5IYBK

Human core-pic in the open state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iybK00
2NVQC 5TMFA 2PPBA 4X6AK 3I4NK 1YNJA 3PO2K 3GTQK 4Q5SA 3HOVK 2O5JA 2PMZD 3GTGK 4XSXA 5D4DA 4A3FC 4BY1C 3S2HK 4BBSC 2R93C 2NVTK 3RZOC 4C3HK 4BXXK 3GTLC 3GTMK 4QJVA 4C3IK 2Y0SL 2E2HC 3HOZK 3S1NK 3HOWK 4BBRC 2A69A 5IYBK 2YU9C 1ZYRA 1TWGK 3WODA 2JA7K 3HOUC 5C4JK 4Y52K 4G7ZA 3I4MC 1TWAC 4KN7A 2O5IA 2VUMC 5IP9K 4XLPA 4OIRA 2Y0SD 3RZDC 3DXJA 2JA5K 3S2DC 2NVXC 5C3EK 3S16K 5IYCK 1TWCC 1Y1VC 1TWHC 4YFXA 4G7HA 4A3KK 4A3GK 3GTJC 4LK0A 1IW7A 4Y7NC 4Q4ZA 4OIPA 3S1RC 2E2JC 4A3BC 2WAQL 3S17K 4A93C 3GTPC 2R7ZK 4XSZA 4A3EK 3HOYK 4ZH4A 1I6HC 4LK1A 4GZYA 4LLGA 4JK1A 2WAQD 1BDFA 1Y1WK 3M4OK 1TWFC 3GTOC 3K7AK 2R92K 4A3CC 1K83C 4YG2A 4A3MK 2JA6C 3CQZK 3GTKK 1R9TK 3S1MK 3S15C 3HOXC 4MEYA 2B63C 1I50K 1WCMK 5M3FK 4MEXA 3S14K 5C44K 4G7OA 2A6EA 4MQ9A 2JA8C 2E2IK 3M3YK 4A3DK 4BY7K 4YFNA 5FLMK 5M5YK 2NVYC 1SFOC 4A3LK 3S1QC 1HQMA 3H0GC 3PO3K 4A3IK 2NVQK 5C4XC 5IP7C 4LJZA 4A3JC 5IYDC 2A6HA 4OIQA 5M5XK 1I3QC 4YFKA 4C3JK 5FJ8K 2R93K 4X6AC 4A3FK 4BY1K 4XLNA 3I4NC 4BBSK 4OINA 3RZOK 3PO2C 3GTQC 3GTLK 3HOVC 3GTGC 4NOIA 3S2HC 5IYDK 2NVTC 2E2HK 4BXXC 4BBRK 2YU9K 3GTMC 3HOUK 3I4MK 1TWAK 3HOZC 3S1NC 3HOWC 2VUMK 3FKIC 5IYBC 1TWGC 4Y52C 2JA7C 5C4JC 1XPPA 3RZDK 3S2DK 2NVXK 5IP9C 1TWCK 4QJVB 1Y1VK 1TWHK 2JA5C 5C3EC 3GTJK 3S16C 4Y7NK 5IYCC 2A68A 3S1RK 3HKZL 4A3KC 2E2JK 4A3BK 4A93K 4A3GC 3GTPK 4KMUA 2WB1L 3S17C 1I6HK 1YNNA 3HKZD 2R7ZC 4A3EC 3HOYC 1TWFK 3GTOK 4C2MK 4A3CK 2WB1D 1K83K 1Y1WC 3FKIK 4OIOA 5TMCA 2JA6K 3M4OC 3H3VL 2CW0A 3S15K 2PA8L 3K7AC 4KN4A 4QIWL 3HOXK 2B63K 2R92C 4A3MC 4AYBL 3CQZC 3EQLA 2JA8K 3GTKC 1R9TC 3S1MC 1I6VA 1I50C 1WCMC 1SMYA 3S14C 2NVYK 5C44C 1SFOK 3H3VD 3S1QK 3H0GK 2E2IC 2PA8D 3M3YC 4QIWD 4BY7C 5C4XK 4A3DC 5M5WK 5IP7K 4AYBD 5M3MK 2PMZL 2BE5A 5FLMC 4A3JK 4A3LC 3PO3C 1I3QK 4A3IC
chains in the Genus database with same CATH superfamily
2CFAB 3ADAC 2PPBA 4X6AK 3I4NK 1JVIA 4KC6A 5D4DA 1TWFA 3GTOA 3GSIA 1HI9A 3A8KA 1O24A 1YCLA 4C3IK 2E2HC 1TWAA 4BBRC 2A69A 5IYBK 3OPFA 5C4JK 2V6SA 4KN7A 3N3YA 2VUMC 5IP9K 3H0GA 3SZYA 1DCHA 3RZDC 4KM8A 3S2DC 2NVXC 4KAWX 4KATA 5IYCK 1O2FB 4YFXA 5HL8A 1F7VA 4A3GK 4OIPA 1XXCA 2WAQL 2V6TA 3GTPC 3HOYK 1Y1WK 3M4OK 1XZQA 1TWFC 1BJTA 3K7AK 3GTOC 1J6XA 3CQZK 4AH6A 3HOXC 3TFJA 3S14K 1XZPA 3SZZA 3M3YK 4KARA 2Y3PA 5FLMK 3GEHA 2D6FC 1SFOC 3S1QC 4RMFA 3H0GC 4KMHA 2KWAA 1J6WA 2XCQA 5IORA 4OIQA 4KB4A 4YFKA 3GEEA 4X6AC 1JQWA 3I4NC 1Y1WA 4G0VA 3GTLK 4LR2A 1WOPA 3T02A 2ZFZA 1EI6A 1X31C 3BP3A 4C3IC 3CAGA 3I4MK 3GIRA 5IYBC 5C4JC 1IBAA 5IP9C 1IE0A 4KMAA 1TWHK 5IYCC 3Q3QA 3HKZL 2E2JK 4A3GC 4WJ3M 1I6HK 2XCRB 3HOYC 1BS2A 4A3CK 1Y1WC 3FKIK 4OIOA 5TMCA 3M4OC 3H3VL 3S15K 3K7AC 4KN4A 4QIWL 3CQZC 4GTBA 1EK8A 1TWHA 4GFQA 3S14C 1O28A 1XZQB 3M3YC 4FZBA 5FLMC 3L4JA 2ZUFA 5IYDK 1I3QK 1WQGA 3N0BA 5TMFA 1VLOA 3PO2K 1L0WA 2O5JA 2PMZD 4GTFA 4XSXA 3S2HK 2P5MA 4BXXK 3TTGA 3GTLC 4QJVA 5E68A 3G4AA 2VUMA 1ZYRA 3WODA 4Y52K 1F7UA 4G7ZA 3I4MC 3HXAA 2Y0SD 2JA5K 5C3EK 1J98A 1I3QA 1TWHC 4A3KK 4GTEA 4GTCA 2E2JC 1C0AA 1EFWA 4A3EK 3ERED 4XCHA 1DD5A 1I6HC 4GZYA 4JK1A 1BDFA 4GT9A 4A3CC 1ZXOA 3N0CA 2JA5A 3S15C 3V4GA 1I50K 5M3FK 5C44K 1SFOA 1WIHA 4BY7K 1J6VA 4YFNA 2RH6A 1HQMA 4A3IK 2NVQK 4LJZA 3LAPA 5IYDC 2A6HA 5M5XK 1I3QC 1VH2A 1O25A 3TFHA 4C3JK 5FJ8K 2R93K 4A3FK 4BY1K 4BBSK 3A8IA 4BLAA 3PO2C 4NOIA 3S2HC 3JSTA 4BXXC 2YU9K 1VGXA 3AH5A 4Y52C 3AD9C 5EGHA 2EBBA 4QJVB 1Y1VK 2JA5C 1B4AA 1O2BA 5C3EC 4Y7NK 3S1RK 3T00A 4A3KC 4A93K 2R93A 1WSVA 1DCPA 1IS1A 1YNNA 4O2DA 1JOEA 1WSRA 5EGEA 4A3EC 2YU9A 3NUHA 4C2MK 2W7VA 1K83K 3CQZA 5IOQA 2JA8K 4WJ4A 1Y1VA 3IPJA 1I6VA 1I50C 5C44C 2PA8D 4BY7C 5C4XK 5M5WK 4A3JK 4ILDA 2PMZL 4A3IC 2NVQC 3AD8C 5JFEA 4Q5SA 4C3JC 3GTLA 3GTGK 2R93C 4A3FC 4BY1C 4BBSC 3GEIA 2NVTK 1K83A 4C3HK 4BKWA 4M1XA 4FM9A 4LQYA 2Y0SL 3HOZK 3HOWK 2YU9C 1TWGK 2JA7K 1DCOA 1AB4A 4P9SA 4XLPA 4OIRA 3BUEA 3S16K 1Y1VC 4G7HA 2GSUA 2RGRA 4PABA 4Y7NC 3S1RC 4J3NA 4A93C 3S17K 3GTGA 1XZPB 3A8JA 4ZH4A 4LK1A 4LLGA 1WOOA 3FOFA 3FKIA 4GTAA 1TWGA 2JA7A 4C2MC 1K83C 4YG2A 4A3MK 3GTKK 3S1MK 3L4KA 1WCMK 2A6EA 2JA8C 2E2IK 5M5YK 4GTDA 4A3LK 3PO3K 5C4XC 4A3JC 1IL2A 3OEPA 5L46A 5IOSA 1O26A 4OINA 3RZOK 3BP8C 5CHPA 1ZBSA 1G51A 3GTGC 5JVOA 2NVTC 2GAGC 4C3HC 3HOUK 3GTKA 4KM9A 4DDQA 1WCMA 1TWAK 3HOZC 3HOWC 3FKIC 1TWGC 1IQ0A 2JA7C 1XPPA 1TWCK 1WQHA 1ZQ1C 3GTJK 3S16C 2A68A 4A3BK 4KMUA 1XXAA 3S17C 4G0WA 1PJ5A 4KB2A 2WB1D 2JA6K 2CW0A 2P8TA 2PA8L 2B63K 1I50A 4A3MC 1TWCA 3EQLA 3GTKC 3S1MC 3GTJA 1USMA 1WCMC 2XCOA 2NVYK 4C45A 2E2IC 5IP7K 4AYBD 5M3MK 3T01A 2GSOA 4A3LC 3PO3C 1WORA 1YNJA 2GAHC 3GTQK 3HOVK 1PJ7A 3RZOC 2PHCB 2JA6A 3GTMK 1XXBA 1WQFA 2B63A 3S1NK 1WOSA 3HOUC 3VA7A 3TFIA 3FHZA 3OREA 1RU0A 1TWAC 2NVYA 2O5IA 1VRQC 3DXJA 1TWCC 1F9NA 3AD7C 3QX3A 3GTJC 1IW7A 4LK0A 4Q4ZA 1YX2A 3GTQA 2FQOA 4A3BC 1GE9A 2R7ZK 1EQRA 4XSZA 3GTMA 1BGWA 4KASA 4WILA 2WAQD 2FQTA 4KMDA 2R92K 4BLBA 1INNA 2JA6C 3AQPA 4P5AA 2GSNA 1R9TK 3AQOA 2CFAA 4MEYA 2B63C 4G7OA 2JH3A 4MEXA 4A3DK 4MQ9A 1O29A 2NVYC 3G4CA 4LOWA 5TJ3A 5IP7C 1VJEA 2R7ZA 1KQ4A 1V5VA 4XLNA 4GTLA 1ZVUA 3GTQC 3HOVC 1ISEA 4KDDA 3LAJA 3S0XA 3FOEA 2R92A 2E2HK 4BBRK 3GTMC 1R9TA 3S1NC 2VUMK 1B4BA 2V6UA 4PAAA 3RZDK 3S2DK 2NVXK 3LPXA 1O27A 3MMLB 1PJ6A 1EH1A 3GTPK 2ZUEA 5IOTA 2WB1L 2E2HA 3HKZD 2R7ZC 1USOA 1O2AA 1TWFK 3GTOK 4P5BA 3GDZA 3HOXK 2R92C 2NVXA 1F93A 4AYBL 4G0UA 2E2IA 1R9TC 1SMYA 1SFOK 3S1QK 1UV7A 3H3VD 5CJ9A 3H0GK 4A3DC 4QIWD 3GTPA 2BE5A
chains in the Genus database with same CATH topology
2NVQC 5TMFA 2PPBA 4X6AK 3I4NK 1YNJA 3PO2K 3GTQK 4Q5SA 3HOVK 2O5JA 2PMZD 3GTGK 4XSXA 5D4DA 4A3FC 4BY1C 3S2HK 4BBSC 2R93C 2NVTK 3RZOC 4C3HK 4BXXK 3GTLC 3GTMK 4QJVA 4C3IK 2Y0SL 2E2HC 3HOZK 3S1NK 3HOWK 4BBRC 2A69A 5IYBK 2YU9C 1ZYRA 1TWGK 3WODA 2JA7K 3HOUC 5C4JK 4Y52K 4G7ZA 3I4MC 1TWAC 4KN7A 2O5IA 2VUMC 5IP9K 4XLPA 4OIRA 2Y0SD 3RZDC 3DXJA 2JA5K 3S2DC 2NVXC 5C3EK 3S16K 5IYCK 1TWCC 1Y1VC 1TWHC 4YFXA 4G7HA 4A3KK 4A3GK 3GTJC 4LK0A 1IW7A 4Y7NC 4Q4ZA 4OIPA 3S1RC 2E2JC 4A3BC 2WAQL 3S17K 4A93C 3GTPC 2R7ZK 4XSZA 4A3EK 3HOYK 4ZH4A 1I6HC 4LK1A 4GZYA 4LLGA 4JK1A 2WAQD 1BDFA 1Y1WK 3M4OK 1TWFC 3GTOC 3K7AK 2R92K 4A3CC 1K83C 4YG2A 4A3MK 2JA6C 3CQZK 3GTKK 1R9TK 3S1MK 3S15C 3HOXC 4MEYA 2B63C 1I50K 1WCMK 5M3FK 4MEXA 3S14K 5C44K 4G7OA 2A6EA 4MQ9A 2JA8C 2E2IK 3M3YK 4A3DK 4BY7K 4YFNA 5FLMK 5M5YK 2NVYC 1SFOC 4A3LK 3S1QC 1HQMA 3H0GC 3PO3K 4A3IK 2NVQK 5C4XC 5IP7C 4LJZA 4A3JC 5IYDC 2A6HA 4OIQA 5M5XK 1I3QC 4YFKA 4C3JK 5FJ8K 2R93K 4X6AC 4A3FK 4BY1K 4XLNA 3I4NC 4BBSK 4OINA 3RZOK 3PO2C 3GTQC 3GTLK 3HOVC 3GTGC 4NOIA 3S2HC 5IYDK 2NVTC 2E2HK 4BXXC 4BBRK 2YU9K 3GTMC 3HOUK 3I4MK 1TWAK 3HOZC 3S1NC 3HOWC 2VUMK 3FKIC 5IYBC 1TWGC 4Y52C 2JA7C 5C4JC 1XPPA 3RZDK 3S2DK 2NVXK 5IP9C 1TWCK 4QJVB 1Y1VK 1TWHK 2JA5C 5C3EC 3GTJK 3S16C 4Y7NK 5IYCC 2A68A 3S1RK 3HKZL 4A3KC 2E2JK 4A3BK 4A93K 4A3GC 3GTPK 4KMUA 2WB1L 3S17C 1I6HK 1YNNA 3HKZD 2R7ZC 4A3EC 3HOYC 1TWFK 3GTOK 4C2MK 4A3CK 2WB1D 1K83K 1Y1WC 3FKIK 4OIOA 5TMCA 2JA6K 3M4OC 3H3VL 2CW0A 3S15K 2PA8L 3K7AC 4KN4A 4QIWL 3HOXK 2B63K 2R92C 4A3MC 4AYBL 3CQZC 3EQLA 2JA8K 3GTKC 1R9TC 3S1MC 1I6VA 1I50C 1WCMC 1SMYA 3S14C 2NVYK 5C44C 1SFOK 3H3VD 3S1QK 3H0GK 2E2IC 2PA8D 3M3YC 4QIWD 4BY7C 5C4XK 4A3DC 5M5WK 5IP7K 4AYBD 5M3MK 2PMZL 2BE5A 5FLMC 4A3JK 4A3LC 3PO3C 1I3QK 4A3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ C;  5TMF A;  2PPB A;  4X6A K;  3I4N K;  1YNJ A;  3PO2 K;  3GTQ K;  4Q5S A;  3HOV K;  2O5J A;  2PMZ D;  3GTG K;  4XSX A;  5D4D A;  4A3F C;  4BY1 C;  3S2H K;  4BBS C;  2R93 C;  2NVT K;  3RZO C;  4C3H K;  4BXX K;  3GTL C;  3GTM K;  4QJV A;  4C3I K;  2Y0S L;  2E2H C;  3HOZ K;  3S1N K;  3HOW K;  4BBR C;  2A69 A;  5IYB K;  2YU9 C;  1ZYR A;  1TWG K;  3WOD A;  2JA7 K;  3HOU C;  5C4J K;  4Y52 K;  4G7Z A;  3I4M C;  1TWA C;  4KN7 A;  2O5I A;  2VUM C;  5IP9 K;  4XLP A;  4OIR A;  2Y0S D;  3RZD C;  3DXJ A;  2JA5 K;  3S2D C;  2NVX C;  5C3E K;  3S16 K;  5IYC K;  1TWC C;  1Y1V C;  1TWH C;  4YFX A;  4G7H A;  4A3K K;  4A3G K;  3GTJ C;  4LK0 A;  1IW7 A;  4Y7N C;  4Q4Z A;  4OIP A;  3S1R C;  2E2J C;  4A3B C;  2WAQ L;  3S17 K;  4A93 C;  3GTP C;  2R7Z K;  4XSZ A;  4A3E K;  3HOY K;  4ZH4 A;  1I6H C;  4LK1 A;  4GZY A;  4LLG A;  4JK1 A;  2WAQ D;  1BDF A;  1Y1W K;  3M4O K;  1TWF C;  3GTO C;  3K7A K;  2R92 K;  4A3C C;  1K83 C;  4YG2 A;  4A3M K;  2JA6 C;  3CQZ K;  3GTK K;  1R9T K;  3S1M K;  3S15 C;  3HOX C;  4MEY A;  2B63 C;  1I50 K;  1WCM K;  5M3F K;  4MEX A;  3S14 K;  5C44 K;  4G7O A;  2A6E A;  4MQ9 A;  2JA8 C;  2E2I K;  3M3Y K;  4A3D K;  4BY7 K;  4YFN A;  5FLM K;  5M5Y K;  2NVY C;  1SFO C;  4A3L K;  3S1Q C;  1HQM A;  3H0G C;  3PO3 K;  4A3I K;  2NVQ K;  5C4X C;  5IP7 C;  4LJZ A;  4A3J C;  5IYD C;  2A6H A;  4OIQ A;  5M5X K;  1I3Q C;  4YFK A;  4C3J K;  5FJ8 K;  2R93 K;  4X6A C;  4A3F K;  4BY1 K;  4XLN A;  3I4N C;  4BBS K;  4OIN A;  3RZO K;  3PO2 C;  3GTQ C;  3GTL K;  3HOV C;  3GTG C;  4NOI A;  3S2H C;  5IYD K;  2NVT C;  2E2H K;  4BXX C;  4BBR K;  2YU9 K;  3GTM C;  3HOU K;  3I4M K;  1TWA K;  3HOZ C;  3S1N C;  3HOW C;  2VUM K;  3FKI C;  5IYB C;  1TWG C;  4Y52 C;  2JA7 C;  5C4J C;  1XPP A;  3RZD K;  3S2D K;  2NVX K;  5IP9 C;  1TWC K;  4QJV B;  1Y1V K;  1TWH K;  2JA5 C;  5C3E C;  3GTJ K;  3S16 C;  4Y7N K;  5IYC C;  2A68 A;  3S1R K;  3HKZ L;  4A3K C;  2E2J K;  4A3B K;  4A93 K;  4A3G C;  3GTP K;  4KMU A;  2WB1 L;  3S17 C;  1I6H K;  1YNN A;  3HKZ D;  2R7Z C;  4A3E C;  3HOY C;  1TWF K;  3GTO K;  4C2M K;  4A3C K;  2WB1 D;  1K83 K;  1Y1W C;  3FKI K;  4OIO A;  5TMC A;  2JA6 K;  3M4O C;  3H3V L;  2CW0 A;  3S15 K;  2PA8 L;  3K7A C;  4KN4 A;  4QIW L;  3HOX K;  2B63 K;  2R92 C;  4A3M C;  4AYB L;  3CQZ C;  3EQL A;  2JA8 K;  3GTK C;  1R9T C;  3S1M C;  1I6V A;  1I50 C;  1WCM C;  1SMY A;  3S14 C;  2NVY K;  5C44 C;  1SFO K;  3H3V D;  3S1Q K;  3H0G K;  2E2I C;  2PA8 D;  3M3Y C;  4QIW D;  4BY7 C;  5C4X K;  4A3D C;  5M5W K;  5IP7 K;  4AYB D;  5M3M K;  2PMZ L;  2BE5 A;  5FLM C;  4A3J K;  4A3L C;  3PO3 C;  1I3Q K;  4A3I C; 
#chains in the Genus database with same CATH topology
 2CFA B;  3ADA C;  2PPB A;  4X6A K;  3I4N K;  1JVI A;  4KC6 A;  5D4D A;  1TWF A;  3GTO A;  3GSI A;  1HI9 A;  3A8K A;  1O24 A;  1YCL A;  4C3I K;  2E2H C;  1TWA A;  4BBR C;  2A69 A;  5IYB K;  3OPF A;  5C4J K;  2V6S A;  4KN7 A;  3N3Y A;  2VUM C;  5IP9 K;  3H0G A;  3SZY A;  1DCH A;  3RZD C;  4KM8 A;  3S2D C;  2NVX C;  4KAW X;  4KAT A;  5IYC K;  1O2F B;  4YFX A;  5HL8 A;  1F7V A;  4A3G K;  4OIP A;  1XXC A;  2WAQ L;  2V6T A;  3GTP C;  3HOY K;  1Y1W K;  3M4O K;  1XZQ A;  1TWF C;  1BJT A;  3K7A K;  3GTO C;  1J6X A;  3CQZ K;  4AH6 A;  3HOX C;  3TFJ A;  3S14 K;  1XZP A;  3SZZ A;  3M3Y K;  4KAR A;  2Y3P A;  5FLM K;  3GEH A;  2D6F C;  1SFO C;  3S1Q C;  4RMF A;  3H0G C;  4KMH A;  2KWA A;  1J6W A;  2XCQ A;  5IOR A;  4OIQ A;  4KB4 A;  4YFK A;  3GEE A;  4X6A C;  1JQW A;  3I4N C;  1Y1W A;  4G0V A;  3GTL K;  4LR2 A;  1WOP A;  3T02 A;  2ZFZ A;  1EI6 A;  1X31 C;  3BP3 A;  4C3I C;  3CAG A;  3I4M K;  3GIR A;  5IYB C;  5C4J C;  1IBA A;  5IP9 C;  1IE0 A;  4KMA A;  1TWH K;  5IYC C;  3Q3Q A;  3HKZ L;  2E2J K;  4A3G C;  4WJ3 M;  1I6H K;  2XCR B;  3HOY C;  1BS2 A;  4A3C K;  1Y1W C;  3FKI K;  4OIO A;  5TMC A;  3M4O C;  3H3V L;  3S15 K;  3K7A C;  4KN4 A;  4QIW L;  3CQZ C;  4GTB A;  1EK8 A;  1TWH A;  4GFQ A;  3S14 C;  1O28 A;  1XZQ B;  3M3Y C;  4FZB A;  5FLM C;  3L4J A;  2ZUF A;  5IYD K;  1I3Q K;  1WQG A;  3N0B A;  5TMF A;  1VLO A;  3PO2 K;  1L0W A;  2O5J A;  2PMZ D;  4GTF A;  4XSX A;  3S2H K;  2P5M A;  4BXX K;  3TTG A;  3GTL C;  4QJV A;  5E68 A;  3G4A A;  2VUM A;  1ZYR A;  3WOD A;  4Y52 K;  1F7U A;  4G7Z A;  3I4M C;  3HXA A;  2Y0S D;  2JA5 K;  5C3E K;  1J98 A;  1I3Q A;  1TWH C;  4A3K K;  4GTE A;  4GTC A;  2E2J C;  1C0A A;  1EFW A;  4A3E K;  3ERE D;  4XCH A;  1DD5 A;  1I6H C;  4GZY A;  4JK1 A;  1BDF A;  4GT9 A;  4A3C C;  1ZXO A;  3N0C A;  2JA5 A;  3S15 C;  3V4G A;  1I50 K;  5M3F K;  5C44 K;  1SFO A;  1WIH A;  4BY7 K;  1J6V A;  4YFN A;  2RH6 A;  1HQM A;  4A3I K;  2NVQ K;  4LJZ A;  3LAP A;  5IYD C;  2A6H A;  5M5X K;  1I3Q C;  1VH2 A;  1O25 A;  3TFH A;  4C3J K;  5FJ8 K;  2R93 K;  4A3F K;  4BY1 K;  4BBS K;  3A8I A;  4BLA A;  3PO2 C;  4NOI A;  3S2H C;  3JST A;  4BXX C;  2YU9 K;  1VGX A;  3AH5 A;  4Y52 C;  3AD9 C;  5EGH A;  2EBB A;  4QJV B;  1Y1V K;  2JA5 C;  1B4A A;  1O2B A;  5C3E C;  4Y7N K;  3S1R K;  3T00 A;  4A3K C;  4A93 K;  2R93 A;  1WSV A;  1DCP A;  1IS1 A;  1YNN A;  4O2D A;  1JOE A;  1WSR A;  5EGE A;  4A3E C;  2YU9 A;  3NUH A;  4C2M K;  2W7V A;  1K83 K;  3CQZ A;  5IOQ A;  2JA8 K;  4WJ4 A;  1Y1V A;  3IPJ A;  1I6V A;  1I50 C;  5C44 C;  2PA8 D;  4BY7 C;  5C4X K;  5M5W K;  4A3J K;  4ILD A;  2PMZ L;  4A3I C;  2NVQ C;  3AD8 C;  5JFE A;  4Q5S A;  4C3J C;  3GTL A;  3GTG K;  2R93 C;  4A3F C;  4BY1 C;  4BBS C;  3GEI A;  2NVT K;  1K83 A;  4C3H K;  4BKW A;  4M1X A;  4FM9 A;  4LQY A;  2Y0S L;  3HOZ K;  3HOW K;  2YU9 C;  1TWG K;  2JA7 K;  1DCO A;  1AB4 A;  4P9S A;  4XLP A;  4OIR A;  3BUE A;  3S16 K;  1Y1V C;  4G7H A;  2GSU A;  2RGR A;  4PAB A;  4Y7N C;  3S1R C;  4J3N A;  4A93 C;  3S17 K;  3GTG A;  1XZP B;  3A8J A;  4ZH4 A;  4LK1 A;  4LLG A;  1WOO A;  3FOF A;  3FKI A;  4GTA A;  1TWG A;  2JA7 A;  4C2M C;  1K83 C;  4YG2 A;  4A3M K;  3GTK K;  3S1M K;  3L4K A;  1WCM K;  2A6E A;  2JA8 C;  2E2I K;  5M5Y K;  4GTD A;  4A3L K;  3PO3 K;  5C4X C;  4A3J C;  1IL2 A;  3OEP A;  5L46 A;  5IOS A;  1O26 A;  4OIN A;  3RZO K;  3BP8 C;  5CHP A;  1ZBS A;  1G51 A;  3GTG C;  5JVO A;  2NVT C;  2GAG C;  4C3H C;  3HOU K;  3GTK A;  4KM9 A;  4DDQ A;  1WCM A;  1TWA K;  3HOZ C;  3HOW C;  3FKI C;  1TWG C;  1IQ0 A;  2JA7 C;  1XPP A;  1TWC K;  1WQH A;  1ZQ1 C;  3GTJ K;  3S16 C;  2A68 A;  4A3B K;  4KMU A;  1XXA A;  3S17 C;  4G0W A;  1PJ5 A;  4KB2 A;  2WB1 D;  2JA6 K;  2CW0 A;  2P8T A;  2PA8 L;  2B63 K;  1I50 A;  4A3M C;  1TWC A;  3EQL A;  3GTK C;  3S1M C;  3GTJ A;  1USM A;  1WCM C;  2XCO A;  2NVY K;  4C45 A;  2E2I C;  5IP7 K;  4AYB D;  5M3M K;  3T01 A;  2GSO A;  4A3L C;  3PO3 C;  1WOR A;  1YNJ A;  2GAH C;  3GTQ K;  3HOV K;  1PJ7 A;  3RZO C;  2PHC B;  2JA6 A;  3GTM K;  1XXB A;  1WQF A;  2B63 A;  3S1N K;  1WOS A;  3HOU C;  3VA7 A;  3TFI A;  3FHZ A;  3ORE A;  1RU0 A;  1TWA C;  2NVY A;  2O5I A;  1VRQ C;  3DXJ A;  1TWC C;  1F9N A;  3AD7 C;  3QX3 A;  3GTJ C;  1IW7 A;  4LK0 A;  4Q4Z A;  1YX2 A;  3GTQ A;  2FQO A;  4A3B C;  1GE9 A;  2R7Z K;  1EQR A;  4XSZ A;  3GTM A;  1BGW A;  4KAS A;  4WIL A;  2WAQ D;  2FQT A;  4KMD A;  2R92 K;  4BLB A;  1INN A;  2JA6 C;  3AQP A;  4P5A A;  2GSN A;  1R9T K;  3AQO A;  2CFA A;  4MEY A;  2B63 C;  4G7O A;  2JH3 A;  4MEX A;  4A3D K;  4MQ9 A;  1O29 A;  2NVY C;  3G4C A;  4LOW A;  5TJ3 A;  5IP7 C;  1VJE A;  2R7Z A;  1KQ4 A;  1V5V A;  4XLN A;  4GTL A;  1ZVU A;  3GTQ C;  3HOV C;  1ISE A;  4KDD A;  3LAJ A;  3S0X A;  3FOE A;  2R92 A;  2E2H K;  4BBR K;  3GTM C;  1R9T A;  3S1N C;  2VUM K;  1B4B A;  2V6U A;  4PAA A;  3RZD K;  3S2D K;  2NVX K;  3LPX A;  1O27 A;  3MML B;  1PJ6 A;  1EH1 A;  3GTP K;  2ZUE A;  5IOT A;  2WB1 L;  2E2H A;  3HKZ D;  2R7Z C;  1USO A;  1O2A A;  1TWF K;  3GTO K;  4P5B A;  3GDZ A;  3HOX K;  2R92 C;  2NVX A;  1F93 A;  4AYB L;  4G0U A;  2E2I A;  1R9T C;  1SMY A;  1SFO K;  3S1Q K;  1UV7 A;  3H3V D;  5CJ9 A;  3H0G K;  4A3D C;  4QIW D;  3GTP A;  2BE5 A; 
#chains in the Genus database with same CATH homology
 2NVQ C;  5TMF A;  2PPB A;  4X6A K;  3I4N K;  1YNJ A;  3PO2 K;  3GTQ K;  4Q5S A;  3HOV K;  2O5J A;  2PMZ D;  3GTG K;  4XSX A;  5D4D A;  4A3F C;  4BY1 C;  3S2H K;  4BBS C;  2R93 C;  2NVT K;  3RZO C;  4C3H K;  4BXX K;  3GTL C;  3GTM K;  4QJV A;  4C3I K;  2Y0S L;  2E2H C;  3HOZ K;  3S1N K;  3HOW K;  4BBR C;  2A69 A;  5IYB K;  2YU9 C;  1ZYR A;  1TWG K;  3WOD A;  2JA7 K;  3HOU C;  5C4J K;  4Y52 K;  4G7Z A;  3I4M C;  1TWA C;  4KN7 A;  2O5I A;  2VUM C;  5IP9 K;  4XLP A;  4OIR A;  2Y0S D;  3RZD C;  3DXJ A;  2JA5 K;  3S2D C;  2NVX C;  5C3E K;  3S16 K;  5IYC K;  1TWC C;  1Y1V C;  1TWH C;  4YFX A;  4G7H A;  4A3K K;  4A3G K;  3GTJ C;  4LK0 A;  1IW7 A;  4Y7N C;  4Q4Z A;  4OIP A;  3S1R C;  2E2J C;  4A3B C;  2WAQ L;  3S17 K;  4A93 C;  3GTP C;  2R7Z K;  4XSZ A;  4A3E K;  3HOY K;  4ZH4 A;  1I6H C;  4LK1 A;  4GZY A;  4LLG A;  4JK1 A;  2WAQ D;  1BDF A;  1Y1W K;  3M4O K;  1TWF C;  3GTO C;  3K7A K;  2R92 K;  4A3C C;  1K83 C;  4YG2 A;  4A3M K;  2JA6 C;  3CQZ K;  3GTK K;  1R9T K;  3S1M K;  3S15 C;  3HOX C;  4MEY A;  2B63 C;  1I50 K;  1WCM K;  5M3F K;  4MEX A;  3S14 K;  5C44 K;  4G7O A;  2A6E A;  4MQ9 A;  2JA8 C;  2E2I K;  3M3Y K;  4A3D K;  4BY7 K;  4YFN A;  5FLM K;  5M5Y K;  2NVY C;  1SFO C;  4A3L K;  3S1Q C;  1HQM A;  3H0G C;  3PO3 K;  4A3I K;  2NVQ K;  5C4X C;  5IP7 C;  4LJZ A;  4A3J C;  5IYD C;  2A6H A;  4OIQ A;  5M5X K;  1I3Q C;  4YFK A;  4C3J K;  5FJ8 K;  2R93 K;  4X6A C;  4A3F K;  4BY1 K;  4XLN A;  3I4N C;  4BBS K;  4OIN A;  3RZO K;  3PO2 C;  3GTQ C;  3GTL K;  3HOV C;  3GTG C;  4NOI A;  3S2H C;  5IYD K;  2NVT C;  2E2H K;  4BXX C;  4BBR K;  2YU9 K;  3GTM C;  3HOU K;  3I4M K;  1TWA K;  3HOZ C;  3S1N C;  3HOW C;  2VUM K;  3FKI C;  5IYB C;  1TWG C;  4Y52 C;  2JA7 C;  5C4J C;  1XPP A;  3RZD K;  3S2D K;  2NVX K;  5IP9 C;  1TWC K;  4QJV B;  1Y1V K;  1TWH K;  2JA5 C;  5C3E C;  3GTJ K;  3S16 C;  4Y7N K;  5IYC C;  2A68 A;  3S1R K;  3HKZ L;  4A3K C;  2E2J K;  4A3B K;  4A93 K;  4A3G C;  3GTP K;  4KMU A;  2WB1 L;  3S17 C;  1I6H K;  1YNN A;  3HKZ D;  2R7Z C;  4A3E C;  3HOY C;  1TWF K;  3GTO K;  4C2M K;  4A3C K;  2WB1 D;  1K83 K;  1Y1W C;  3FKI K;  4OIO A;  5TMC A;  2JA6 K;  3M4O C;  3H3V L;  2CW0 A;  3S15 K;  2PA8 L;  3K7A C;  4KN4 A;  4QIW L;  3HOX K;  2B63 K;  2R92 C;  4A3M C;  4AYB L;  3CQZ C;  3EQL A;  2JA8 K;  3GTK C;  1R9T C;  3S1M C;  1I6V A;  1I50 C;  1WCM C;  1SMY A;  3S14 C;  2NVY K;  5C44 C;  1SFO K;  3H3V D;  3S1Q K;  3H0G K;  2E2I C;  2PA8 D;  3M3Y C;  4QIW D;  4BY7 C;  5C4X K;  4A3D C;  5M5W K;  5IP7 K;  4AYB D;  5M3M K;  2PMZ L;  2BE5 A;  5FLM C;  4A3J K;  4A3L C;  3PO3 C;  1I3Q K;  4A3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...