT C;  5FJ8 K;  4XSZ A;  3FKI K;  4C2M K;  2O5J A;  3HOW C;  3S1N C;  1IW7 A;  3M3Y C;  2PA8 L;  3PO2 K;  4X6A K;  4LJZ A;  3H0G C;  3HOU K;  3GTP C;  3S14 K;  4Y7N C;  3K7A C;  2JA7 C;  4G7O A;  4C3I K;  4A3D K;  4KN7 A;  1WCM K;  4MEY A;  5IP7 C;  2E2H C;  4BY1 C;  3I4M K;  4QJV A;  1Y1V C;  3PO3 C;  5IYD K;  4Q5S A;  4G7Z A;  3S2D C;  3RZD K;  1SMY A;  3HOZ C;  2E2J C;  3GTQ K;  2Y0S D;  4A3K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...