5IYBK

Human core-pic in the open state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iybK00
1I3QK 1XPPA 2R93K 4X6AK 4A93C 4A3LC 4JK1A 2WB1D 1TWCC 4YFKA 1I6VA 1YNJA 5C44C 4A3DC 3I4NC 3GTJC 2R92K 3S17C 4A3IK 3HOZK 3GTOK 3M3YK 1TWHK 1BDFA 1WCMC 4A3GC 4GZYA 3HOUK 1I50C 3GTGC 4BXXC 2PMZL 1I6HC 4MQ9A 5M3FK 3RZDC 3S2DC 4A3MC 3GTLK 2O5JA 5IP9K 4MEYA 3HKZD 4Y52C 5M5XK 5IYCC 1K83K 2JA8C 3S17K 3GTLC 3WODA 3EQLA 4ZH4A 4KN7A 4Y7NC 1Y1WK 3I4MK 4XLNA 3HOXK 4A3BC 5TMFA 1Y1VK 5FLMC 4QJVA 2A69A 1HQMA 2R93C 4X6AC 1YNNA 3H0GK 3HOVK 2NVXC 3S1RK 4XSXA 3S2DK 2PA8L 4Q5SA 3GTMK 5FLMK 1TWFK 5TMCA 4QIWD 4QIWL 4OIPA 1ZYRA 5C4XC 3S1QC 2WAQD 4A3EK 2PA8D 5IYBK 5IYDC 1R9TK 2WB1L 1TWFC 3S16C 3M4OC 3S2HC 4A3CC 4XLPA 2NVQK 4OINA 1IW7A 2JA5K 3HOWC 3S1NC 1K83C 2E2JK 4A3DK 1SFOC 4MEXA 2R92C 2VUMC 3S14C 2NVTK 4A3KC 4NOIA 4QJVB 4A3EC 2PPBA 3GTQK 5M3MK 3PO3K 3H0GC 3HOVC 4A3FC 3M4OK 2A68A 4OIQA 3HOYK 3GTPC 3GTQC 1TWHC 4A3GK 2NVYC 5C3EK 3HOUC 4YG2A 4C2MK 3GTMC 2E2HK 3GTPK 4KMUA 4LK1A 3GTJK 1TWGK 1Y1WC 2NVQC 3GTKC 3FKIC 2JA7C 4Y52K 4Q4ZA 1R9TC 3K7AC 1Y1VC 2E2JC 1I3QC 4LJZA 2A6HA 4AYBD 4A3FK 2NVTC 2NVYK 2PMZD 4G7ZA 3RZDK 5C4JK 2O5IA 3S15K 4BY7K 4LLGA 4OIRA 3HOZC 5IYCK 3DXJA 5M5YK 5M5WK 2Y0SD 3S1MK 3H3VL 2WAQL 2NVXK 5D4DA 4A3CK 1TWCK 5C44K 1TWAC 5IP7C 3FKIK 2CW0A 4Y7NK 1I50K 4LK0A 4BXXK 4A3BK 4XSZA 3HOXC 4BY1C 3HOYC 2VUMK 4AYBL 2E2IK 2JA6K 2JA8K 3S2HK 3GTKK 3HOWK 5C4JC 3S1NK 3CQZK 3S15C 3S1MC 4BY7C 2E2HC 2E2IC 4G7HA 3PO3C 5IP9C 4BBRC 4A3JC 2B63C 2YU9K 3RZOK 4BBSC 3S1QK 4OIOA 3K7AK 3M3YC 4A3KK 3HKZL 3PO2K 4G7OA 4KN4A 1WCMK 4A3IC 2R7ZK 2JA5C 3S1RC 4BY1K 2BE5A 3GTOC 4C3HK 3I4MC 1SFOK 2JA6C 1TWGC 4A3LK 5IP7K 2R7ZC 3I4NK 5C4XK 4A93K 3S14K 1I6HK 4BBRK 4A3JK 5FJ8K 2B63K 3RZOC 3S16K 5C3EC 4BBSK 1SMYA 5IYDK 3H3VD 2Y0SL 1TWAK 4YFNA 2YU9C 4YFXA 2JA7K 2A6EA 3GTGK 3PO2C 3CQZC 4C3IK 5IYBC 4C3JK 4A3MK
chains in the Genus database with same CATH superfamily
4A3LC 2V6SA 4A3DC 1BGWA 4BLAA 1O26A 3A8KA 4A3GC 4C3JC 3HOUK 3GTGC 1I6HC 2PMZL 2JA6A 4AH6A 3S2DC 4MEYA 1WOSA 4Y52C 5M5XK 3S17K 1BS2A 3AH5A 4KARA 1Y1WK 1ZBSA 4XLNA 5TMFA 1F93A 4QJVA 2XCOA 1YNNA 4PABA 1TWFK 1DCHA 4QIWD 4QIWL 4OIPA 1ZYRA 5C4XC 4A3EK 1K83A 1F7VA 1DCPA 1TWFC 2NVQK 3N0CA 4XCHA 2VUMC 3A8IA 5JFEA 3GTOA 3G4AA 2PPBA 2R92A 3PO3K 3JSTA 2R93A 4KB4A 3LAPA 3HOYK 1ZQ1C 4KMHA 3GTPC 2NVYC 1ZVUA 3GTPK 1J6VA 5IOTA 1TWGK 2CFAB 3AQOA 2B63A 2E2JC 1IQ0A 1IBAA 4LJZA 4G7ZA 2PMZD 1GE9A 1O27A 1AB4A 3HOZC 2V6UA 5M5YK 3DXJA 5M5WK 2NVXK 4GFQA 4A3CK 3BP3A 4KB2A 1JOEA 1I50K 3QX3A 1BJTA 4XSZA 2GAGC 4BY1C 3HOYC 4BKWA 1TWHA 3S1NK 4LR2A 2E2IC 4BBRC 4A3JC 1USMA 1VJEA 4G0WA 3S1QK 3N0BA 4KN4A 5CJ9A 1I3QA 3S1RC 4BY1K 2BE5A 3GTOC 4GTCA 1HI9A 1IE0A 2JA6C 3GTGA 4A3LK 3S14K 1I6HK 3RZOC 1G51A 1F7UA 1V5VA 3VA7A 5IYDK 1TWGA 4YFNA 3GTPA 4YFXA 3GTGK 3PO2C 4C3IK 2JH3A 4C3JK 1I3QK 2R93K 5E68A 1PJ7A 4JK1A 1YX2A 1C0AA 4YFKA 1YNJA 3OEPA 3GTJC 2R92K 3S17C 4A3IK 4ILDA 2KWAA 3ADAC 3AD8C 4C45A 3M3YK 2GAHC 1TWHK 3TFJA 2JA5A 2O5JA 1ISEA 3HKZD 2JA8C 4KDDA 4ZH4A 4Y7NC 5FLMC 1PJ5A 2R93C 4XSXA 1Y1WA 2P5MA 1XZQB 5FLMK 5TMCA 2WAQD 5IYBK 3S16C 1IL2A 3S2HC 4XLPA 4OINA 3HOWC 1K83C 1J6XA 2E2JK 3MMLB 4BLBA 1O2AA 4MEXA 1PJ6A 3FHZA 4A3KC 2PHCB 2ZFZA 4KM9A 4NOIA 4QJVB 3H0GC 1O25A 3HOVC 2A68A 4A3GK 5C3EK 2JA7A 4C3HC 3HXAA 4KMUA 4LK1A 1Y1VC 2XCQA 1SFOA 2NVTC 4LOWA 1ZXOA 2R7ZA 3S15K 4GTBA 1WCMA 1EH1A 1O24A 3H3VL 2YU9A 5D4DA 5IP7C 3FKIK 2CW0A 4Y7NK 4BXXK 4LK0A 1XZPA 3AD7C 2JA6K 3V4GA 5IORA 3GTKK 3S15C 3FOEA 3FKIA 5EGHA 3RZOK 4LQYA 1O29A 2EBBA 3S0XA 3GSIA 4GTAA 3M3YC 3L4KA 3PO2K 4G7OA 1UV7A 1WCMK 4A3IC 4FZBA 4GTLA 3T01A 3TFIA 1SMYA 2Y0SL 5TJ3A 1VRQC 1IS1A 1DCOA 3CQZC 4X6AK 1DD5A 1TWCC 1I6VA 5IOSA 2V6TA 3HOZK 2GSOA 2D6FC 3NUHA 1XXCA 1BDFA 1WCMC 1INNA 1WOOA 3FOFA 3GTKA 3OREA 4GZYA 1I50C 2CFAA 2VUMA 5M3FK 3RZDC 5IP9K 5IYCC 1KQ4A 3TTGA 4GTEA 3WODA 1VGXA 3HOXK 1X31C 3H0GA 2NVYA 1HQMA 1WSVA 4X6AC 2PA8L 3GTMK 4M1XA 3T00A 5EGEA 1J98A 2E2HA 2PA8D 2WB1L 4A3CC 2XCRB 1IW7A 2JA5K 2ZUFA 2FQTA 2GSNA 1SFOC 4KMDA 3GEHA 1EI6A 1WIHA 3GTQK 1YCLA 5M3MK 4A3FC 4OIQA 1TWHC 5JVOA 3LAJA 3HOUC 1WORA 4YG2A 4C2MK 1R9TA 3GTMC 3GTJK 2NVQC 3GTKC 3FKIC 2GSUA 2JA7C 4Y52K 4Q4ZA 3K7AC 1I3QC 2Y3PA 2A6HA 4AYBD 4A3FK 1Y1VA 4KASA 5C4JK 4BY7K 5IYCK 5CHPA 3GEIA 2Y0SD 2WAQL 4KM8A 4O2DA 1TWCK 1WQFA 4P5BA 4DDQA 4A3BK 3GTLA 1F9NA 3AD9C 3N3YA 4AYBL 1WQHA 3HOWK 5C4JC 4BY7C 4C3IC 3S1MC 2E2HC 1TWCA 3OPFA 2NVXA 4OIOA 3K7AK 4A3KK 3HKZL 4GTDA 1WSRA 4KAWX 2JA5C 4G0UA 1XXBA 1RU0A 5C4XK 3I4NK 2B63K 4BBSK 5FJ8K 1TWAA 3S16K 5C3EC 3H3VD 1TWAK 3GIRA 3LPXA 1VLOA 2A6EA 1EK8A 5IYBC 4A3MK 1XPPA 4A93C 2WB1D 2W7VA 3L4JA 3ERED 5C44C 3GEEA 3GTQA 3I4NC 4WJ3M 2RH6A 1USOA 4GTFA 3GTOK 1WOPA 1XXAA 4BXXC 2RGRA 4MQ9A 4A3MC 3AQPA 3GTLK 1O28A 1I50A 5HL8A 1K83K 4P9SA 3T02A 5L46A 1O2FB 3GTLC 1B4AA 3EQLA 2ZUEA 4KN7A 3I4MK 1O2BA 1VH2A 1XZQA 4A3BC 1Y1VK 1L0WA 2A69A 3H0GK 3HOVK 4G0VA 2NVXC 3S1RK 3S2DK 4Q5SA 3GDZA 3GTJA 3S1QC 1R9TK 5IYDC 4KC6A 3M4OC 3Q3QA 3S1NC 4KATA 4A3DK 3G4CA 2R92C 3S14C 1J6WA 2NVTK 4C2MC 4A3EC 1WQGA 3M4OK 4WILA 2P8TA 4P5AA 3GTQC 4FM9A 2E2HK 4WJ4A 1Y1WC 1JVIA 1TWFA 4PAAA 3CAGA 1R9TC 3GTMA 2NVYK 3RZDK 2O5IA 4LLGA 4OIRA 3IPJA 1XZPB 3S1MK 3SZYA 5C44K 4GT9A 3SZZA 1TWAC 3TFHA 3CQZA 3HOXC 2VUMK 2E2IK 2E2IA 2JA8K 3S2HK 4RMFA 3CQZK 1B4BA 3A8JA 1EQRA 3BUEA 4G7HA 1JQWA 3PO3C 5IP9C 4KMAA 2B63C 4BBSC 2YU9K 2FQOA 1EFWA 4J3NA 2R7ZK 4C3HK 3I4MC 1SFOK 1TWGC 4A93K 5IP7K 2R7ZC 4BBRK 4A3JK 3BP8C 2YU9C 2JA7K 5IOQA
chains in the Genus database with same CATH topology
1I3QK 1XPPA 2R93K 4X6AK 4A93C 4A3LC 4JK1A 2WB1D 1TWCC 4YFKA 1I6VA 1YNJA 5C44C 4A3DC 3I4NC 3GTJC 2R92K 3S17C 4A3IK 3HOZK 3GTOK 3M3YK 1TWHK 1BDFA 1WCMC 4A3GC 4GZYA 3HOUK 1I50C 3GTGC 4BXXC 2PMZL 1I6HC 4MQ9A 5M3FK 3RZDC 3S2DC 4A3MC 3GTLK 2O5JA 5IP9K 4MEYA 3HKZD 4Y52C 5M5XK 5IYCC 1K83K 2JA8C 3S17K 3GTLC 3WODA 3EQLA 4ZH4A 4KN7A 4Y7NC 1Y1WK 3I4MK 4XLNA 3HOXK 4A3BC 5TMFA 1Y1VK 5FLMC 4QJVA 2A69A 1HQMA 2R93C 4X6AC 1YNNA 3H0GK 3HOVK 2NVXC 3S1RK 4XSXA 3S2DK 2PA8L 4Q5SA 3GTMK 5FLMK 1TWFK 5TMCA 4QIWD 4QIWL 4OIPA 1ZYRA 5C4XC 3S1QC 2WAQD 4A3EK 2PA8D 5IYBK 5IYDC 1R9TK 2WB1L 1TWFC 3S16C 3M4OC 3S2HC 4A3CC 4XLPA 2NVQK 4OINA 1IW7A 2JA5K 3HOWC 3S1NC 1K83C 2E2JK 4A3DK 1SFOC 4MEXA 2R92C 2VUMC 3S14C 2NVTK 4A3KC 4NOIA 4QJVB 4A3EC 2PPBA 3GTQK 5M3MK 3PO3K 3H0GC 3HOVC 4A3FC 3M4OK 2A68A 4OIQA 3HOYK 3GTPC 3GTQC 1TWHC 4A3GK 2NVYC 5C3EK 3HOUC 4YG2A 4C2MK 3GTMC 2E2HK 3GTPK 4KMUA 4LK1A 3GTJK 1TWGK 1Y1WC 2NVQC 3GTKC 3FKIC 2JA7C 4Y52K 4Q4ZA 1R9TC 3K7AC 1Y1VC 2E2JC 1I3QC 4LJZA 2A6HA 4AYBD 4A3FK 2NVTC 2NVYK 2PMZD 4G7ZA 3RZDK 5C4JK 2O5IA 3S15K 4BY7K 4LLGA 4OIRA 3HOZC 5IYCK 3DXJA 5M5YK 5M5WK 2Y0SD 3S1MK 3H3VL 2WAQL 2NVXK 5D4DA 4A3CK 1TWCK 5C44K 1TWAC 5IP7C 3FKIK 2CW0A 4Y7NK 1I50K 4LK0A 4BXXK 4A3BK 4XSZA 3HOXC 4BY1C 3HOYC 2VUMK 4AYBL 2E2IK 2JA6K 2JA8K 3S2HK 3GTKK 3HOWK 5C4JC 3S1NK 3CQZK 3S15C 3S1MC 4BY7C 2E2HC 2E2IC 4G7HA 3PO3C 5IP9C 4BBRC 4A3JC 2B63C 2YU9K 3RZOK 4BBSC 3S1QK 4OIOA 3K7AK 3M3YC 4A3KK 3HKZL 3PO2K 4G7OA 4KN4A 1WCMK 4A3IC 2R7ZK 2JA5C 3S1RC 4BY1K 2BE5A 3GTOC 4C3HK 3I4MC 1SFOK 2JA6C 1TWGC 4A3LK 5IP7K 2R7ZC 3I4NK 5C4XK 4A93K 3S14K 1I6HK 4BBRK 4A3JK 5FJ8K 2B63K 3RZOC 3S16K 5C3EC 4BBSK 1SMYA 5IYDK 3H3VD 2Y0SL 1TWAK 4YFNA 2YU9C 4YFXA 2JA7K 2A6EA 3GTGK 3PO2C 3CQZC 4C3IK 5IYBC 4C3JK 4A3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q K;  1XPP A;  2R93 K;  4X6A K;  4A93 C;  4A3L C;  4JK1 A;  2WB1 D;  1TWC C;  4YFK A;  1I6V A;  1YNJ A;  5C44 C;  4A3D C;  3I4N C;  3GTJ C;  2R92 K;  3S17 C;  4A3I K;  3HOZ K;  3GTO K;  3M3Y K;  1TWH K;  1BDF A;  1WCM C;  4A3G C;  4GZY A;  3HOU K;  1I50 C;  3GTG C;  4BXX C;  2PMZ L;  1I6H C;  4MQ9 A;  5M3F K;  3RZD C;  3S2D C;  4A3M C;  3GTL K;  2O5J A;  5IP9 K;  4MEY A;  3HKZ D;  4Y52 C;  5M5X K;  5IYC C;  1K83 K;  2JA8 C;  3S17 K;  3GTL C;  3WOD A;  3EQL A;  4ZH4 A;  4KN7 A;  4Y7N C;  1Y1W K;  3I4M K;  4XLN A;  3HOX K;  4A3B C;  5TMF A;  1Y1V K;  5FLM C;  4QJV A;  2A69 A;  1HQM A;  2R93 C;  4X6A C;  1YNN A;  3H0G K;  3HOV K;  2NVX C;  3S1R K;  4XSX A;  3S2D K;  2PA8 L;  4Q5S A;  3GTM K;  5FLM K;  1TWF K;  5TMC A;  4QIW D;  4QIW L;  4OIP A;  1ZYR A;  5C4X C;  3S1Q C;  2WAQ D;  4A3E K;  2PA8 D;  5IYB K;  5IYD C;  1R9T K;  2WB1 L;  1TWF C;  3S16 C;  3M4O C;  3S2H C;  4A3C C;  4XLP A;  2NVQ K;  4OIN A;  1IW7 A;  2JA5 K;  3HOW C;  3S1N C;  1K83 C;  2E2J K;  4A3D K;  1SFO C;  4MEX A;  2R92 C;  2VUM C;  3S14 C;  2NVT K;  4A3K C;  4NOI A;  4QJV B;  4A3E C;  2PPB A;  3GTQ K;  5M3M K;  3PO3 K;  3H0G C;  3HOV C;  4A3F C;  3M4O K;  2A68 A;  4OIQ A;  3HOY K;  3GTP C;  3GTQ C;  1TWH C;  4A3G K;  2NVY C;  5C3E K;  3HOU C;  4YG2 A;  4C2M K;  3GTM C;  2E2H K;  3GTP K;  4KMU A;  4LK1 A;  3GTJ K;  1TWG K;  1Y1W C;  2NVQ C;  3GTK C;  3FKI C;  2JA7 C;  4Y52 K;  4Q4Z A;  1R9T C;  3K7A C;  1Y1V C;  2E2J C;  1I3Q C;  4LJZ A;  2A6H A;  4AYB D;  4A3F K;  2NVT C;  2NVY K;  2PMZ D;  4G7Z A;  3RZD K;  5C4J K;  2O5I A;  3S15 K;  4BY7 K;  4LLG A;  4OIR A;  3HOZ C;  5IYC K;  3DXJ A;  5M5Y K;  5M5W K;  2Y0S D;  3S1M K;  3H3V L;  2WAQ L;  2NVX K;  5D4D A;  4A3C K;  1TWC K;  5C44 K;  1TWA C;  5IP7 C;  3FKI K;  2CW0 A;  4Y7N K;  1I50 K;  4LK0 A;  4BXX K;  4A3B K;  4XSZ A;  3HOX C;  4BY1 C;  3HOY C;  2VUM K;  4AYB L;  2E2I K;  2JA6 K;  2JA8 K;  3S2H K;  3GTK K;  3HOW K;  5C4J C;  3S1N K;  3CQZ K;  3S15 C;  3S1M C;  4BY7 C;  2E2H C;  2E2I C;  4G7H A;  3PO3 C;  5IP9 C;  4BBR C;  4A3J C;  2B63 C;  2YU9 K;  3RZO K;  4BBS C;  3S1Q K;  4OIO A;  3K7A K;  3M3Y C;  4A3K K;  3HKZ L;  3PO2 K;  4G7O A;  4KN4 A;  1WCM K;  4A3I C;  2R7Z K;  2JA5 C;  3S1R C;  4BY1 K;  2BE5 A;  3GTO C;  4C3H K;  3I4M C;  1SFO K;  2JA6 C;  1TWG C;  4A3L K;  5IP7 K;  2R7Z C;  3I4N K;  5C4X K;  4A93 K;  3S14 K;  1I6H K;  4BBR K;  4A3J K;  5FJ8 K;  2B63 K;  3RZO C;  3S16 K;  5C3E C;  4BBS K;  1SMY A;  5IYD K;  3H3V D;  2Y0S L;  1TWA K;  4YFN A;  2YU9 C;  4YFX A;  2JA7 K;  2A6E A;  3GTG K;  3PO2 C;  3CQZ C;  4C3I K;  5IYB C;  4C3J K;  4A3M K; 
#chains in the Genus database with same CATH topology
 4A3L C;  2V6S A;  4A3D C;  1BGW A;  4BLA A;  1O26 A;  3A8K A;  4A3G C;  4C3J C;  3HOU K;  3GTG C;  1I6H C;  2PMZ L;  2JA6 A;  4AH6 A;  3S2D C;  4MEY A;  1WOS A;  4Y52 C;  5M5X K;  3S17 K;  1BS2 A;  3AH5 A;  4KAR A;  1Y1W K;  1ZBS A;  4XLN A;  5TMF A;  1F93 A;  4QJV A;  2XCO A;  1YNN A;  4PAB A;  1TWF K;  1DCH A;  4QIW D;  4QIW L;  4OIP A;  1ZYR A;  5C4X C;  4A3E K;  1K83 A;  1F7V A;  1DCP A;  1TWF C;  2NVQ K;  3N0C A;  4XCH A;  2VUM C;  3A8I A;  5JFE A;  3GTO A;  3G4A A;  2PPB A;  2R92 A;  3PO3 K;  3JST A;  2R93 A;  4KB4 A;  3LAP A;  3HOY K;  1ZQ1 C;  4KMH A;  3GTP C;  2NVY C;  1ZVU A;  3GTP K;  1J6V A;  5IOT A;  1TWG K;  2CFA B;  3AQO A;  2B63 A;  2E2J C;  1IQ0 A;  1IBA A;  4LJZ A;  4G7Z A;  2PMZ D;  1GE9 A;  1O27 A;  1AB4 A;  3HOZ C;  2V6U A;  5M5Y K;  3DXJ A;  5M5W K;  2NVX K;  4GFQ A;  4A3C K;  3BP3 A;  4KB2 A;  1JOE A;  1I50 K;  3QX3 A;  1BJT A;  4XSZ A;  2GAG C;  4BY1 C;  3HOY C;  4BKW A;  1TWH A;  3S1N K;  4LR2 A;  2E2I C;  4BBR C;  4A3J C;  1USM A;  1VJE A;  4G0W A;  3S1Q K;  3N0B A;  4KN4 A;  5CJ9 A;  1I3Q A;  3S1R C;  4BY1 K;  2BE5 A;  3GTO C;  4GTC A;  1HI9 A;  1IE0 A;  2JA6 C;  3GTG A;  4A3L K;  3S14 K;  1I6H K;  3RZO C;  1G51 A;  1F7U A;  1V5V A;  3VA7 A;  5IYD K;  1TWG A;  4YFN A;  3GTP A;  4YFX A;  3GTG K;  3PO2 C;  4C3I K;  2JH3 A;  4C3J K;  1I3Q K;  2R93 K;  5E68 A;  1PJ7 A;  4JK1 A;  1YX2 A;  1C0A A;  4YFK A;  1YNJ A;  3OEP A;  3GTJ C;  2R92 K;  3S17 C;  4A3I K;  4ILD A;  2KWA A;  3ADA C;  3AD8 C;  4C45 A;  3M3Y K;  2GAH C;  1TWH K;  3TFJ A;  2JA5 A;  2O5J A;  1ISE A;  3HKZ D;  2JA8 C;  4KDD A;  4ZH4 A;  4Y7N C;  5FLM C;  1PJ5 A;  2R93 C;  4XSX A;  1Y1W A;  2P5M A;  1XZQ B;  5FLM K;  5TMC A;  2WAQ D;  5IYB K;  3S16 C;  1IL2 A;  3S2H C;  4XLP A;  4OIN A;  3HOW C;  1K83 C;  1J6X A;  2E2J K;  3MML B;  4BLB A;  1O2A A;  4MEX A;  1PJ6 A;  3FHZ A;  4A3K C;  2PHC B;  2ZFZ A;  4KM9 A;  4NOI A;  4QJV B;  3H0G C;  1O25 A;  3HOV C;  2A68 A;  4A3G K;  5C3E K;  2JA7 A;  4C3H C;  3HXA A;  4KMU A;  4LK1 A;  1Y1V C;  2XCQ A;  1SFO A;  2NVT C;  4LOW A;  1ZXO A;  2R7Z A;  3S15 K;  4GTB A;  1WCM A;  1EH1 A;  1O24 A;  3H3V L;  2YU9 A;  5D4D A;  5IP7 C;  3FKI K;  2CW0 A;  4Y7N K;  4BXX K;  4LK0 A;  1XZP A;  3AD7 C;  2JA6 K;  3V4G A;  5IOR A;  3GTK K;  3S15 C;  3FOE A;  3FKI A;  5EGH A;  3RZO K;  4LQY A;  1O29 A;  2EBB A;  3S0X A;  3GSI A;  4GTA A;  3M3Y C;  3L4K A;  3PO2 K;  4G7O A;  1UV7 A;  1WCM K;  4A3I C;  4FZB A;  4GTL A;  3T01 A;  3TFI A;  1SMY A;  2Y0S L;  5TJ3 A;  1VRQ C;  1IS1 A;  1DCO A;  3CQZ C;  4X6A K;  1DD5 A;  1TWC C;  1I6V A;  5IOS A;  2V6T A;  3HOZ K;  2GSO A;  2D6F C;  3NUH A;  1XXC A;  1BDF A;  1WCM C;  1INN A;  1WOO A;  3FOF A;  3GTK A;  3ORE A;  4GZY A;  1I50 C;  2CFA A;  2VUM A;  5M3F K;  3RZD C;  5IP9 K;  5IYC C;  1KQ4 A;  3TTG A;  4GTE A;  3WOD A;  1VGX A;  3HOX K;  1X31 C;  3H0G A;  2NVY A;  1HQM A;  1WSV A;  4X6A C;  2PA8 L;  3GTM K;  4M1X A;  3T00 A;  5EGE A;  1J98 A;  2E2H A;  2PA8 D;  2WB1 L;  4A3C C;  2XCR B;  1IW7 A;  2JA5 K;  2ZUF A;  2FQT A;  2GSN A;  1SFO C;  4KMD A;  3GEH A;  1EI6 A;  1WIH A;  3GTQ K;  1YCL A;  5M3M K;  4A3F C;  4OIQ A;  1TWH C;  5JVO A;  3LAJ A;  3HOU C;  1WOR A;  4YG2 A;  4C2M K;  1R9T A;  3GTM C;  3GTJ K;  2NVQ C;  3GTK C;  3FKI C;  2GSU A;  2JA7 C;  4Y52 K;  4Q4Z A;  3K7A C;  1I3Q C;  2Y3P A;  2A6H A;  4AYB D;  4A3F K;  1Y1V A;  4KAS A;  5C4J K;  4BY7 K;  5IYC K;  5CHP A;  3GEI A;  2Y0S D;  2WAQ L;  4KM8 A;  4O2D A;  1TWC K;  1WQF A;  4P5B A;  4DDQ A;  4A3B K;  3GTL A;  1F9N A;  3AD9 C;  3N3Y A;  4AYB L;  1WQH A;  3HOW K;  5C4J C;  4BY7 C;  4C3I C;  3S1M C;  2E2H C;  1TWC A;  3OPF A;  2NVX A;  4OIO A;  3K7A K;  4A3K K;  3HKZ L;  4GTD A;  1WSR A;  4KAW X;  2JA5 C;  4G0U A;  1XXB A;  1RU0 A;  5C4X K;  3I4N K;  2B63 K;  4BBS K;  5FJ8 K;  1TWA A;  3S16 K;  5C3E C;  3H3V D;  1TWA K;  3GIR A;  3LPX A;  1VLO A;  2A6E A;  1EK8 A;  5IYB C;  4A3M K;  1XPP A;  4A93 C;  2WB1 D;  2W7V A;  3L4J A;  3ERE D;  5C44 C;  3GEE A;  3GTQ A;  3I4N C;  4WJ3 M;  2RH6 A;  1USO A;  4GTF A;  3GTO K;  1WOP A;  1XXA A;  4BXX C;  2RGR A;  4MQ9 A;  4A3M C;  3AQP A;  3GTL K;  1O28 A;  1I50 A;  5HL8 A;  1K83 K;  4P9S A;  3T02 A;  5L46 A;  1O2F B;  3GTL C;  1B4A A;  3EQL A;  2ZUE A;  4KN7 A;  3I4M K;  1O2B A;  1VH2 A;  1XZQ A;  4A3B C;  1Y1V K;  1L0W A;  2A69 A;  3H0G K;  3HOV K;  4G0V A;  2NVX C;  3S1R K;  3S2D K;  4Q5S A;  3GDZ A;  3GTJ A;  3S1Q C;  1R9T K;  5IYD C;  4KC6 A;  3M4O C;  3Q3Q A;  3S1N C;  4KAT A;  4A3D K;  3G4C A;  2R92 C;  3S14 C;  1J6W A;  2NVT K;  4C2M C;  4A3E C;  1WQG A;  3M4O K;  4WIL A;  2P8T A;  4P5A A;  3GTQ C;  4FM9 A;  2E2H K;  4WJ4 A;  1Y1W C;  1JVI A;  1TWF A;  4PAA A;  3CAG A;  1R9T C;  3GTM A;  2NVY K;  3RZD K;  2O5I A;  4LLG A;  4OIR A;  3IPJ A;  1XZP B;  3S1M K;  3SZY A;  5C44 K;  4GT9 A;  3SZZ A;  1TWA C;  3TFH A;  3CQZ A;  3HOX C;  2VUM K;  2E2I K;  2E2I A;  2JA8 K;  3S2H K;  4RMF A;  3CQZ K;  1B4B A;  3A8J A;  1EQR A;  3BUE A;  4G7H A;  1JQW A;  3PO3 C;  5IP9 C;  4KMA A;  2B63 C;  4BBS C;  2YU9 K;  2FQO A;  1EFW A;  4J3N A;  2R7Z K;  4C3H K;  3I4M C;  1SFO K;  1TWG C;  4A93 K;  5IP7 K;  2R7Z C;  4BBR K;  4A3J K;  3BP8 C;  2YU9 C;  2JA7 K;  5IOQ A; 
#chains in the Genus database with same CATH homology
 1I3Q K;  1XPP A;  2R93 K;  4X6A K;  4A93 C;  4A3L C;  4JK1 A;  2WB1 D;  1TWC C;  4YFK A;  1I6V A;  1YNJ A;  5C44 C;  4A3D C;  3I4N C;  3GTJ C;  2R92 K;  3S17 C;  4A3I K;  3HOZ K;  3GTO K;  3M3Y K;  1TWH K;  1BDF A;  1WCM C;  4A3G C;  4GZY A;  3HOU K;  1I50 C;  3GTG C;  4BXX C;  2PMZ L;  1I6H C;  4MQ9 A;  5M3F K;  3RZD C;  3S2D C;  4A3M C;  3GTL K;  2O5J A;  5IP9 K;  4MEY A;  3HKZ D;  4Y52 C;  5M5X K;  5IYC C;  1K83 K;  2JA8 C;  3S17 K;  3GTL C;  3WOD A;  3EQL A;  4ZH4 A;  4KN7 A;  4Y7N C;  1Y1W K;  3I4M K;  4XLN A;  3HOX K;  4A3B C;  5TMF A;  1Y1V K;  5FLM C;  4QJV A;  2A69 A;  1HQM A;  2R93 C;  4X6A C;  1YNN A;  3H0G K;  3HOV K;  2NVX C;  3S1R K;  4XSX A;  3S2D K;  2PA8 L;  4Q5S A;  3GTM K;  5FLM K;  1TWF K;  5TMC A;  4QIW D;  4QIW L;  4OIP A;  1ZYR A;  5C4X C;  3S1Q C;  2WAQ D;  4A3E K;  2PA8 D;  5IYB K;  5IYD C;  1R9T K;  2WB1 L;  1TWF C;  3S16 C;  3M4O C;  3S2H C;  4A3C C;  4XLP A;  2NVQ K;  4OIN A;  1IW7 A;  2JA5 K;  3HOW C;  3S1N C;  1K83 C;  2E2J K;  4A3D K;  1SFO C;  4MEX A;  2R92 C;  2VUM C;  3S14 C;  2NVT K;  4A3K C;  4NOI A;  4QJV B;  4A3E C;  2PPB A;  3GTQ K;  5M3M K;  3PO3 K;  3H0G C;  3HOV C;  4A3F C;  3M4O K;  2A68 A;  4OIQ A;  3HOY K;  3GTP C;  3GTQ C;  1TWH C;  4A3G K;  2NVY C;  5C3E K;  3HOU C;  4YG2 A;  4C2M K;  3GTM C;  2E2H K;  3GTP K;  4KMU A;  4LK1 A;  3GTJ K;  1TWG K;  1Y1W C;  2NVQ C;  3GTK C;  3FKI C;  2JA7 C;  4Y52 K;  4Q4Z A;  1R9T C;  3K7A C;  1Y1V C;  2E2J C;  1I3Q C;  4LJZ A;  2A6H A;  4AYB D;  4A3F K;  2NVT C;  2NVY K;  2PMZ D;  4G7Z A;  3RZD K;  5C4J K;  2O5I A;  3S15 K;  4BY7 K;  4LLG A;  4OIR A;  3HOZ C;  5IYC K;  3DXJ A;  5M5Y K;  5M5W K;  2Y0S D;  3S1M K;  3H3V L;  2WAQ L;  2NVX K;  5D4D A;  4A3C K;  1TWC K;  5C44 K;  1TWA C;  5IP7 C;  3FKI K;  2CW0 A;  4Y7N K;  1I50 K;  4LK0 A;  4BXX K;  4A3B K;  4XSZ A;  3HOX C;  4BY1 C;  3HOY C;  2VUM K;  4AYB L;  2E2I K;  2JA6 K;  2JA8 K;  3S2H K;  3GTK K;  3HOW K;  5C4J C;  3S1N K;  3CQZ K;  3S15 C;  3S1M C;  4BY7 C;  2E2H C;  2E2I C;  4G7H A;  3PO3 C;  5IP9 C;  4BBR C;  4A3J C;  2B63 C;  2YU9 K;  3RZO K;  4BBS C;  3S1Q K;  4OIO A;  3K7A K;  3M3Y C;  4A3K K;  3HKZ L;  3PO2 K;  4G7O A;  4KN4 A;  1WCM K;  4A3I C;  2R7Z K;  2JA5 C;  3S1R C;  4BY1 K;  2BE5 A;  3GTO C;  4C3H K;  3I4M C;  1SFO K;  2JA6 C;  1TWG C;  4A3L K;  5IP7 K;  2R7Z C;  3I4N K;  5C4X K;  4A93 K;  3S14 K;  1I6H K;  4BBR K;  4A3J K;  5FJ8 K;  2B63 K;  3RZO C;  3S16 K;  5C3E C;  4BBS K;  1SMY A;  5IYD K;  3H3V D;  2Y0S L;  1TWA K;  4YFN A;  2YU9 C;  4YFX A;  2JA7 K;  2A6E A;  3GTG K;  3PO2 C;  3CQZ C;  4C3I K;  5IYB C;  4C3J K;  4A3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...