4A3EK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3eK00
4LK0A 2A6HA 3GTQK 3GTMK 1R9TC 5TMCA 3S2DC 3CQZK 4BBRK 3HOXC 1Y1WK 1I3QC 3K7AK 3HOWK 4A3IC 1WCMK 3S16C 2A69A 5M5XK 3HOUC 5FJ8K 1TWAC 1IW7A 2PA8D 2E2IC 4A3GK 3RZDC 5C4JC 2WB1D 5C4XK 4A3FC 5C4XC 2Y0SL 1SFOC 4BY7C 4A3LK 3S1QC 4BXXC 3HOYK 5M5YK 3H3VD 3PO3C 3GTLC 5IP9C 2WAQL 2JA8K 1I6HC 4A3FK 5M3FK 4G7OA 3S14C 4A3JC 2B63C 4A3MC 5C44C 3GTGC 1WCMC 3S16K 2PMZD 1I50K 2NVYC 4Y52C 4YFKA 5C4JK 2JA7K 2JA6C 4OIOA 3GTMC 1K83C 1I50C 4BY1K 4AYBL 5M5WK 4Y7NK 3S1RK 3S17C 5IYBC 3HOVK 1I3QK 3K7AC 3GTOC 4MEYA 4QIWL 2NVQC 4BBSC 2A6EA 4A93C 2Y0SD 3HKZL 4C3HK 2E2JC 3GTPK 1TWCK 3GTKK 3HKZD 3M4OC 4A3BC 3S1MK 4C2MK 5FLMK 4LJZA 1TWHK 4G7HA 4A3EC 2YU9K 2VUMK 3H3VL 3S1QK 4A3LC 1Y1VK 4YG2A 4YFXA 2E2HK 2JA5C 3RZOC 3RZDK 3FKIC 4NOIA 4BY1C 1TWGK 3HOUK 3S2HK 5IYDC 2NVTC 4OIPA 1R9TK 3S14K 4KMUA 2R92K 3M3YK 2NVYK 3I4NC 1ZYRA 4A3CC 1I6HK 4Y52K 3HOXK 1Y1WC 4OINA 3GTPC 4C3IK 5IP7K 3PO3K 4Q5SA 3S1NK 4A3BK 5TMFA 4A3MK 4AYBD 4XSZA 2R93C 5IYBK 3HOVC 2E2IK 4X6AC 1K83K 2NVXC 3WODA 4QIWD 3HOWC 2WB1L 3DXJA 2R92C 2R7ZC 3I4NK 4A3EK 1TWFC 4G7ZA 2YU9C 4JK1A 3HOZK 1TWAK 4MEXA 4OIRA 4A3JK 1HQMA 4ZH4A 1YNJA 1SMYA 2WAQD 5IYCC 4A3IK 3S1RC 3I4MC 3S15C 4A93K 2JA8C 5IYDK 3EQLA 2PMZL 3GTLK 4A3DK 4X6AK 3FKIK 5FLMC 2JA6K 2JA7C 5IYCK 1BDFA 4QJVA 3CQZC 4BBRC 1I6VA 3S1NC 1TWHC 4Q4ZA 2R7ZK 3PO2K 1TWGC 1SFOK 2PPBA 3S2HC 4BY7K 2E2JK 3H0GK 4MQ9A 4BBSK 4A3GC 3I4MK 3GTJC 3S15K 4OIQA 5C44K 5M3MK 3GTGK 3PO2C 2VUMC 4QJVB 5IP7C 3S1MC 2PA8L 3H0GC 5C3EK 4C3JK 4XLNA 2E2HC 2JA5K 2O5IA 2A68A 3HOYC 4A3CK 4XLPA 2CW0A 2NVQK 2NVTK 4KN4A 3M4OK 4KN7A 2O5JA 4XSXA 1XPPA 5D4DA 3GTKC 3M3YC 4A3KK 4Y7NC 3S17K 1Y1VC 4LK1A 4A3DC 2NVXK 3GTOK 2B63K 3GTJK 3GTQC 3S2DK 1TWFK 3HOZC 1YNNA 4A3KC 4YFNA 3RZOK 2BE5A 4BXXK 2R93K 4LLGA 1TWCC 4GZYA 5C3EC 5IP9K
chains in the Genus database with same CATH superfamily
4LK0A 3S2DC 1R9TC 1YX2A 3HOXC 1Y1WK 1I3QC 3K7AK 4J3NA 5EGHA 3HOUC 5FJ8K 4GFQA 2WB1D 2Y0SL 1SFOC 5M5YK 1G51A 5L46A 4A3FK 2R92A 3NUHA 4WJ4A 1J6WA 2XCQA 4GTDA 4O2DA 1J6XA 2JA7K 2JA6C 4OIOA 3N3YA 1I50C 4C45A 1DCHA 4AYBL 4C3JC 2R93A 3HOVK 2XCOA 3GTOC 2A6EA 1C0AA 3GTKK 1TWCK 3AH5A 3M4OC 4A3BC 3TFIA 1BGWA 3FKIA 4YG2A 4YFXA 1ZBSA 3RZDK 3FKIC 1XXCA 3T02A 1TWGK 1XZQA 1R9TK 3H0GA 4A3CC 3HOXK 1Y1WC 4OINA 1V5VA 2GAHC 3AQPA 1UV7A 2CFAA 3JSTA 4P5AA 3S1NK 4Q5SA 4A3BK 5TMFA 1USOA 5IYBK 1I50A 1WSRA 2YU9C 4GTCA 1TWAK 3I4MC 3S15C 1YNJA 5EGEA 4A93K 3OREA 3L4KA 3GSIA 2JA8C 2PMZL 3AD9C 2ZUFA 5FLMC 2JA6K 2JA7C 5IYCK 2E2HA 4QJVA 1WOOA 3AQOA 2NVYA 3A8KA 3I4MK 3S15K 4KASA 5C44K 3PO2C 4BLBA 4GTFA 5IP7C 4XLNA 2O5IA 2NVQK 4KN7A 5D4DA 4BKWA 3S17K 3Q3QA 1Y1VC 5TJ3A 1TWFK 1YNNA 4A3KC 5IOTA 4BXXK 4GZYA 5IP9K 2EBBA 3GIRA 1XXAA 4G7ZA 1ZVUA 1EI6A 5TMCA 3CQZK 3GTPA 1ISEA 4GTLA 1TWHA 1TWAC 4A3GK 5C4JC 4A3LK 1XZQB 3S1QC 3HOYK 4BXXC 3H3VD 5IP9C 2WAQL 2JA8K 1I6HC 3ERED 4LQYA 2JA5A 4G7OA 1VH2A 4A3JC 2B63C 4WILA 1O29A 3GTGC 4KM9A 2PHCB 4YFKA 5C4JK 1K83A 2V6UA 2NVXA 3GTOA 4KM8A 4PAAA 5JFEA 1DCPA 1K83C 4KDDA 4BY1K 3S1RK 5IYBC 4KATA 3GTQA 3GTMA 2NVQC 3T00A 3N0BA 1BJTA 2Y0SD 3HKZL 3V4GA 3HKZD 4C2MK 2YU9K 2VUMK 3GTLA 1Y1VK 1JOEA 4NOIA 4BY1C 3S2HK 3HOUK 4OIPA 4M1XA 3S14K 3AD8C 2R92K 1ZYRA 1ZXOA 2Y3PA 3IPJA 4A3MK 2NVXC 3WODA 4QIWD 3GEIA 1WQGA 1ZQ1C 2WB1L 2R92C 1B4BA 4A3EK 4G0VA 5IORA 1DD5A 4A3JK 5C4XC 1IS1A 1SMYA 4KB2A 3QX3A 4A3IK 3GTKA 1O2BA 3L4JA 5E68A 2GAGC 1TWGA 1R9TA 1SFOK 1INNA 1XXBA 3HXAA 3H0GK 3LAPA 4OIQA 5M3MK 2XCRB 3OPFA 2VUMC 2PA8L 4A3CK 3MMLB 1XZPB 4G0WA 3FOEA 3G4CA 4KAWX 4Y7NC 2B63K 3GTQC 1O26A 3HOZC 2O5JA 1EK8A 1WORA 1VRQC 4BBRK 1JVIA 2GSUA 5IOQA 1WCMK 2P8TA 2A69A 3S16C 4P5BA 1EH1A 3RZDC 1F7UA 5C4XK 4BY7C 3PO3C 3GTGA 4C2MC 3GEEA 3A8JA 5M3FK 4XCHA 5C44C 1WCMC 3S16K 1WQHA 2PMZD 4DDQA 3BP3A 2E2IA 3GTMC 1JQWA 3GTJA 2CFAB 3TFJA 5M5WK 3S17C 1I3QK 3K7AC 4QIWL 3FOFA 1Y1WA 4A93C 2W7VA 5CHPA 2E2JC 1AB4A 4KARA 1WOPA 3S1MK 5FLMK 4G7HA 1TWHK 4A3EC 3H3VL 2E2HK 2JA5C 1J98A 1PJ5A 2NVTC 2R7ZA 4GTAA 2D6FC 1VLOA 2GSOA 4KMHA 4LOWA 4KMUA 3M3YK 3I4NC 2NVYK 4Y52K 4C3IK 5IP7K 1F7VA 2ZFZA 3AD7C 2R93C 2P5MA 2GSNA 2KWAA 2JA7A 1VGXA 2RH6A 1WSVA 3LPXA 4AH6A 3HOWC 3DXJA 3TTGA 3I4NK 1TWFC 4JK1A 3CAGA 4MEXA 1TWFA 4OIRA 1HQMA 2WAQD 3S1RC 1XZPA 5IYDK 3EQLA 2YU9A 3GTLK 2VUMA 3FHZA 3FKIK 1GE9A 1BDFA 3A8IA 1WIHA 3CQZC 4Q4ZA 3T01A 1TWGC 2E2JK 4MQ9A 4A3GC 5CJ9A 3S1MC 3HOYC 3H0GC 5C3EK 3TFHA 2E2HC 2JA5K 1O25A 4ILDA 4PABA 1YCLA 2CW0A 2NVTK 4XSXA 3M3YC 3BP8C 4KC6A 4A3DC 2NVXK 3GTOK 4KB4A 1TWAA 3S2DK 3LAJA 4C3IC 3RZOK 2BE5A 2R93K 4LLGA 1TWCC 5C3EC 2A6HA 3GTQK 3GTMK 2JA6A 3HOWK 5HL8A 1TWCA 4A3IC 1EQRA 1BS2A 5M5XK 1IW7A 2PA8D 3SZYA 2E2IC 1Y1VA 4FZBA 2ZUEA 4A3FC 1EFWA 2V6SA 3GTLC 1HI9A 2FQOA 1IBAA 4GT9A 4WJ3M 1KQ4A 3S14C 1IE0A 4A3MC 1USMA 4GTBA 1I50K 2NVYC 4Y52C 3G4AA 4KMAA 4Y7NK 1IQ0A 4MEYA 3CQZA 4BBSC 4C3HK 3GTPK 3GEHA 1WCMA 1O24A 4LJZA 5JVOA 3S1QK 4A3LC 3ADAC 3RZOC 4KMDA 1O2AA 3GDZA 5IYDC 1SFOA 3OEPA 1B4AA 1I6HK 2FQTA 4C3HC 3GTPC 3PO3K 4AYBD 1DCOA 4XSZA 3HOVC 4GTEA 3SZZA 2E2IK 2V6TA 4X6AC 1K83K 1O2FB 3N0CA 1PJ7A 2R7ZC 1O28A 3HOZK 2B63A 4P9SA 5IOSA 4ZH4A 5IYCC 3BUEA 4BLAA 1O27A 1PJ6A 3S0XA 1F93A 1F9NA 4A3DK 4X6AK 2RGRA 1WQFA 4BBRC 1I6VA 3S1NC 1TWHC 2JH3A 1X31C 3VA7A 2R7ZK 4RMFA 3PO2K 4G0UA 2PPBA 3S2HC 4BY7K 4BBSK 3GTJC 3GTGK 4QJVB 4FM9A 4LR2A 1L0WA 4C3JK 2A68A 4XLPA 1WOSA 4KN4A 3M4OK 1XPPA 3GTKC 4A3KK 4LK1A 1RU0A 3GTJK 1IL2A 1VJEA 1J6VA 4YFNA 1I3QA
chains in the Genus database with same CATH topology
4LK0A 2A6HA 3GTQK 3GTMK 1R9TC 5TMCA 3S2DC 3CQZK 4BBRK 3HOXC 1Y1WK 1I3QC 3K7AK 3HOWK 4A3IC 1WCMK 3S16C 2A69A 5M5XK 3HOUC 5FJ8K 1TWAC 1IW7A 2PA8D 2E2IC 4A3GK 3RZDC 5C4JC 2WB1D 5C4XK 4A3FC 5C4XC 2Y0SL 1SFOC 4BY7C 4A3LK 3S1QC 4BXXC 3HOYK 5M5YK 3H3VD 3PO3C 3GTLC 5IP9C 2WAQL 2JA8K 1I6HC 4A3FK 5M3FK 4G7OA 3S14C 4A3JC 2B63C 4A3MC 5C44C 3GTGC 1WCMC 3S16K 2PMZD 1I50K 2NVYC 4Y52C 4YFKA 5C4JK 2JA7K 2JA6C 4OIOA 3GTMC 1K83C 1I50C 4BY1K 4AYBL 5M5WK 4Y7NK 3S1RK 3S17C 5IYBC 3HOVK 1I3QK 3K7AC 3GTOC 4MEYA 4QIWL 2NVQC 4BBSC 2A6EA 4A93C 2Y0SD 3HKZL 4C3HK 2E2JC 3GTPK 1TWCK 3GTKK 3HKZD 3M4OC 4A3BC 3S1MK 4C2MK 5FLMK 4LJZA 1TWHK 4G7HA 4A3EC 2YU9K 2VUMK 3H3VL 3S1QK 4A3LC 1Y1VK 4YG2A 4YFXA 2E2HK 2JA5C 3RZOC 3RZDK 3FKIC 4NOIA 4BY1C 1TWGK 3HOUK 3S2HK 5IYDC 2NVTC 4OIPA 1R9TK 3S14K 4KMUA 2R92K 3M3YK 2NVYK 3I4NC 1ZYRA 4A3CC 1I6HK 4Y52K 3HOXK 1Y1WC 4OINA 3GTPC 4C3IK 5IP7K 3PO3K 4Q5SA 3S1NK 4A3BK 5TMFA 4A3MK 4AYBD 4XSZA 2R93C 5IYBK 3HOVC 2E2IK 4X6AC 1K83K 2NVXC 3WODA 4QIWD 3HOWC 2WB1L 3DXJA 2R92C 2R7ZC 3I4NK 4A3EK 1TWFC 4G7ZA 2YU9C 4JK1A 3HOZK 1TWAK 4MEXA 4OIRA 4A3JK 1HQMA 4ZH4A 1YNJA 1SMYA 2WAQD 5IYCC 4A3IK 3S1RC 3I4MC 3S15C 4A93K 2JA8C 5IYDK 3EQLA 2PMZL 3GTLK 4A3DK 4X6AK 3FKIK 5FLMC 2JA6K 2JA7C 5IYCK 1BDFA 4QJVA 3CQZC 4BBRC 1I6VA 3S1NC 1TWHC 4Q4ZA 2R7ZK 3PO2K 1TWGC 1SFOK 2PPBA 3S2HC 4BY7K 2E2JK 3H0GK 4MQ9A 4BBSK 4A3GC 3I4MK 3GTJC 3S15K 4OIQA 5C44K 5M3MK 3GTGK 3PO2C 2VUMC 4QJVB 5IP7C 3S1MC 2PA8L 3H0GC 5C3EK 4C3JK 4XLNA 2E2HC 2JA5K 2O5IA 2A68A 3HOYC 4A3CK 4XLPA 2CW0A 2NVQK 2NVTK 4KN4A 3M4OK 4KN7A 2O5JA 4XSXA 1XPPA 5D4DA 3GTKC 3M3YC 4A3KK 4Y7NC 3S17K 1Y1VC 4LK1A 4A3DC 2NVXK 3GTOK 2B63K 3GTJK 3GTQC 3S2DK 1TWFK 3HOZC 1YNNA 4A3KC 4YFNA 3RZOK 2BE5A 4BXXK 2R93K 4LLGA 1TWCC 4GZYA 5C3EC 5IP9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 A;  2A6H A;  3GTQ K;  3GTM K;  1R9T C;  5TMC A;  3S2D C;  3CQZ K;  4BBR K;  3HOX C;  1Y1W K;  1I3Q C;  3K7A K;  3HOW K;  4A3I C;  1WCM K;  3S16 C;  2A69 A;  5M5X K;  3HOU C;  5FJ8 K;  1TWA C;  1IW7 A;  2PA8 D;  2E2I C;  4A3G K;  3RZD C;  5C4J C;  2WB1 D;  5C4X K;  4A3F C;  5C4X C;  2Y0S L;  1SFO C;  4BY7 C;  4A3L K;  3S1Q C;  4BXX C;  3HOY K;  5M5Y K;  3H3V D;  3PO3 C;  3GTL C;  5IP9 C;  2WAQ L;  2JA8 K;  1I6H C;  4A3F K;  5M3F K;  4G7O A;  3S14 C;  4A3J C;  2B63 C;  4A3M C;  5C44 C;  3GTG C;  1WCM C;  3S16 K;  2PMZ D;  1I50 K;  2NVY C;  4Y52 C;  4YFK A;  5C4J K;  2JA7 K;  2JA6 C;  4OIO A;  3GTM C;  1K83 C;  1I50 C;  4BY1 K;  4AYB L;  5M5W K;  4Y7N K;  3S1R K;  3S17 C;  5IYB C;  3HOV K;  1I3Q K;  3K7A C;  3GTO C;  4MEY A;  4QIW L;  2NVQ C;  4BBS C;  2A6E A;  4A93 C;  2Y0S D;  3HKZ L;  4C3H K;  2E2J C;  3GTP K;  1TWC K;  3GTK K;  3HKZ D;  3M4O C;  4A3B C;  3S1M K;  4C2M K;  5FLM K;  4LJZ A;  1TWH K;  4G7H A;  4A3E C;  2YU9 K;  2VUM K;  3H3V L;  3S1Q K;  4A3L C;  1Y1V K;  4YG2 A;  4YFX A;  2E2H K;  2JA5 C;  3RZO C;  3RZD K;  3FKI C;  4NOI A;  4BY1 C;  1TWG K;  3HOU K;  3S2H K;  5IYD C;  2NVT C;  4OIP A;  1R9T K;  3S14 K;  4KMU A;  2R92 K;  3M3Y K;  2NVY K;  3I4N C;  1ZYR A;  4A3C C;  1I6H K;  4Y52 K;  3HOX K;  1Y1W C;  4OIN A;  3GTP C;  4C3I K;  5IP7 K;  3PO3 K;  4Q5S A;  3S1N K;  4A3B K;  5TMF A;  4A3M K;  4AYB D;  4XSZ A;  2R93 C;  5IYB K;  3HOV C;  2E2I K;  4X6A C;  1K83 K;  2NVX C;  3WOD A;  4QIW D;  3HOW C;  2WB1 L;  3DXJ A;  2R92 C;  2R7Z C;  3I4N K;  4A3E K;  1TWF C;  4G7Z A;  2YU9 C;  4JK1 A;  3HOZ K;  1TWA K;  4MEX A;  4OIR A;  4A3J K;  1HQM A;  4ZH4 A;  1YNJ A;  1SMY A;  2WAQ D;  5IYC C;  4A3I K;  3S1R C;  3I4M C;  3S15 C;  4A93 K;  2JA8 C;  5IYD K;  3EQL A;  2PMZ L;  3GTL K;  4A3D K;  4X6A K;  3FKI K;  5FLM C;  2JA6 K;  2JA7 C;  5IYC K;  1BDF A;  4QJV A;  3CQZ C;  4BBR C;  1I6V A;  3S1N C;  1TWH C;  4Q4Z A;  2R7Z K;  3PO2 K;  1TWG C;  1SFO K;  2PPB A;  3S2H C;  4BY7 K;  2E2J K;  3H0G K;  4MQ9 A;  4BBS K;  4A3G C;  3I4M K;  3GTJ C;  3S15 K;  4OIQ A;  5C44 K;  5M3M K;  3GTG K;  3PO2 C;  2VUM C;  4QJV B;  5IP7 C;  3S1M C;  2PA8 L;  3H0G C;  5C3E K;  4C3J K;  4XLN A;  2E2H C;  2JA5 K;  2O5I A;  2A68 A;  3HOY C;  4A3C K;  4XLP A;  2CW0 A;  2NVQ K;  2NVT K;  4KN4 A;  3M4O K;  4KN7 A;  2O5J A;  4XSX A;  1XPP A;  5D4D A;  3GTK C;  3M3Y C;  4A3K K;  4Y7N C;  3S17 K;  1Y1V C;  4LK1 A;  4A3D C;  2NVX K;  3GTO K;  2B63 K;  3GTJ K;  3GTQ C;  3S2D K;  1TWF K;  3HOZ C;  1YNN A;  4A3K C;  4YFN A;  3RZO K;  2BE5 A;  4BXX K;  2R93 K;  4LLG A;  1TWC C;  4GZY A;  5C3E C;  5IP9 K; 
#chains in the Genus database with same CATH topology
 4LK0 A;  3S2D C;  1R9T C;  1YX2 A;  3HOX C;  1Y1W K;  1I3Q C;  3K7A K;  4J3N A;  5EGH A;  3HOU C;  5FJ8 K;  4GFQ A;  2WB1 D;  2Y0S L;  1SFO C;  5M5Y K;  1G51 A;  5L46 A;  4A3F K;  2R92 A;  3NUH A;  4WJ4 A;  1J6W A;  2XCQ A;  4GTD A;  4O2D A;  1J6X A;  2JA7 K;  2JA6 C;  4OIO A;  3N3Y A;  1I50 C;  4C45 A;  1DCH A;  4AYB L;  4C3J C;  2R93 A;  3HOV K;  2XCO A;  3GTO C;  2A6E A;  1C0A A;  3GTK K;  1TWC K;  3AH5 A;  3M4O C;  4A3B C;  3TFI A;  1BGW A;  3FKI A;  4YG2 A;  4YFX A;  1ZBS A;  3RZD K;  3FKI C;  1XXC A;  3T02 A;  1TWG K;  1XZQ A;  1R9T K;  3H0G A;  4A3C C;  3HOX K;  1Y1W C;  4OIN A;  1V5V A;  2GAH C;  3AQP A;  1UV7 A;  2CFA A;  3JST A;  4P5A A;  3S1N K;  4Q5S A;  4A3B K;  5TMF A;  1USO A;  5IYB K;  1I50 A;  1WSR A;  2YU9 C;  4GTC A;  1TWA K;  3I4M C;  3S15 C;  1YNJ A;  5EGE A;  4A93 K;  3ORE A;  3L4K A;  3GSI A;  2JA8 C;  2PMZ L;  3AD9 C;  2ZUF A;  5FLM C;  2JA6 K;  2JA7 C;  5IYC K;  2E2H A;  4QJV A;  1WOO A;  3AQO A;  2NVY A;  3A8K A;  3I4M K;  3S15 K;  4KAS A;  5C44 K;  3PO2 C;  4BLB A;  4GTF A;  5IP7 C;  4XLN A;  2O5I A;  2NVQ K;  4KN7 A;  5D4D A;  4BKW A;  3S17 K;  3Q3Q A;  1Y1V C;  5TJ3 A;  1TWF K;  1YNN A;  4A3K C;  5IOT A;  4BXX K;  4GZY A;  5IP9 K;  2EBB A;  3GIR A;  1XXA A;  4G7Z A;  1ZVU A;  1EI6 A;  5TMC A;  3CQZ K;  3GTP A;  1ISE A;  4GTL A;  1TWH A;  1TWA C;  4A3G K;  5C4J C;  4A3L K;  1XZQ B;  3S1Q C;  3HOY K;  4BXX C;  3H3V D;  5IP9 C;  2WAQ L;  2JA8 K;  1I6H C;  3ERE D;  4LQY A;  2JA5 A;  4G7O A;  1VH2 A;  4A3J C;  2B63 C;  4WIL A;  1O29 A;  3GTG C;  4KM9 A;  2PHC B;  4YFK A;  5C4J K;  1K83 A;  2V6U A;  2NVX A;  3GTO A;  4KM8 A;  4PAA A;  5JFE A;  1DCP A;  1K83 C;  4KDD A;  4BY1 K;  3S1R K;  5IYB C;  4KAT A;  3GTQ A;  3GTM A;  2NVQ C;  3T00 A;  3N0B A;  1BJT A;  2Y0S D;  3HKZ L;  3V4G A;  3HKZ D;  4C2M K;  2YU9 K;  2VUM K;  3GTL A;  1Y1V K;  1JOE A;  4NOI A;  4BY1 C;  3S2H K;  3HOU K;  4OIP A;  4M1X A;  3S14 K;  3AD8 C;  2R92 K;  1ZYR A;  1ZXO A;  2Y3P A;  3IPJ A;  4A3M K;  2NVX C;  3WOD A;  4QIW D;  3GEI A;  1WQG A;  1ZQ1 C;  2WB1 L;  2R92 C;  1B4B A;  4A3E K;  4G0V A;  5IOR A;  1DD5 A;  4A3J K;  5C4X C;  1IS1 A;  1SMY A;  4KB2 A;  3QX3 A;  4A3I K;  3GTK A;  1O2B A;  3L4J A;  5E68 A;  2GAG C;  1TWG A;  1R9T A;  1SFO K;  1INN A;  1XXB A;  3HXA A;  3H0G K;  3LAP A;  4OIQ A;  5M3M K;  2XCR B;  3OPF A;  2VUM C;  2PA8 L;  4A3C K;  3MML B;  1XZP B;  4G0W A;  3FOE A;  3G4C A;  4KAW X;  4Y7N C;  2B63 K;  3GTQ C;  1O26 A;  3HOZ C;  2O5J A;  1EK8 A;  1WOR A;  1VRQ C;  4BBR K;  1JVI A;  2GSU A;  5IOQ A;  1WCM K;  2P8T A;  2A69 A;  3S16 C;  4P5B A;  1EH1 A;  3RZD C;  1F7U A;  5C4X K;  4BY7 C;  3PO3 C;  3GTG A;  4C2M C;  3GEE A;  3A8J A;  5M3F K;  4XCH A;  5C44 C;  1WCM C;  3S16 K;  1WQH A;  2PMZ D;  4DDQ A;  3BP3 A;  2E2I A;  3GTM C;  1JQW A;  3GTJ A;  2CFA B;  3TFJ A;  5M5W K;  3S17 C;  1I3Q K;  3K7A C;  4QIW L;  3FOF A;  1Y1W A;  4A93 C;  2W7V A;  5CHP A;  2E2J C;  1AB4 A;  4KAR A;  1WOP A;  3S1M K;  5FLM K;  4G7H A;  1TWH K;  4A3E C;  3H3V L;  2E2H K;  2JA5 C;  1J98 A;  1PJ5 A;  2NVT C;  2R7Z A;  4GTA A;  2D6F C;  1VLO A;  2GSO A;  4KMH A;  4LOW A;  4KMU A;  3M3Y K;  3I4N C;  2NVY K;  4Y52 K;  4C3I K;  5IP7 K;  1F7V A;  2ZFZ A;  3AD7 C;  2R93 C;  2P5M A;  2GSN A;  2KWA A;  2JA7 A;  1VGX A;  2RH6 A;  1WSV A;  3LPX A;  4AH6 A;  3HOW C;  3DXJ A;  3TTG A;  3I4N K;  1TWF C;  4JK1 A;  3CAG A;  4MEX A;  1TWF A;  4OIR A;  1HQM A;  2WAQ D;  3S1R C;  1XZP A;  5IYD K;  3EQL A;  2YU9 A;  3GTL K;  2VUM A;  3FHZ A;  3FKI K;  1GE9 A;  1BDF A;  3A8I A;  1WIH A;  3CQZ C;  4Q4Z A;  3T01 A;  1TWG C;  2E2J K;  4MQ9 A;  4A3G C;  5CJ9 A;  3S1M C;  3HOY C;  3H0G C;  5C3E K;  3TFH A;  2E2H C;  2JA5 K;  1O25 A;  4ILD A;  4PAB A;  1YCL A;  2CW0 A;  2NVT K;  4XSX A;  3M3Y C;  3BP8 C;  4KC6 A;  4A3D C;  2NVX K;  3GTO K;  4KB4 A;  1TWA A;  3S2D K;  3LAJ A;  4C3I C;  3RZO K;  2BE5 A;  2R93 K;  4LLG A;  1TWC C;  5C3E C;  2A6H A;  3GTQ K;  3GTM K;  2JA6 A;  3HOW K;  5HL8 A;  1TWC A;  4A3I C;  1EQR A;  1BS2 A;  5M5X K;  1IW7 A;  2PA8 D;  3SZY A;  2E2I C;  1Y1V A;  4FZB A;  2ZUE A;  4A3F C;  1EFW A;  2V6S A;  3GTL C;  1HI9 A;  2FQO A;  1IBA A;  4GT9 A;  4WJ3 M;  1KQ4 A;  3S14 C;  1IE0 A;  4A3M C;  1USM A;  4GTB A;  1I50 K;  2NVY C;  4Y52 C;  3G4A A;  4KMA A;  4Y7N K;  1IQ0 A;  4MEY A;  3CQZ A;  4BBS C;  4C3H K;  3GTP K;  3GEH A;  1WCM A;  1O24 A;  4LJZ A;  5JVO A;  3S1Q K;  4A3L C;  3ADA C;  3RZO C;  4KMD A;  1O2A A;  3GDZ A;  5IYD C;  1SFO A;  3OEP A;  1B4A A;  1I6H K;  2FQT A;  4C3H C;  3GTP C;  3PO3 K;  4AYB D;  1DCO A;  4XSZ A;  3HOV C;  4GTE A;  3SZZ A;  2E2I K;  2V6T A;  4X6A C;  1K83 K;  1O2F B;  3N0C A;  1PJ7 A;  2R7Z C;  1O28 A;  3HOZ K;  2B63 A;  4P9S A;  5IOS A;  4ZH4 A;  5IYC C;  3BUE A;  4BLA A;  1O27 A;  1PJ6 A;  3S0X A;  1F93 A;  1F9N A;  4A3D K;  4X6A K;  2RGR A;  1WQF A;  4BBR C;  1I6V A;  3S1N C;  1TWH C;  2JH3 A;  1X31 C;  3VA7 A;  2R7Z K;  4RMF A;  3PO2 K;  4G0U A;  2PPB A;  3S2H C;  4BY7 K;  4BBS K;  3GTJ C;  3GTG K;  4QJV B;  4FM9 A;  4LR2 A;  1L0W A;  4C3J K;  2A68 A;  4XLP A;  1WOS A;  4KN4 A;  3M4O K;  1XPP A;  3GTK C;  4A3K K;  4LK1 A;  1RU0 A;  3GTJ K;  1IL2 A;  1VJE A;  1J6V A;  4YFN A;  1I3Q A; 
#chains in the Genus database with same CATH homology
 4LK0 A;  2A6H A;  3GTQ K;  3GTM K;  1R9T C;  5TMC A;  3S2D C;  3CQZ K;  4BBR K;  3HOX C;  1Y1W K;  1I3Q C;  3K7A K;  3HOW K;  4A3I C;  1WCM K;  3S16 C;  2A69 A;  5M5X K;  3HOU C;  5FJ8 K;  1TWA C;  1IW7 A;  2PA8 D;  2E2I C;  4A3G K;  3RZD C;  5C4J C;  2WB1 D;  5C4X K;  4A3F C;  5C4X C;  2Y0S L;  1SFO C;  4BY7 C;  4A3L K;  3S1Q C;  4BXX C;  3HOY K;  5M5Y K;  3H3V D;  3PO3 C;  3GTL C;  5IP9 C;  2WAQ L;  2JA8 K;  1I6H C;  4A3F K;  5M3F K;  4G7O A;  3S14 C;  4A3J C;  2B63 C;  4A3M C;  5C44 C;  3GTG C;  1WCM C;  3S16 K;  2PMZ D;  1I50 K;  2NVY C;  4Y52 C;  4YFK A;  5C4J K;  2JA7 K;  2JA6 C;  4OIO A;  3GTM C;  1K83 C;  1I50 C;  4BY1 K;  4AYB L;  5M5W K;  4Y7N K;  3S1R K;  3S17 C;  5IYB C;  3HOV K;  1I3Q K;  3K7A C;  3GTO C;  4MEY A;  4QIW L;  2NVQ C;  4BBS C;  2A6E A;  4A93 C;  2Y0S D;  3HKZ L;  4C3H K;  2E2J C;  3GTP K;  1TWC K;  3GTK K;  3HKZ D;  3M4O C;  4A3B C;  3S1M K;  4C2M K;  5FLM K;  4LJZ A;  1TWH K;  4G7H A;  4A3E C;  2YU9 K;  2VUM K;  3H3V L;  3S1Q K;  4A3L C;  1Y1V K;  4YG2 A;  4YFX A;  2E2H K;  2JA5 C;  3RZO C;  3RZD K;  3FKI C;  4NOI A;  4BY1 C;  1TWG K;  3HOU K;  3S2H K;  5IYD C;  2NVT C;  4OIP A;  1R9T K;  3S14 K;  4KMU A;  2R92 K;  3M3Y K;  2NVY K;  3I4N C;  1ZYR A;  4A3C C;  1I6H K;  4Y52 K;  3HOX K;  1Y1W C;  4OIN A;  3GTP C;  4C3I K;  5IP7 K;  3PO3 K;  4Q5S A;  3S1N K;  4A3B K;  5TMF A;  4A3M K;  4AYB D;  4XSZ A;  2R93 C;  5IYB K;  3HOV C;  2E2I K;  4X6A C;  1K83 K;  2NVX C;  3WOD A;  4QIW D;  3HOW C;  2WB1 L;  3DXJ A;  2R92 C;  2R7Z C;  3I4N K;  4A3E K;  1TWF C;  4G7Z A;  2YU9 C;  4JK1 A;  3HOZ K;  1TWA K;  4MEX A;  4OIR A;  4A3J K;  1HQM A;  4ZH4 A;  1YNJ A;  1SMY A;  2WAQ D;  5IYC C;  4A3I K;  3S1R C;  3I4M C;  3S15 C;  4A93 K;  2JA8 C;  5IYD K;  3EQL A;  2PMZ L;  3GTL K;  4A3D K;  4X6A K;  3FKI K;  5FLM C;  2JA6 K;  2JA7 C;  5IYC K;  1BDF A;  4QJV A;  3CQZ C;  4BBR C;  1I6V A;  3S1N C;  1TWH C;  4Q4Z A;  2R7Z K;  3PO2 K;  1TWG C;  1SFO K;  2PPB A;  3S2H C;  4BY7 K;  2E2J K;  3H0G K;  4MQ9 A;  4BBS K;  4A3G C;  3I4M K;  3GTJ C;  3S15 K;  4OIQ A;  5C44 K;  5M3M K;  3GTG K;  3PO2 C;  2VUM C;  4QJV B;  5IP7 C;  3S1M C;  2PA8 L;  3H0G C;  5C3E K;  4C3J K;  4XLN A;  2E2H C;  2JA5 K;  2O5I A;  2A68 A;  3HOY C;  4A3C K;  4XLP A;  2CW0 A;  2NVQ K;  2NVT K;  4KN4 A;  3M4O K;  4KN7 A;  2O5J A;  4XSX A;  1XPP A;  5D4D A;  3GTK C;  3M3Y C;  4A3K K;  4Y7N C;  3S17 K;  1Y1V C;  4LK1 A;  4A3D C;  2NVX K;  3GTO K;  2B63 K;  3GTJ K;  3GTQ C;  3S2D K;  1TWF K;  3HOZ C;  1YNN A;  4A3K C;  4YFN A;  3RZO K;  2BE5 A;  4BXX K;  2R93 K;  4LLG A;  1TWC C;  4GZY A;  5C3E C;  5IP9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...