4A3EK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3eK00
4KMUA 3S14C 2E2JK 4A3FK 2VUMK 2R7ZK 3GTMC 4LLGA 1TWFC 4A93K 2A69A 5FLMK 1YNNA 5M5YK 1Y1WK 2E2IK 1TWHC 1ZYRA 4BY1C 4LK1A 3HOWC 3HOYK 4Y7NK 3GTLK 2CW0A 4YFKA 4A3FC 2E2JC 2E2HK 2R7ZC 4BY7K 3WODA 1BDFA 3PO2K 4LJZA 4A93C 4MEYA 2YU9K 5IYCK 1WCMK 1Y1WC 2R92C 4A3MK 3HOYC 3S1NK 4Y7NC 3GTLC 4BBSK 4NOIA 4BY7C 2JA5K 3M4OC 4BXXK 1WCMC 4OIRA 1TWHK 4YFNA 1R9TK 5IP9K 2O5IA 3S1MK 1TWAK 3HOXK 3S2DK 2NVQK 3S1NC 3EQLA 4BBSC 2O5JA 2JA6C 4OIOA 3HOZK 4BBRK 5TMCA 2JA5C 4BXXC 2Y0SL 3S2DC 1R9TC 4A3JC 1TWAC 3HOXC 4KN4A 2WAQL 4QJVA 3S1RK 2NVQC 3HOWK 4OINA 3HOZC 1TWGK 4BBRC 2Y0SD 3GTGK 4X6AK 2WAQD 2BE5A 3K7AC 4OIQA 3S1RC 4A3DK 1I6HK 5IP7K 1I3QK 1Y1VC 3S15K 1TWGC 2NVXK 4XSZA 3GTGC 3M4OK 4A3GK 4X6AC 4G7ZA 3H3VL 5M5WK 4A3DC 1I6HC 5IP7C 1I3QC 3S15C 2NVXC 2A6HA 3H3VD 4A3BC 4A3GC 3GTKK 5C3EK 4A3IK 1XPPA 3GTPC 3GTOC 4A3JK 3RZDK 5C4JC 4C2MK 1TWCK 4G7HA 1I6VA 1SMYA 4KN7A 4A3EK 3HKZL 5C3EC 4A3IC 3GTKC 3S16K 3H0GC 3DXJA 3K7AK 3RZDC 4A3KK 1TWCC 1Y1VK 2JA8K 4OIPA 3HKZD 1SFOK 4A3EC 5C44K 3GTJK 3S16C 3PO3K 4A3CK 2A6EA 4C3IK 4A3KC 1K83C 5D4DA 2JA8C 4C3JK 4Y52K 1IW7A 1SFOC 4A3LK 4Q4ZA 4JK1A 4A3BK 5C44C 3GTJC 3PO3C 2JA7K 5M3MK 3RZOC 4A3CC 3GTPK 3GTOK 2B63K 5C4JK 1YNJA 3HOVC 4Y52C 4A3LC 2PMZL 5M5XK 2JA7C 4XLPA 3H0GK 4MEXA 2B63C 3S17C 2R93K 3S2HK 1I50K 4XLNA 2PMZD 3M3YK 4G7OA 5TMFA 3I4MC 4QIWL 5IYDK 2WB1L 2NVTK 1K83K 3S2HC 1I50C 4MQ9A 2R93C 4QJVB 2PPBA 3HOUK 3M3YC 2VUMC 3FKIK 1HQMA 4QIWD 3S1QK 2WB1D 3RZOK 3GTQK 2NVYK 5FLMC 4YG2A 2E2IC 5IYDC 4Q5SA 2NVTC 2A68A 5FJ8K 4ZH4A 2PA8L 5IYBK 5M3FK 3HOVK 3HOUC 4LK0A 2E2HC 3FKIC 3I4NK 3S1QC 4YFXA 5C4XK 4C3HK 3PO2C 3GTQC 2NVYC 4XSXA 5IYCC 2PA8D 2YU9C 4A3MC 3S17K 4GZYA 3CQZK 2JA6K 2R92K 4AYBL 5IYBC 3I4NC 3S14K 3GTMK 5C4XC 3I4MK 1TWFK 4AYBD 4BY1K 3S1MC 5IP9C 3CQZC
chains in the Genus database with same CATH superfamily
4G0VA 3S14C 2VUMK 2NVYA 2V6TA 2A69A 4KB4A 1YNNA 5HL8A 4BY1C 3HOWC 2JH3A 4KARA 4BY7K 4GTAA 2R92A 4MEYA 2P8TA 3GTMA 4BBSK 4BY7C 1TWHA 1ZVUA 2GAHC 4BXXK 3Q3QA 4OIRA 4C45A 1GE9A 4P5BA 4BBSC 1B4BA 4AH6A 2CFAA 4BXXC 3TFJA 1IL2A 2E2HA 3S1RK 2WAQL 4OINA 1IE0A 1JOEA 4X6AK 1XXCA 2BE5A 3MMLB 4OIQA 3S1RC 1G51A 1I3QK 3FOFA 1WSVA 3CQZA 1TWAA 4X6AC 1BJTA 3SZZA 1I3QC 4KATA 3TTGA 2A6HA 1BGWA 3GTKK 4A3JK 5C4JC 3LAPA 1TWCK 4G7HA 3GTGA 1I6VA 1O2FB 1SMYA 3GTKC 3HKZL 3AQOA 2ZUEA 3H0GC 3K7AK 4FM9A 1DCPA 2NVXA 1TWCC 1Y1VK 2JA8K 1SFOK 2W7VA 2JA8C 3HXAA 1SFOC 3SZYA 4BLAA 5M3MK 3GTPK 1YNJA 3HOVC 2GSUA 5M5XK 3S2HK 2PMZD 3M3YK 5TMFA 4QIWL 2WB1L 3S2HC 3M3YC 3S1QK 3GEHA 3RZOK 2NVYK 5FLMC 3I4NK 3H0GA 3S1QC 1J6WA 5C4XK 3PO2C 1ZQ1C 2NVYC 4XSXA 2YU9C 3FHZA 4A3MC 3S17K 2R92K 1J98A 3I4NC 2FQOA 4FZBA 3GTMK 5C4XC 1B4AA 4AYBD 1WQFA 3A8KA 1WOPA 1TWHK 2R92C 1EH1A 1PJ6A 4KMUA 2E2JK 2V6SA 3GTMC 1F7UA 1TWHC 4KB2A 4LK1A 2CW0A 3BP3A 4YFKA 2E2JC 2E2HK 3T02A 3WODA 4GTCA 5IYCK 1PJ7A 2Y3PA 1TWFA 1AB4A 3M4OC 4XCHA 5CJ9A 1TWAK 2NVQK 3EQLA 2O5JA 4OIOA 1Y1WA 3G4CA 3T01A 1TWAC 5IORA 3HOWK 2NVQC 3IPJA 2YU9A 1WCMA 3GTGK 4ILDA 3OEPA 1DD5A 4A3DK 4M1XA 2PHCB 2P5MA 1VGXA 3AQPA 2GSNA 1J6VA 1R9TA 2NVXK 3GTGC 4A3GK 4G7ZA 4A3DC 1J6XA 3AD8C 4WJ4A 2NVXC 3H3VD 4A3BC 4A3GC 2FQTA 1XPPA 1TWGA 3RZDK 4C2MK 1IQ0A 5JVOA 1JVIA 3ERED 3S16K 3RZDC 1O26A 4C2MC 4OIPA 3AH5A 3S16C 4A3CK 1YCLA 1K83C 4Y52K 4A3LK 1O27A 4GTLA 4GTFA 4GT9A 4A3CC 5C4JK 3GDZA 4Y52C 4A3LC 2PMZL 4WILA 4XLPA 3H0GK 2XCQA 3A8IA 3GEEA 2KWAA 4XLNA 1WQGA 1O28A 2EBBA 1IS1A 4GTEA 1ZXOA 3S0XA 2PPBA 3HOUK 2JA7A 1INNA 1HQMA 3T00A 4G0WA 2E2IC 3A8JA 4GTDA 4Q5SA 4KAWX 1PJ5A 5FJ8K 2ZUFA 3HOVK 5IYBK 3HOUC 4P9SA 4YFXA 4C3HK 2R93A 4KMAA 1X31C 4AYBL 5IYBC 1DCHA 1EI6A 3N0BA 1BS2A 4C3HC 1TWFK 1K83A 3S1MC 5IP9C 3GIRA 3FKIA 1XZPA 4A3FK 4LLGA 1TWFC 2CFAB 5FLMK 3TFIA 5M5YK 1Y1WK 5L46A 1ZYRA 4PAAA 3GTLK 1XXAA 4A3FC 3PO2K 4LJZA 4KDDA 2YU9K 1WCMK 1Y1WC 1V5VA 4A3MK 3GTLC 3VA7A 3TFHA 1WCMC 4YFNA 1R9TK 2D6FC 2O5IA 4KM9A 3HOXK 2XCOA 2R7ZA 1F93A 4KMHA 5TMCA 2E2IA 4RMFA 1HI9A 1R9TC 3HOXC 3OPFA 1TWGK 4P5AA 2Y0SD 1I6HK 4KMDA 2JA5A 3AD7C 1TWGC 3L4KA 4XSZA 3M4OK 3H3VL 5M5WK 4PABA 1I6HC 1YX2A 1L0WA 3N0CA 1USOA 5C3EK 1O24A 3GTOC 1EFWA 5C3EC 3GTLA 4A3KK 1O25A 1XZPB 4KC6A 3JSTA 2A6EA 4A3KC 4C3JK 1IW7A 1WOOA 4KASA 4Q4ZA 4A3BK 2JA7K 1IBAA 4C3JC 4KM8A 4O2DA 2JA7C 4LQYA 1XZQA 1KQ4A 2R93K 1I50K 3FOEA 1RU0A 3GTJA 4G7OA 2ZFZA 3I4MC 4BLBA 2NVTK 2R93C 1K83K 1I50C 1WOSA 3AD9C 2VUMC 3FKIK 2RGRA 3GTOA 2B63A 4DDQA 4YG2A 1EQRA 2NVTC 2A68A 4ZH4A 5M3FK 3FKIC 1F7VA 3ADAC 2PA8D 4GZYA 5TJ3A 1C0AA 2XCRB 1VRQC 3GSIA 5IOTA 1ZBSA 4LOWA 3GTQA 1O29A 2R7ZK 1WSRA 4A93K 1USMA 2E2IK 3HOYK 4Y7NK 2R7ZC 1BDFA 2JA6A 4A93C 1WIHA 3HOYC 3S1NK 5CHPA 4Y7NC 2GSOA 4GFQA 4NOIA 3NUHA 2JA5K 3LPXA 3GEIA 5IOQA 1I50A 3S1MK 3S2DK 1VLOA 5IP9K 1EK8A 2VUMA 3S1NC 2JA6C 1WQHA 3HOZK 4BBRK 4J3NA 2JA5C 3QX3A 2Y0SL 2V6UA 3S2DC 4A3JC 4KN4A 1XZQB 3BUEA 4QJVA 3HOZC 4BBRC 1DCOA 2WAQD 3K7AC 5IP7K 1Y1VC 3S15K 1JQWA 2GAGC 5E68A 3N3YA 1VH2A 5IP7C 3L4JA 3S15C 5EGHA 1XXBA 1F9NA 4WJ3M 4A3IK 3GTPC 3G4AA 4KN7A 4A3EK 4A3IC 1I3QA 3DXJA 5JFEA 3HKZD 4A3EC 5C44K 3GTJK 3PO3K 3V4GA 4C3IK 4LR2A 3OREA 5D4DA 3GTKA 4JK1A 4GTBA 5C44C 3GTJC 3PO3C 3RZOC 1TWCA 3GTOK 2B63K 4C3IC 3CAGA 4BKWA 1VJEA 1ISEA 1Y1VA 4MEXA 2B63C 3S17C 1SFOA 5IOSA 1WORA 5IYDK 2RH6A 1UV7A 1O2BA 4MQ9A 4G0UA 4QJVB 3GTPA 4QIWD 2WB1D 3GTQK 3LAJA 5IYDC 2PA8L 4LK0A 2E2HC 3GTQC 5IYCC 3CQZK 2JA6K 5EGEA 3BP8C 3S14K 1O2AA 3I4MK 4BY1K 3CQZC
chains in the Genus database with same CATH topology
4KMUA 3S14C 2E2JK 4A3FK 2VUMK 2R7ZK 3GTMC 4LLGA 1TWFC 4A93K 2A69A 5FLMK 1YNNA 5M5YK 1Y1WK 2E2IK 1TWHC 1ZYRA 4BY1C 4LK1A 3HOWC 3HOYK 4Y7NK 3GTLK 2CW0A 4YFKA 4A3FC 2E2JC 2E2HK 2R7ZC 4BY7K 3WODA 1BDFA 3PO2K 4LJZA 4A93C 4MEYA 2YU9K 5IYCK 1WCMK 1Y1WC 2R92C 4A3MK 3HOYC 3S1NK 4Y7NC 3GTLC 4BBSK 4NOIA 4BY7C 2JA5K 3M4OC 4BXXK 1WCMC 4OIRA 1TWHK 4YFNA 1R9TK 5IP9K 2O5IA 3S1MK 1TWAK 3HOXK 3S2DK 2NVQK 3S1NC 3EQLA 4BBSC 2O5JA 2JA6C 4OIOA 3HOZK 4BBRK 5TMCA 2JA5C 4BXXC 2Y0SL 3S2DC 1R9TC 4A3JC 1TWAC 3HOXC 4KN4A 2WAQL 4QJVA 3S1RK 2NVQC 3HOWK 4OINA 3HOZC 1TWGK 4BBRC 2Y0SD 3GTGK 4X6AK 2WAQD 2BE5A 3K7AC 4OIQA 3S1RC 4A3DK 1I6HK 5IP7K 1I3QK 1Y1VC 3S15K 1TWGC 2NVXK 4XSZA 3GTGC 3M4OK 4A3GK 4X6AC 4G7ZA 3H3VL 5M5WK 4A3DC 1I6HC 5IP7C 1I3QC 3S15C 2NVXC 2A6HA 3H3VD 4A3BC 4A3GC 3GTKK 5C3EK 4A3IK 1XPPA 3GTPC 3GTOC 4A3JK 3RZDK 5C4JC 4C2MK 1TWCK 4G7HA 1I6VA 1SMYA 4KN7A 4A3EK 3HKZL 5C3EC 4A3IC 3GTKC 3S16K 3H0GC 3DXJA 3K7AK 3RZDC 4A3KK 1TWCC 1Y1VK 2JA8K 4OIPA 3HKZD 1SFOK 4A3EC 5C44K 3GTJK 3S16C 3PO3K 4A3CK 2A6EA 4C3IK 4A3KC 1K83C 5D4DA 2JA8C 4C3JK 4Y52K 1IW7A 1SFOC 4A3LK 4Q4ZA 4JK1A 4A3BK 5C44C 3GTJC 3PO3C 2JA7K 5M3MK 3RZOC 4A3CC 3GTPK 3GTOK 2B63K 5C4JK 1YNJA 3HOVC 4Y52C 4A3LC 2PMZL 5M5XK 2JA7C 4XLPA 3H0GK 4MEXA 2B63C 3S17C 2R93K 3S2HK 1I50K 4XLNA 2PMZD 3M3YK 4G7OA 5TMFA 3I4MC 4QIWL 5IYDK 2WB1L 2NVTK 1K83K 3S2HC 1I50C 4MQ9A 2R93C 4QJVB 2PPBA 3HOUK 3M3YC 2VUMC 3FKIK 1HQMA 4QIWD 3S1QK 2WB1D 3RZOK 3GTQK 2NVYK 5FLMC 4YG2A 2E2IC 5IYDC 4Q5SA 2NVTC 2A68A 5FJ8K 4ZH4A 2PA8L 5IYBK 5M3FK 3HOVK 3HOUC 4LK0A 2E2HC 3FKIC 3I4NK 3S1QC 4YFXA 5C4XK 4C3HK 3PO2C 3GTQC 2NVYC 4XSXA 5IYCC 2PA8D 2YU9C 4A3MC 3S17K 4GZYA 3CQZK 2JA6K 2R92K 4AYBL 5IYBC 3I4NC 3S14K 3GTMK 5C4XC 3I4MK 1TWFK 4AYBD 4BY1K 3S1MC 5IP9C 3CQZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMU A;  3S14 C;  2E2J K;  4A3F K;  2VUM K;  2R7Z K;  3GTM C;  4LLG A;  1TWF C;  4A93 K;  2A69 A;  5FLM K;  1YNN A;  5M5Y K;  1Y1W K;  2E2I K;  1TWH C;  1ZYR A;  4BY1 C;  4LK1 A;  3HOW C;  3HOY K;  4Y7N K;  3GTL K;  2CW0 A;  4YFK A;  4A3F C;  2E2J C;  2E2H K;  2R7Z C;  4BY7 K;  3WOD A;  1BDF A;  3PO2 K;  4LJZ A;  4A93 C;  4MEY A;  2YU9 K;  5IYC K;  1WCM K;  1Y1W C;  2R92 C;  4A3M K;  3HOY C;  3S1N K;  4Y7N C;  3GTL C;  4BBS K;  4NOI A;  4BY7 C;  2JA5 K;  3M4O C;  4BXX K;  1WCM C;  4OIR A;  1TWH K;  4YFN A;  1R9T K;  5IP9 K;  2O5I A;  3S1M K;  1TWA K;  3HOX K;  3S2D K;  2NVQ K;  3S1N C;  3EQL A;  4BBS C;  2O5J A;  2JA6 C;  4OIO A;  3HOZ K;  4BBR K;  5TMC A;  2JA5 C;  4BXX C;  2Y0S L;  3S2D C;  1R9T C;  4A3J C;  1TWA C;  3HOX C;  4KN4 A;  2WAQ L;  4QJV A;  3S1R K;  2NVQ C;  3HOW K;  4OIN A;  3HOZ C;  1TWG K;  4BBR C;  2Y0S D;  3GTG K;  4X6A K;  2WAQ D;  2BE5 A;  3K7A C;  4OIQ A;  3S1R C;  4A3D K;  1I6H K;  5IP7 K;  1I3Q K;  1Y1V C;  3S15 K;  1TWG C;  2NVX K;  4XSZ A;  3GTG C;  3M4O K;  4A3G K;  4X6A C;  4G7Z A;  3H3V L;  5M5W K;  4A3D C;  1I6H C;  5IP7 C;  1I3Q C;  3S15 C;  2NVX C;  2A6H A;  3H3V D;  4A3B C;  4A3G C;  3GTK K;  5C3E K;  4A3I K;  1XPP A;  3GTP C;  3GTO C;  4A3J K;  3RZD K;  5C4J C;  4C2M K;  1TWC K;  4G7H A;  1I6V A;  1SMY A;  4KN7 A;  4A3E K;  3HKZ L;  5C3E C;  4A3I C;  3GTK C;  3S16 K;  3H0G C;  3DXJ A;  3K7A K;  3RZD C;  4A3K K;  1TWC C;  1Y1V K;  2JA8 K;  4OIP A;  3HKZ D;  1SFO K;  4A3E C;  5C44 K;  3GTJ K;  3S16 C;  3PO3 K;  4A3C K;  2A6E A;  4C3I K;  4A3K C;  1K83 C;  5D4D A;  2JA8 C;  4C3J K;  4Y52 K;  1IW7 A;  1SFO C;  4A3L K;  4Q4Z A;  4JK1 A;  4A3B K;  5C44 C;  3GTJ C;  3PO3 C;  2JA7 K;  5M3M K;  3RZO C;  4A3C C;  3GTP K;  3GTO K;  2B63 K;  5C4J K;  1YNJ A;  3HOV C;  4Y52 C;  4A3L C;  2PMZ L;  5M5X K;  2JA7 C;  4XLP A;  3H0G K;  4MEX A;  2B63 C;  3S17 C;  2R93 K;  3S2H K;  1I50 K;  4XLN A;  2PMZ D;  3M3Y K;  4G7O A;  5TMF A;  3I4M C;  4QIW L;  5IYD K;  2WB1 L;  2NVT K;  1K83 K;  3S2H C;  1I50 C;  4MQ9 A;  2R93 C;  4QJV B;  2PPB A;  3HOU K;  3M3Y C;  2VUM C;  3FKI K;  1HQM A;  4QIW D;  3S1Q K;  2WB1 D;  3RZO K;  3GTQ K;  2NVY K;  5FLM C;  4YG2 A;  2E2I C;  5IYD C;  4Q5S A;  2NVT C;  2A68 A;  5FJ8 K;  4ZH4 A;  2PA8 L;  5IYB K;  5M3F K;  3HOV K;  3HOU C;  4LK0 A;  2E2H C;  3FKI C;  3I4N K;  3S1Q C;  4YFX A;  5C4X K;  4C3H K;  3PO2 C;  3GTQ C;  2NVY C;  4XSX A;  5IYC C;  2PA8 D;  2YU9 C;  4A3M C;  3S17 K;  4GZY A;  3CQZ K;  2JA6 K;  2R92 K;  4AYB L;  5IYB C;  3I4N C;  3S14 K;  3GTM K;  5C4X C;  3I4M K;  1TWF K;  4AYB D;  4BY1 K;  3S1M C;  5IP9 C;  3CQZ C; 
#chains in the Genus database with same CATH topology
 4G0V A;  3S14 C;  2VUM K;  2NVY A;  2V6T A;  2A69 A;  4KB4 A;  1YNN A;  5HL8 A;  4BY1 C;  3HOW C;  2JH3 A;  4KAR A;  4BY7 K;  4GTA A;  2R92 A;  4MEY A;  2P8T A;  3GTM A;  4BBS K;  4BY7 C;  1TWH A;  1ZVU A;  2GAH C;  4BXX K;  3Q3Q A;  4OIR A;  4C45 A;  1GE9 A;  4P5B A;  4BBS C;  1B4B A;  4AH6 A;  2CFA A;  4BXX C;  3TFJ A;  1IL2 A;  2E2H A;  3S1R K;  2WAQ L;  4OIN A;  1IE0 A;  1JOE A;  4X6A K;  1XXC A;  2BE5 A;  3MML B;  4OIQ A;  3S1R C;  1G51 A;  1I3Q K;  3FOF A;  1WSV A;  3CQZ A;  1TWA A;  4X6A C;  1BJT A;  3SZZ A;  1I3Q C;  4KAT A;  3TTG A;  2A6H A;  1BGW A;  3GTK K;  4A3J K;  5C4J C;  3LAP A;  1TWC K;  4G7H A;  3GTG A;  1I6V A;  1O2F B;  1SMY A;  3GTK C;  3HKZ L;  3AQO A;  2ZUE A;  3H0G C;  3K7A K;  4FM9 A;  1DCP A;  2NVX A;  1TWC C;  1Y1V K;  2JA8 K;  1SFO K;  2W7V A;  2JA8 C;  3HXA A;  1SFO C;  3SZY A;  4BLA A;  5M3M K;  3GTP K;  1YNJ A;  3HOV C;  2GSU A;  5M5X K;  3S2H K;  2PMZ D;  3M3Y K;  5TMF A;  4QIW L;  2WB1 L;  3S2H C;  3M3Y C;  3S1Q K;  3GEH A;  3RZO K;  2NVY K;  5FLM C;  3I4N K;  3H0G A;  3S1Q C;  1J6W A;  5C4X K;  3PO2 C;  1ZQ1 C;  2NVY C;  4XSX A;  2YU9 C;  3FHZ A;  4A3M C;  3S17 K;  2R92 K;  1J98 A;  3I4N C;  2FQO A;  4FZB A;  3GTM K;  5C4X C;  1B4A A;  4AYB D;  1WQF A;  3A8K A;  1WOP A;  1TWH K;  2R92 C;  1EH1 A;  1PJ6 A;  4KMU A;  2E2J K;  2V6S A;  3GTM C;  1F7U A;  1TWH C;  4KB2 A;  4LK1 A;  2CW0 A;  3BP3 A;  4YFK A;  2E2J C;  2E2H K;  3T02 A;  3WOD A;  4GTC A;  5IYC K;  1PJ7 A;  2Y3P A;  1TWF A;  1AB4 A;  3M4O C;  4XCH A;  5CJ9 A;  1TWA K;  2NVQ K;  3EQL A;  2O5J A;  4OIO A;  1Y1W A;  3G4C A;  3T01 A;  1TWA C;  5IOR A;  3HOW K;  2NVQ C;  3IPJ A;  2YU9 A;  1WCM A;  3GTG K;  4ILD A;  3OEP A;  1DD5 A;  4A3D K;  4M1X A;  2PHC B;  2P5M A;  1VGX A;  3AQP A;  2GSN A;  1J6V A;  1R9T A;  2NVX K;  3GTG C;  4A3G K;  4G7Z A;  4A3D C;  1J6X A;  3AD8 C;  4WJ4 A;  2NVX C;  3H3V D;  4A3B C;  4A3G C;  2FQT A;  1XPP A;  1TWG A;  3RZD K;  4C2M K;  1IQ0 A;  5JVO A;  1JVI A;  3ERE D;  3S16 K;  3RZD C;  1O26 A;  4C2M C;  4OIP A;  3AH5 A;  3S16 C;  4A3C K;  1YCL A;  1K83 C;  4Y52 K;  4A3L K;  1O27 A;  4GTL A;  4GTF A;  4GT9 A;  4A3C C;  5C4J K;  3GDZ A;  4Y52 C;  4A3L C;  2PMZ L;  4WIL A;  4XLP A;  3H0G K;  2XCQ A;  3A8I A;  3GEE A;  2KWA A;  4XLN A;  1WQG A;  1O28 A;  2EBB A;  1IS1 A;  4GTE A;  1ZXO A;  3S0X A;  2PPB A;  3HOU K;  2JA7 A;  1INN A;  1HQM A;  3T00 A;  4G0W A;  2E2I C;  3A8J A;  4GTD A;  4Q5S A;  4KAW X;  1PJ5 A;  5FJ8 K;  2ZUF A;  3HOV K;  5IYB K;  3HOU C;  4P9S A;  4YFX A;  4C3H K;  2R93 A;  4KMA A;  1X31 C;  4AYB L;  5IYB C;  1DCH A;  1EI6 A;  3N0B A;  1BS2 A;  4C3H C;  1TWF K;  1K83 A;  3S1M C;  5IP9 C;  3GIR A;  3FKI A;  1XZP A;  4A3F K;  4LLG A;  1TWF C;  2CFA B;  5FLM K;  3TFI A;  5M5Y K;  1Y1W K;  5L46 A;  1ZYR A;  4PAA A;  3GTL K;  1XXA A;  4A3F C;  3PO2 K;  4LJZ A;  4KDD A;  2YU9 K;  1WCM K;  1Y1W C;  1V5V A;  4A3M K;  3GTL C;  3VA7 A;  3TFH A;  1WCM C;  4YFN A;  1R9T K;  2D6F C;  2O5I A;  4KM9 A;  3HOX K;  2XCO A;  2R7Z A;  1F93 A;  4KMH A;  5TMC A;  2E2I A;  4RMF A;  1HI9 A;  1R9T C;  3HOX C;  3OPF A;  1TWG K;  4P5A A;  2Y0S D;  1I6H K;  4KMD A;  2JA5 A;  3AD7 C;  1TWG C;  3L4K A;  4XSZ A;  3M4O K;  3H3V L;  5M5W K;  4PAB A;  1I6H C;  1YX2 A;  1L0W A;  3N0C A;  1USO A;  5C3E K;  1O24 A;  3GTO C;  1EFW A;  5C3E C;  3GTL A;  4A3K K;  1O25 A;  1XZP B;  4KC6 A;  3JST A;  2A6E A;  4A3K C;  4C3J K;  1IW7 A;  1WOO A;  4KAS A;  4Q4Z A;  4A3B K;  2JA7 K;  1IBA A;  4C3J C;  4KM8 A;  4O2D A;  2JA7 C;  4LQY A;  1XZQ A;  1KQ4 A;  2R93 K;  1I50 K;  3FOE A;  1RU0 A;  3GTJ A;  4G7O A;  2ZFZ A;  3I4M C;  4BLB A;  2NVT K;  2R93 C;  1K83 K;  1I50 C;  1WOS A;  3AD9 C;  2VUM C;  3FKI K;  2RGR A;  3GTO A;  2B63 A;  4DDQ A;  4YG2 A;  1EQR A;  2NVT C;  2A68 A;  4ZH4 A;  5M3F K;  3FKI C;  1F7V A;  3ADA C;  2PA8 D;  4GZY A;  5TJ3 A;  1C0A A;  2XCR B;  1VRQ C;  3GSI A;  5IOT A;  1ZBS A;  4LOW A;  3GTQ A;  1O29 A;  2R7Z K;  1WSR A;  4A93 K;  1USM A;  2E2I K;  3HOY K;  4Y7N K;  2R7Z C;  1BDF A;  2JA6 A;  4A93 C;  1WIH A;  3HOY C;  3S1N K;  5CHP A;  4Y7N C;  2GSO A;  4GFQ A;  4NOI A;  3NUH A;  2JA5 K;  3LPX A;  3GEI A;  5IOQ A;  1I50 A;  3S1M K;  3S2D K;  1VLO A;  5IP9 K;  1EK8 A;  2VUM A;  3S1N C;  2JA6 C;  1WQH A;  3HOZ K;  4BBR K;  4J3N A;  2JA5 C;  3QX3 A;  2Y0S L;  2V6U A;  3S2D C;  4A3J C;  4KN4 A;  1XZQ B;  3BUE A;  4QJV A;  3HOZ C;  4BBR C;  1DCO A;  2WAQ D;  3K7A C;  5IP7 K;  1Y1V C;  3S15 K;  1JQW A;  2GAG C;  5E68 A;  3N3Y A;  1VH2 A;  5IP7 C;  3L4J A;  3S15 C;  5EGH A;  1XXB A;  1F9N A;  4WJ3 M;  4A3I K;  3GTP C;  3G4A A;  4KN7 A;  4A3E K;  4A3I C;  1I3Q A;  3DXJ A;  5JFE A;  3HKZ D;  4A3E C;  5C44 K;  3GTJ K;  3PO3 K;  3V4G A;  4C3I K;  4LR2 A;  3ORE A;  5D4D A;  3GTK A;  4JK1 A;  4GTB A;  5C44 C;  3GTJ C;  3PO3 C;  3RZO C;  1TWC A;  3GTO K;  2B63 K;  4C3I C;  3CAG A;  4BKW A;  1VJE A;  1ISE A;  1Y1V A;  4MEX A;  2B63 C;  3S17 C;  1SFO A;  5IOS A;  1WOR A;  5IYD K;  2RH6 A;  1UV7 A;  1O2B A;  4MQ9 A;  4G0U A;  4QJV B;  3GTP A;  4QIW D;  2WB1 D;  3GTQ K;  3LAJ A;  5IYD C;  2PA8 L;  4LK0 A;  2E2H C;  3GTQ C;  5IYC C;  3CQZ K;  2JA6 K;  5EGE A;  3BP8 C;  3S14 K;  1O2A A;  3I4M K;  4BY1 K;  3CQZ C; 
#chains in the Genus database with same CATH homology
 4KMU A;  3S14 C;  2E2J K;  4A3F K;  2VUM K;  2R7Z K;  3GTM C;  4LLG A;  1TWF C;  4A93 K;  2A69 A;  5FLM K;  1YNN A;  5M5Y K;  1Y1W K;  2E2I K;  1TWH C;  1ZYR A;  4BY1 C;  4LK1 A;  3HOW C;  3HOY K;  4Y7N K;  3GTL K;  2CW0 A;  4YFK A;  4A3F C;  2E2J C;  2E2H K;  2R7Z C;  4BY7 K;  3WOD A;  1BDF A;  3PO2 K;  4LJZ A;  4A93 C;  4MEY A;  2YU9 K;  5IYC K;  1WCM K;  1Y1W C;  2R92 C;  4A3M K;  3HOY C;  3S1N K;  4Y7N C;  3GTL C;  4BBS K;  4NOI A;  4BY7 C;  2JA5 K;  3M4O C;  4BXX K;  1WCM C;  4OIR A;  1TWH K;  4YFN A;  1R9T K;  5IP9 K;  2O5I A;  3S1M K;  1TWA K;  3HOX K;  3S2D K;  2NVQ K;  3S1N C;  3EQL A;  4BBS C;  2O5J A;  2JA6 C;  4OIO A;  3HOZ K;  4BBR K;  5TMC A;  2JA5 C;  4BXX C;  2Y0S L;  3S2D C;  1R9T C;  4A3J C;  1TWA C;  3HOX C;  4KN4 A;  2WAQ L;  4QJV A;  3S1R K;  2NVQ C;  3HOW K;  4OIN A;  3HOZ C;  1TWG K;  4BBR C;  2Y0S D;  3GTG K;  4X6A K;  2WAQ D;  2BE5 A;  3K7A C;  4OIQ A;  3S1R C;  4A3D K;  1I6H K;  5IP7 K;  1I3Q K;  1Y1V C;  3S15 K;  1TWG C;  2NVX K;  4XSZ A;  3GTG C;  3M4O K;  4A3G K;  4X6A C;  4G7Z A;  3H3V L;  5M5W K;  4A3D C;  1I6H C;  5IP7 C;  1I3Q C;  3S15 C;  2NVX C;  2A6H A;  3H3V D;  4A3B C;  4A3G C;  3GTK K;  5C3E K;  4A3I K;  1XPP A;  3GTP C;  3GTO C;  4A3J K;  3RZD K;  5C4J C;  4C2M K;  1TWC K;  4G7H A;  1I6V A;  1SMY A;  4KN7 A;  4A3E K;  3HKZ L;  5C3E C;  4A3I C;  3GTK C;  3S16 K;  3H0G C;  3DXJ A;  3K7A K;  3RZD C;  4A3K K;  1TWC C;  1Y1V K;  2JA8 K;  4OIP A;  3HKZ D;  1SFO K;  4A3E C;  5C44 K;  3GTJ K;  3S16 C;  3PO3 K;  4A3C K;  2A6E A;  4C3I K;  4A3K C;  1K83 C;  5D4D A;  2JA8 C;  4C3J K;  4Y52 K;  1IW7 A;  1SFO C;  4A3L K;  4Q4Z A;  4JK1 A;  4A3B K;  5C44 C;  3GTJ C;  3PO3 C;  2JA7 K;  5M3M K;  3RZO C;  4A3C C;  3GTP K;  3GTO K;  2B63 K;  5C4J K;  1YNJ A;  3HOV C;  4Y52 C;  4A3L C;  2PMZ L;  5M5X K;  2JA7 C;  4XLP A;  3H0G K;  4MEX A;  2B63 C;  3S17 C;  2R93 K;  3S2H K;  1I50 K;  4XLN A;  2PMZ D;  3M3Y K;  4G7O A;  5TMF A;  3I4M C;  4QIW L;  5IYD K;  2WB1 L;  2NVT K;  1K83 K;  3S2H C;  1I50 C;  4MQ9 A;  2R93 C;  4QJV B;  2PPB A;  3HOU K;  3M3Y C;  2VUM C;  3FKI K;  1HQM A;  4QIW D;  3S1Q K;  2WB1 D;  3RZO K;  3GTQ K;  2NVY K;  5FLM C;  4YG2 A;  2E2I C;  5IYD C;  4Q5S A;  2NVT C;  2A68 A;  5FJ8 K;  4ZH4 A;  2PA8 L;  5IYB K;  5M3F K;  3HOV K;  3HOU C;  4LK0 A;  2E2H C;  3FKI C;  3I4N K;  3S1Q C;  4YFX A;  5C4X K;  4C3H K;  3PO2 C;  3GTQ C;  2NVY C;  4XSX A;  5IYC C;  2PA8 D;  2YU9 C;  4A3M C;  3S17 K;  4GZY A;  3CQZ K;  2JA6 K;  2R92 K;  4AYB L;  5IYB C;  3I4N C;  3S14 K;  3GTM K;  5C4X C;  3I4M K;  1TWF K;  4AYB D;  4BY1 K;  3S1M C;  5IP9 C;  3CQZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...