1F9NA

Crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
KGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords ARGININE REPRESSOR/ACTIVATOR PROTEIN
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f9nA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1f9nA02
4PGGA 3RKYA 3KE2A 3J81K 2K4JA 5FFXA 5JVOA 1W5SA 2G9WA 2VOOA 1X3UA 2VBZA 2QUFA 2EFPA 5D5UB 2XVCA 2HEOA 2P7CB 2HWVA 4BHBA 5AIPA 2HS5A 2HZTA 3S2WA 1P4AA 1YIOA 1SMYF 3HRMA 3DKWA 2EA4A 1S29A 1GE9A 5K1YA 4CGZA 1TNSA 1FPQA 2W85A 4IF4A 5JHUA 2IT0A 2QQBA 5DYMA 4P9UA 3W6KB 2FNPA 2RN7A 1RIOH 2FA5A 5DCMA 3F8MA 4Y17A 1IN8A 1J2XA 1U5TC 3WGIA 4BH9A 2Z9OA 4G8XA 3P7NA 4UVBA 2GWRA 2WC2A 1OYYA 2W24A 2D45A 2VN2A 1XGOA 3EYIA 3EQLF 2WTEA 2XKOA 4HX4A 2M5WA 4AIJA 4HLYA 4LLNA 1G3SA 3LQQA 4N9HA 4HQEA 2NYXA 5E18F 1ZLJA 5KVRA 5CVUA 1FBSA 1ZG5A 3V8KA 1I1SA 4UVCA 2EA2A 2RQPA 3TO7A 2V1DA 5FLXZ 3DFGA 3QP6A 2NAZA 1SD6A 1EH7A 1HKQA 3E6CC 4KIBA 3F8FA 2ZNZA 5HS8A 2DAOA 3WE3A 2VXZA 3K1PA 1MZBA 4GO1A 5FD5A 1R5HA 4L0YB 4Y15A 1PP8F 4U0VA 1B6AA 2E7XA 3SFZA 2DU9A 3KZZA 2YSRA 2GXGA 2Z3YA 1MJAA 2O0YA 2XRNA 3IL2A 5DV5A 2O61A 1KU2A 2WV0A 2QZ8A 4RGSA 4CO8A 4UXNA 1CF7A 4EMSA 4HLXA 2P6SA 1J59A 3I0TA 1TLHB 2JT1A 1ZAOA 4ON0A 4YFNF 2K02A 5ILVA 3Q5FA 3ZMTA 1ZRDA 3RI4A 3KZYA 3W6JB 4MHGA 1SFXA 1ZGAA 3L7WA 4R1HA 4EJVA 1S7OA 3SZTA 4RAYA 2JZYA 1SAXA 3H3ZA 5D5WB 3KETA 5BPDA 4HV5A 1O7FA 2RGRA 3HRSA 4KDPA 3ZPLA 1SD5A 1D3YA 1K78A 4XBFA 1R7JA 1MJ9A 3RPQA 1R1UA 2LF7A 2CGPA 1HKSA 3F8BA 4G6QA 1FBUA 1OMIA 1RUOA 1B9MA 1R58A 3BP8A 5HDNA 4LJZF 3JTGA 1R5GA 1EK8A 1LVAA 2VOPA 1YLFA 1FP1D 3FM3A 4UV8A 4G94A 2KKOA 3I59B 2ZXJA 4L9TA 2E7WA 3WGGA 4DNCA 5L3DA 4EVIA 4MQ9F 3RTRA 3ZMUA 3IC7A 2VT2A 2HR3A 3V7RA 5F1RA 5D5VB 1WQHA 1O3QA 1YW9A 1WKMA 5LGTA 1YFHA 3GFMA 3QP5A 3TDZC 2PHCB 1JHFA 1H0MA 1YW8A 3WG9A 1STZA 1IXCA 3TOAA 4BNCA 1BIBA 1BGWA 1XGMA 1HW2A 2Z99A 3KEOA 4KIFA 1W4MA 5E8GA 1R36A 4GFQA 1SD7A 2ZJ2A 4S05A 1G3YA 1K6OA 1FY7A 3F8CA 4HBLA 2FMYA 4Q5SF 4DDQA 4BHPA 3VB2A 3SZPA 2PN6A 4LK0F 2P4WA 2FQ3A 1BC8C 3LA2A 4YFKF 4LB6B 1OR7A 2J5PA 1T2KA 1LQ1A 4ZYGA 3P9IA 2DFIA 4I2OA 3BUEA 4WWCA 1U6GA 3MZHA 1TQPA 5LHHA 1L3LA 4OIPF 2ZMEB 3H92A 3TO9A 3LAPA 1H9GA 4KMUX 1KYWA 2L02A 2P5KA 1XXBA 4P55A 3M9AA 3NRVA 1NHAA 3ZQ7A 4LFUA 1Q1HA 2A07F 2QBYA 2F2EA 1R00A 4EJWA 2HYFA 4M74A 3VEPA 2EWNA 3ZMVA 3NQOA 2VBXA 1FOKA 4EM2A 1IF1A 1IAWA 3WU0A 4BHCA 5TJJA 1ODDA 2X4HA 2IA0A 1Z7UA 1YG2A 4HV6A 4G9YA 1I5ZA 3GYHX 1FYMA 4H0EA 1TQMA 3KP4A 5D6EA 1MJBA 1WQ2A 1YW7A 4HX7A 2MLKA 2L3DA 1P4WA 2GQQA 5EEHA 4KN4X 3G73A 1U78A 5H6QA 1RUNA 3HIFA 1ZGJA 1Z6TA 1YS6A 4R8HA 3CAGA 2M45A 4IRGA 4M71A 1WIHA 3PQJA 4MEXF 4GXOA 5BQTA 3FMQA 2D1HA 2CG4A 5EEGA 1QPMA 2M87A 2UWMA 2ZFZA 3J80K 1R22A 3KP2A 4GYIA 2IA1A 3ZMZA 2ZO4A 4MNUA 4KMFA 4HA8A 2R7FA 2IPQX 3TQNA 1AB4A 1QQIA 1EH6A 5FO5A 1ZRFA 1P4XA 3JSOA 5ICFA 4A6DA 4I98B 3ROUA 4G7ZF 4YFXF 3FOFA 5CVVA 1FSEA 2Y48A 1BOAA 5IT9K 1KQ8A 2OD5A 2DQRA 5ICEA 4I09A 3R4KA 3O6BB 2QM3A 4XLNF 3KP7A 3DXJF 1REPC 4N9IA 2MC3A 1DDNA 2MLGA 1IS1A 2Z5UA 2HTSA 3IWFA 3GZ5A 1IXSB 1KU9A 2LSOA 1KU3A 2QLZA 3GFIA 5E1ZB 1YYVA 1Z91A 4FX0A 4AD9A 3HRUA 1XXAA 1QO0D 2OU2A 1DD5A 1A04A 4ZH4F 3M8EA 4EJTA 1YTYA 1BBYA 3FWEA 3RYRA 3HTSB 1MD0A 1WQFA 3RKWA 2OZ6A 1XMAA 4ESJA 3NEUA 1BN5A 4WXHA 5DDGA 2ZNYA 2MH2A 2A68F 1Z9CA 2NS0A 1B59A 3I4PA 2ETHA 2ESNA 3O2PE 2CSOA 4HQMA 4A6EA 4I01A 2PMUA 1G4DA 3CO7C 3M7GA 2L4AA 2HTJA 4P96A 2J5OA 4M6XA 1UHWA 2DPDA 1XB4A 2GA1A 3ZN0A 3FXQA 2EFWA 2FMLA 5ED4A 3J7AO 4HYEA 3RKXA 1ISEA 3RPUA 4RGUA 4L5JA 3JAMK 4FT8A 3BY6A 4CHUA 2QQ9A 1GHCA 3ABUA 2DLLA 1IZ1A 3FF5A 5E1WA 2WWYA 2H09A 3MQ0A 2XV4S 1USSA 4NQWA 3KLOA 4HX8A 3TO6A 4M9XA 3TOBA 1BI3A 3ELKA 5D4RA 3HRTA 1IUYA 1IN6A 2KRFA 4YIFA 2A3SA 5LGNA 3F8NA 5HLIA 1HSTA 4ENJA 4ZYHA 4A5NA 2XIGA 5JFRA 3MCZA 2BE5F 3QPTA 4O6JA 3R0JA 4QLCU 3MZYA 1JXSA 1FNNA 4R79A 1D8KA 1ULYA 5L3EA 1XD7A 3IKTA 1BM9A 3HHHA 5HS9A 2O3FA 1S7AA 3E6MA 1B9NA 1W7PA 1WSUA 4G7OF 1W5TA 3JW4A 4U7DA 5IT3A 1KYZA 2ISYA 2G7UA 4G0VA 1OPCA 1YS7A 2DT5A 1LDJA 3OV8A 4LB5A 1FT9A 3C18A 1O57A 3BOQA 1PUEE 3D5LA 3U1DA 2ISZA 4M6YA 4BQAA 1T38A 1WWXA 3ECHA 4UV9A 1ZVUA 5A2QK 1EH8A 1AWCA 3RJPA 1UFMA 4CYDA 3HUGA 2MBFA 4L5IA 4AIHA 4F7ZA 2HDCA 3M8FA 2YR2A 1HQCA 1U5TB 2B0LA 1XXCA 2JTVA 4XLPF 5D6FA 2O6GE 3I54A 3GX4X 4M73A 3BJAA 3E3VA 1K78B 3CLOA 4KT5C 5BPIA 3ZMSA 5HOOA 3ZP5A 4MQVA 5LRRA 4ZYEA 1XCBA 4OU0A 4GCVA 1E2XA 2BGCA 3F72A 4Y13A 2DBBA 3GVAA 1F4KA 1WI9A 2JSCA 4IXAA 3T0YA 1JHHA 4NB5A 3SHFA 3F3XA 4B09A 4OINF 4Q48A 2V1UA 3ECOA 1I1GA 2PJPA 4KAWX 3WTUC 4LLLA 3KLNA 5HS7A 1EV7A 4RAZA 3WTVC 5HDGA 4WCGA 2KIFA 3I71A 2DW4A 2KIUA 4LD5A 5F64A 4OIOF 2HYGD 2O8XA 3HOTA 1BC7C 5DCFA 4DQ2A 1BI0A 3ZMDA 1LDDA 3F21A 3LA3A 2NNNA 5JI6A 2UXXA 3SQNA 5H20A 1P6RA 3FMSA 3E6BA 1ZG1A 2UZKA 3T1BA 3V8JA 5ERIA 3G3ZA 1KU7A 3MMLB 2CFXA 4HDUA 4KYWA 3BJ6A 3F6OA 4HF2A 2PI0A 1V4RA 1XN7A 3E97A 4WXCA 1SFUA 5ICCA 4G0UA 4ESBA 4UVAA 4RGRA 4ASNA 2DPUA 3VOEA 3KP6A 3BDDA 4I0BA 4D0PA 2RKHA 1USTA 1KQ0A 1XCVA 1PP7U 3REOA 3K2ZA 1QZZA 2Q2EA 4OMYA 3FXUA 1RZ4A 2RC4A 4PCQA 1LB2A 5CJ9A 1G6NA 4KC6A 4U0YA 3QOPA 2DI3A 1ZN2A 2AS5F 1OKRA 2VBYA 5LEJA 2F5CA 1TW3A 3BPXA 1SFEA 4PZJA 3T8TA 1PDNC 2Y3PA 1UHMA 5L3CA 1OYIA 2W25A 3LA7A 4A12A 1O7LA 5L3BA 2XCQA 2OQRA 3I5UA 4RB0A 1VTNC 3E5XA 1TTYA 4JQFA 3DPLC 2L4MA 2PMHA 3BJOA 2Z33A 5D8LB 2RGVA 1W7PB 4L9JA 1J0RA 4IJAA 3EYYA 1G3TA 3HHGA 4BAYA 2K4BA 2XAFA 3L4KA 4JBAA 4LK1F 5HVQC 2JPCA 2VE9A 1ZREA 1J7KA 4KFCA 2QQAA 2XAHA 1H9TA 3FM5A 3SXYA 4RB3C 2ZFWA 2OAZA 2PBIA 3RYPA 3K69A 1FC3A 3K1MA 5HDKA 4ZZDA 4CICA 4ESFA 1BI1A 2F5DA 1R23A 2XROA 2KIMA 3CDHA 5TRDA 2Y0MA 4LMYA 3HSRA 4KB4A 4UNOA 3GEZA 2VC0A 1P92A 3OPFA 1FSHA 1KQ9A 5DD4A 2FU4A 1JGSA 1IN4A 5DUIA 2RV8A 4ENNA 2PG4A 3WGHA 2STWA 2FSWA 1LEBA 2QVOA 2BYVE 1SMTA 3DPTA 4A5MA 4CZZA 4IVNA 4XSXF 1IRGA 5DD8A 3QX3A 3HTUA 4HF0A 3R61A 3OOPA 3CUQA 2LDUA 2IP2A 2Q0OA 4QWQA 5CVJA 2OQGA 1ON1A 2FBHA 4AWXB 1UCRA 2FRHA 3IHUA 4P5OA 4XSZF 2FXAA 4I0AA 2IRFG 2MA3A 1S3JA 1FBQA 4L18B 1Y0UA 2CO5A 1ZHFA 3GFLA 2EV5A 1GXPA 1D8JA 2D1VA 3VFZA 2K27A 4MEYF 2EFOA 2M30A 3B02A 3QU3A 2L01A 4KDDA 1RNLA 4WXDA 3F6VA 4OMZA 3HSFA 5J8CA 1FZPB 2V9VA 1ZG3A 5CYVA 3KP3A 1K7AA 2RVCA 3R0AA 1FX7A 2V1XA 4M9SA 2IA2A 2FE3A 5ILUA 3J81Z 3EETA 3I64A 2MD5A 4EM1A 5LHGA 3MFKA 3F22A 1TW2A 3RIRA 3V4GA 1F1ZA 3GXOA 1B4BA 4BYYA 5LEKA 1XMKA 1S6LA 2CYYA 3WE2A 3OEPA 2XCRB 3GF2A 4KNYA 2BBYA 3QU6A 3LFKA 5E20A 2VC1A 4KIGA 5D8KB 2VE8A 2R3SA 1B1BA 1OYWA 4N0BA 5LLQA 1F9NA 2F5FA 1HW5A 5LHIA 2KWAA 2RDPA 1DPRA 3KP5A 5KK1A 3MWMA 2UXNA 3FOEA 5ILSA 1FP2A 2HGCA 1XSXA 5DEQA 2VONA 1SD4A 1W7PD 3FX3A 4P9FA 3E6DA 4IHSA 4FX4A 1IW7F 4IRIA 4HF1A 2CWEA 3DV8A 3FZVA 4FHTA 4UHTA 4EV0A 1DP7P 2ZCWA 2XAGA 2ACJA 3ISPA 4GGGA 3PFIA 3CJNA 3Q9VA 2M1BA 2TDXA 2GA2A 4MTDA 4OIQF 4Q47A 4U88A 3MEXA 3WODF 4I7HA 1RI7A 2XASA 2XGXA 2GZWA 2VODA 3BROA 5K5QA 5A2QZ 4JK1X 4ENMA 2Y75A 5F6FA 2K86A 1O3SA 5FGMA 3WTYC 2ZKZA 1T6SA 3FXRA 4HW0A 4RGXA 4S04A 4KN7X 5L3FA 4EGZA 1JE8A 2HKOA 1XSVA 4AIKA 1V3FA 1BIAA 2ZBKA 2DK5A 5ICGA 4A0YA 2EV6A 3K9TA 3P9CA 1U3EM 1T39A 4RS8A 1CGPA 2FEZA 2IJLA 4MGRA 1XDSA 2COMA 5J6XA 3CO6C 2HQRA 5CVRA 2EFNA 3C7JA 3WTXC 1Z6RA 1LJ9A 2GXBA 3EUHA 1KGSA 2EFQA 3KCCA 2ESHA 3VODA 3ULQB 5DCMB 3CUQC 3N4MA 2FNAA 2Q8KA 1LNWA 1D5VA 3GWZA 2P7VB 1GVJA 4G6DA 4IRHA 1MDMA 4RB1A 2L54A 1ZRCA 2EB7A 2QBYB 2PEXA 3V7SA 2VBWA 1TBXA 3L09A 1WQGA 3C3WA 2PFBA 1E17A 4TV7A 4XRFA 5K5OA 1XGSA 2BV6A 2ZMEA 5FFZA 4NHJA 1LDKB 2DK8A 3H3UA 3TGNA 5E1XA 4O5VA 3WTTC 4U0WA 3F23A 1F5TA 1S8NA 3WU1B 6PAXA 3HSEA 1EH1A 4EM0B 1QGPA 2E1NA 2PLYA 1T0FA 3CUQB 4ENKA 2BEOA 4EJUA 4L9NA 1ZLKA 4ZYDA 3L9FA 3ABTA 4RB2C 2HOEA 2NNYA 2F5EA 3AAFA 4A0ZA 3GUDA 5DUKA 5BS6A 4O3MA 4A0XA 2HFHA 1IRFA 1BJTA 4B8XA 1I27A 3BPVA 4YG2F 2E1CA 3QAHA 1ZARA 1BI2A 2OZUA 1ONVA 3IWZA 3HOSA 1HBXG 4EQQA 1P2FA 1IN7A 5E8IA 2KJCA 5LRSA 1J9IA 1O3RA 3LPXA 1K79A 4J3NA 1YO5C 3L00A 3U9GA 1HXDA 2JRTA 4WX9A 2HKXA 5E17F 2O03A 4G7HF 1XDUA 3GLXA 3EDPA 3R60A 4A2UA 3BWGA 3JAMZ 4LLGF 3QRFF 1J5YA 2AXLA 1KA8A 2R7DA 3DP7A 2DTRA 5HLHA 3B73A 1FYLA 4MTEA 3IRRA 5JVTA 4KB2A 4KICA 3I53A 5IT9Z 1DUXC 1HW1A 1L0OC 1QZYA 3CTAA 3O3KA 1MDMB 2C6YA 4IPAA 3TKYA 1WRJA 3PQKA 3CUOA 4BXUA 1I6XA 1R1TA 2NRAC 5D5XB 2YX4A 2PQ8A 3I59A 2XAJA 4Q4ZF 2A6HF 3E5QA 4UUVA 2HQNA 2M8EA 2P5LC 3N97A 1CF7B 1B4AA 1Z1DA 2H6CA 5LBQA 2K7LA 4CXFA 2H6BA 2VT3A 4FM9A 3DQVC 2ADUA 2EJRA 2FOKA 3VA7A 4Z2YA 4GYGA 3FHZA 5LGUA 1XGNA 4HDVA 2FF4A 2ELHA 4YIIA 1BJAA 1FLIA 3HYIA 2IW5A 2W57A 5JR3A 3P9KA 2OBPA 2V6CA 2LF8A 4OIRF 2FBIA 3D0SA 2P6TA 2XUBA 1Z05A 2QENA 3JSPA 3GFJA 2G7HA 3ZN1A 4M9ZA 5AONA 4LGWA 4KA4A 1LEAA 3DEUA 2CQKA 1O3TA 3FMRA 3V8LA 2A61A 2RNJA 3IRQA 2QWWA 4AVPA 2LKPA 4EGYA 1FWZA 1U2WA 3BZ6A 4L9VA 1U5TA 1R1VA 3GW2A 1TNTA 5FD6A 1ON2A 2CW0F 1C0WA 3K0LA 5D4SA 5BOXA 1UB9A 3R6SA 3KEQA 2H27A 2GAUA 1ZYRF 3I58A 1TQIA 4ZZLA 2XCOA 1FYKA 1U8RA 3QPHA 3MAJA 3WTWC 2YPRA 2GIVA 2XKPA 2DO7A 1XSDA 1GXQA 1QNTA 2MH9A 3J80Z 2H94A 3Q9SA 3JTHA 5J8FA 3IKVA 2A69F 2P8TA 4KUMA 3WTZA 2STTA 2KJBA 1DPUA 5CLSA 1HSJA 5FLXK 3ERED 2JPBA 1QBJA 2D2WA 4M72A 4IHTA 3T8RA 1IXRC 3TDUC 5HLGA 4I02A 3ML6A 1IN5A 4HOBA 1YQAA 3KFWX 1ZH5A 3LQRA 4ETSA 2YU3A 1HKTA 4PGHA 1G3WA 4LG0B 2QYOA 2W84A 2P5VA 3NUHA 2OA4A 3T5XA 3WTSC 3LSTA 2A6EF 2YX7A 2DQLA 4G0WA 3L4JA 2FBKA 4WF2A 4OOIA 1MKMA 3U2RA 4U7BA 3DF8A 2IVMA 2P5MA 5H6RA 3RDIA 3OREA 2EV0A 5K5RA 2XHKA 3E5UA 3C1DA 3LWFA 5L3GA 2XAQA 4PDKA 3COAC 3L2CA 2EK5A 3LAJA 3GO5A 2X0LA 3M1EA 5CVIA 3V7CA 1J75A 4L0ZB 2LNBA 5AIQA 5FB2A 4WK8F 1AOYA 4EJOA 1T98A 3K1NA 4LG0A 4CDGA 1MGTA 4HAMA 3GZ6A 4HZFA 4E70A 2V79A 2A5YB 5BMZA 4K2EA
chains in the Genus database with same CATH superfamily
4PGGA 3RKYA 3LSIA 3KE2A 2O5JA 1XZPA 3A1YA 4NNJA 3A01B 5IYBK 4CSWA 2K3PA 3J81K 1MH4A 2K4JA 3BCAA 5FFXA 4RDUA 5JVOA 3GTMJ 3OWTA 3A0BC 1W5SA 2G9WA 2VOOA 5C3EK 1X3UA 2VBZA 4B44A 2X1CA 2QUFA 4WJ4A 2EFPA 5D5UB 1PVEA 1EJ9A 2XVCA 1WOPA 5EG0B 3QPLA 1KZHA 2HEOA 2P7CB 2HWVA 2CJJA 2JK3A 3G2BA 3Q0WA 4BHBA 2E60A 5AIPA 3Q0UA 2HS5A 2HZTA 1DGWY 2OC6A 3A8KA 2E2IK 3S14K 3S2WA 1P4AA 1YIOA 1VRQC 1SMYF 3HRMA 3HG9A 4GTCA 4A3DK 2XGCA 4KJZA 4NC7A 2ME6A 1TC3C 3AQPA 3PO3K 1F7VA 3JRBA 3DKWA 1WCMA 1SVLA 1SFOJ 4JX5A 1I3AA 2EA4A 3I9V2 1S29A 3FBIB 3OYIA 1GE9A 5K1YA 4CGZA 1TNSA 2R93J 1FPQA 2W85A 4IF4A 1JJ6C 4FE7A 5JHUA 3G4AA 4C2MJ 2IT0A 3C2BA 2QQBA 5DYMA 4P9UA 3SZZA 4RLFA 3W6KB 2FNPA 2RN7A 1RIOH 2X1DA 2FA5A 5FRNA 5DCMA 3GTLA 1UJ8A 4A3DC 5C4XJ 3CLQA 3HOYJ 3HGYA 2JA6A 1JGGA 2DT7B 2ZMEC 3F8MA 1MSEC 1DGRM 4Y17A 3K4MA 1PYVA 1HLVA 1IN8A 2ELKA 1J2XA 3GTQJ 4ZDOA 1U5TC 3WGIA 4BH9A 2LVSA 3G1OA 3OYHA 5KAFC 3OYEA 2Z9OA 4G8XA 3P7NA 4UVBA 2GWRA 2E71A 2WC2A 3GLLA 3H0GA 1WORA 1C0AA 1YX2A 1EF4A 1OYYA 2W24A 3CQZJ 2D45A 2VN2A 2DXIA 2MABA 1XGOA 3EYIA 3RQIA 3EQLF 2WTEA 2XKOA 4B47A 4C30A 4HX4A 2M5WA 4AIJA 1VQLI 4HLYA 4NC6A 1ZR4A 4LLNA 2RAEA 2K9LA 1G3SA 1VI0A 4CZCA 3CD6I 1WJBA 4DBQA 3LQQA 2O5IA 4BXFA 4N9HA 1K83K 4HQEA 4XLAA 2NYXA 1X4OA 2JWTA 4LG3A 5E18F 5DS9A 3S2DC 1ZLJA 4IOCF 5FKOA 5KVRA 2XDVA 2PMZA 3LSPA 3CCJI 4BACA 5CVUA 1LFUP 1FBSA 4C45A 1W36D 1TWHK 2DA5A 1ZG5A 3BR0A 3V8KA 3CP8A 1I1SA 4UVCA 5TISC 2IGMA 2EA2A 3TW7A 3S2DJ 2RQPA 3TO7A 5IOSA 3RZDK 2V1DA 5FLXZ 3H0GC 3DFGA 1H8AC 3QP6A 2E2HK 2NAZA 3OYJA 1SD6A 2B63K 2VJ5A 2NVUB 2ECCA 2QSHX 3E7LA 3GTQK 3K6GA 1EH7A 1YIJI 1HKQA 3GTMC 1WPKA 2GIZA 3E6CC 2OV7A 1JKQC 4KIBA 3X2QH 4QPQA 3F8FA 4BS9A 1JKPC 2ZNZA 4NUBA 5HS8A 2DAOA 3WE3A 2VXZA 1EA3A 4C2TA 3K1PA 2P0WA 1CQTA 2ZSHB 1TZLA 1MZBA 4GO1A 5FD5A 3S15C 2MSYA 1R5HA 2ZXHA 3FISA 4AVZA 4L0YB 2Y9YA 2OCEA 4Y15A 1PP8F 3H0GK 2A69A 4U0VA 1X1CA 1B6AA 1POGA 1TWGK 2E7XA 2R93K 3SFZA 2DU9A 3KZZA 1T08B 2LY1A 5J1YA 2IGNA 3KYCB 3HOWJ 2YSRA 1GVDA 1VQ6I 2GXGA 2CV2A 2O8KA 2Z3YA 3HKZA 1BDFA 2X51A 1MJAA 2O0YA 5LD2C 2XRNA 4A3DJ 3IL2A 5DV5A 3S17C 2O61A 1KU2A 4LITA 2Z1DA 4E6KG 1RR7A 3PNTA 3BG9A 3ZQLA 2WV0A 5GTIC 2QZ8A 1SVOA 1FJLA 3N0BA 3L2WA 4RGSA 4CO8A 3H9JA 3RZOC 4UXNA 4D1QA 1CF7A 1BA5A 3I4NK 4EMSA 4HLXA 2P6SA 1J59A 2HVRA 5GADJ 3I0TA 1TLHB 2JT1A 1ZAOA 4DZJA 4ON0A 4YFNF 2K02A 5ILVA 3PIOF 5E3OA 1SANA 3Q5FA 4W97A 2G0EA 2KP6A 3ZMTA 1ZRDA 3HOUC 4DBRA 2IBDA 2L7MP 3J7ZI 3RI4A 2A6HA 3KZYA 3W6JB 1ETQA 2RREA 1QHGA 1SFXA 1ZGAA 3L7WA 4R1HA 4MHGA 1NK2P 3BTJA 4QIWD 1VGXA 3FHNA 1YJNI 3GIRA 1MMSA 5TGTA 1O27A 4EJVA 1S7OA 3SZTA 4RAYA 2JZYA 4Z6YA 1SAXA 3H3ZA 5D5WB 3KETA 1W36C 1KONA 5BPDA 4HV5A 1O7FA 3RSNA 4QIWL 4B43A 2JA7A 2COBA 2RGRA 3OYKA 4JX4A 3HRSA 4KDPA 1OCCH 3ZPLA 1SD5A 3S16C 5GAEJ 1D3YA 2ZC2A 3AL0B 3HDDA 4C3HJ 3N05A 1ZYRA 2QCOA 2IXSA 4GFBA 1K78A 3OYCA 4XBFA 1EQRA 5FKKA 1R7JA 1MBJA 4G7HA 1YX3A 4J00A 1X1DA 4E7LA 2V6TA 1ITYA 1MBFA 2PMZD 1MJ9A 3RPQA 1R1UA 2CQ7A 4A93C 2LF7A 4KM8A 1QVTA 2CGPA 2ID6A 1HKSA 3F8BA 4G6QA 4WILA 4DW6A 1FBUA 1OMIA 2KISA 1RUOA 4YFXA 1B9MA 4HSTA 1X31C 4KN4A 1R58A 3BP8A 3M3YJ 2NVTC 2ELJA 3P5JA 5HDNA 1WJFA 4LJZF 2CH0A 4BKWA 3RQ4A 3PO2C 4C3JC 1WOOA 2M8GX 3JTGA 1R5GA 2NOGA 1EK8A 1LVAA 2E1MC 1S9HA 4KITB 2VOPA 1Y1VC 1YLFA 5EGEA 2BW3A 2X6WA 1FP1D 3FM3A 3WG7H 3ZQQA 3JREA 4UV8A 3GTGJ 4G94A 1APLC 2KKOA 3I59B 3G1MA 2YUSA 2ZXJA 3Q0VA 2I8DA 4L9TA 2E7WA 3FXKA 4KMHA 3WGGA 4DNCA 5L3DA 4EVIA 4MQ9F 3RTRA 1VFCA 2BOLA 2DFHA 1Y56A 3HKZL 3GTGC 3CCSI 2NVXJ 1OCRH 3ZMUA 2K9QA 3IC7A 4A3LK 2VT2A 3DTEA 2HR3A 3SDGA 3V7RA 2B7EA 5F1RA 2B63J 5D5VB 1WQHA 2L9VA 4F92B 1O3QA 1R9TC 1ZKGA 1YW9A 1WKMA 1TWFJ 3BTLA 4DJAA 5LGTA 2R7XA 3BP8C 3SEZA 1TWHJ 1YFHA 3GFMA 3QP5A 3TDZC 4YIRX 2JUCA 2DMPA 2PHCB 3MKWB 1JHFA 1H0MA 4AYBL 1YW8A 2JA8C 3WG9A 1STZA 2TCTA 4A3GC 1MBHA 1IXCA 3TOAA 4BNCA 1BIBA 3HOWC 1LVKA 3U21A 1BW5A 5JHFA 1BGWA 1XGMA 1HW2A 3SZYA 2Z99A 3KEOA 4KIFA 1W4MA 3I4MC 3ASNH 5E8GA 3GTOK 1R36A 4GFQA 2W4SA 1SD7A 2ZJ2A 2QKLB 2L2OA 4S05A 2OF7A 2JA6K 1G3YA 1K6OA 3CZ6A 4C3JJ 1FY7A 3F8CA 3HPGA 4HBLA 3CQZK 5FROA 2CS3A 3MVPA 3OR1C 4IQ4A 2FMYA 2E1MB 4Q5SF 4DDQA 4BHPA 4BDYA 2VPLA 3VB2A 3G1LA 1K61A 3K4KA 1TWAC 3I3LA 4ANJA 3SZPA 4A3FK 2PN6A 4LK0F 3AH5A 3EQLA 2YU9A 1SAUA 4GTAA 2DFEA 1Z3YA 3H9QA 4X6AC 5HL8A 1W5CC 5IYDJ 2M2EA 4XK4A 2P4WA 4IZZA 1FTTA 2FQ3A 1BC8C 1T8IA 5LFAA 3LA2A 1T56A 4RLQA 4LB6B 1OR7A 2J5PA 4YFKF 1RPWA 1A31A 3EUAA 4XR6A 5HLTA 4XOTA 1T2KA 2K5CA 1LQ1A 1YX5A 4ZYGA 4DOZA 3P9IA 2DFIA 4I2OA 3FKIA 3BUEA 1R6RA 3GTOJ 4BY7K 1R4MB 3H35A 4WWCA 1RETA 1U6GA 2AHQA 3MZHA 1TQPA 5LHHA 4XN3A 1HDDC 5DM6F 2W7VA 1L3LA 4OIPF 2ZMEB 3H92A 2GAGC 2FJ1A 3TO9A 3LAPA 1H9GA 4CCNA 4KMUX 1KYWA 2L9SA 2JQ7A 4C3IJ 3GTLJ 5CPRB 4PFOA 2L02A 1X1AA 2P5KA 1XXBA 4P55A 3M9AA 3NRVA 3RCOA 1VQMI 1NHAA 3ZQ7A 3N3YA 4IKFA 2X1EA 4LFUA 1Q1HA 5F0CA 1A6QA 1FMVA 1MMNA 2RNGA 3W3CA 3OYDA 2A07F 4A3BJ 3DBRB 3QWLA 2ZUEA 2DA3A 5C3EJ 2QBYA 1VLOA 2M3AA 3GTMK 2F2EA 1R00A 4EJWA 3TW6A 2HYFA 1LPQA 4JOMA 4KATA 4M74A 1Y1VJ 3IH2A 3VEPA 2EWNA 3FKIC 3ZMVA 3NQOA 3H3VK 3S1RJ 2RQQA 2VBXA 1HCRA 1MMAA 1X19A 4ZC3A 1JUSA 2NVTJ 1FOKA 1Y1VK 2DFFA 1TP4A 3G4SI 4EM2A 1IF1A 1IAWA 2HZDA 3WU0A 1WJ5A 4BHCA 2PA8D 4EATA 5TJJA 1ODDA 4FISA 2X4HA 1I3QA 2IA0A 4A3BK 2DYRH 1Z7UA 1YG2A 2BW3B 2JA2A 4HV6A 1GT0C 1K6YA 2DMTA 2M0CA 4G9YA 1PJ5A 1ETOA 2N8GA 1R9TA 1UZCA 1I5ZA 3GYHX 3FKIK 4YEJA 1FYMA 3M3YC 5DM7F 4H0EA 1TQMA 3EUKL 1YCLA 3KP4A 5CKTA 5D6EA 3VYTB 1MJBA 1WQ2A 2E1OA 4Y4RA 1YW7A 3M4OC 4HX7A 3KZIC 4BLAA 4BUPA 2CU7A 2MLKA 2BY0A 2L3DA 1P4WA 2GQQA 5EEHA 4KN4X 3I56I 3G73A 5C4JC 1U78A 3FXJA 1TWFA 1FOWA 1GV5A 1FMWA 5H6QA 4AC0A 3AG4H 3HIFA 4PFPA 1ZGJA 1RUNA 4C3HK 4OIQA 2V26A 3S93A 3BTIA 1B8IA 1T33A 1Z6TA 1MNMC 1YS6A 4II3A 3FK6A 4R8HA 4FQGA 3VYRB 3CAGA 2M45A 4IRGA 4M71A 1G51A 1GV2A 2EZLA 2ZFUA 3JRGA 1WIHA 2HI3A 3M4OK 3PQJA 4XSXA 4MEXF 4UB6C 4GXOA 5BQTA 1IC8A 4Q4ZA 3FMQA 2D1HA 2CG4A 4BEHA 3DTKA 3EPZA 1QPMA 2M87A 2XPWA 5EEGA 2V6EA 2MC4A 3ERMA 2UWMA 2ZFZA 4HRIA 4BDZA 1EFWA 3J80K 3LSRA 3CCQI 1O28A 1R22A 3KP2A 2KPMA 4GYIA 3GTKJ 5K7HA 1MIJA 2IA1A 3ZMZA 2E2JK 1TT5B 4HG2A 2ZO4A 4MNUA 4KMFA 4HA8A 2R7FA 2JA6J 1TL8A 2R92J 1QPIA 4FTHA 2IPQX 4BKXA 1ZGWA 3TQNA 1AB4A 1R71A 3HXLA 1QQIA 1EH6A 5FO5A 1ZRFA 2VLAA 1P4XA 3IH4A 2R5YA 4Y3OA 3JSOA 3RKQA 5ICFA 4A6DA 4I98B 3ROUA 5IOZA 4G7ZF 1WI3A 1JT0A 3AG1H 4YFXF 5CVVA 3FOFA 1FSEA 2Y48A 2VUMK 3GTPA 3DLAA 2VQCA 2WB1L 1BOAA 3TP3A 2OCCH 3LL7A 5IT9K 1TWFK 5F0FA 1IG7A 3CCEI 1KQ8A 2JVGA 5E3NA 2OD5A 4BE1A 1V5VA 4XKVA 2DQRA 5ICEA 3FXOA 4I09A 4AYBD 3S16K 3R4KA 1IRZA 4XLPA 3O6BB 2QM3A 4RA2A 2NVXK 3H1CA 2Z16A 4XLNF 1ERDA 2R7RA 3KP7A 3DXJF 1AA7A 4QPOA 2XC7A 4N9IA 1REPC 2WAQN 1AKHA 2MC3A 1DDNA 3HOXK 2MLGA 4L5EA 2CW7A 2GSOA 1IS1A 2Z5UA 1YRNA 2HTSA 2X48A 3IWFA 2M0MA 3SZGA 3GZ5A 1IXSB 1U8BA 4B1RA 1KU9A 4BEHB 1ZQ3P 1ETWA 2LSOA 5EGOB 1KU3A 1Z21A 2QLZA 3GFIA 4BXXJ 1F43A 5E1ZB 2VUMA 1YYVA 3S16J 1Z91A 4FX0A 4AD9A 3HRUA 3NWSA 2KHMA 4AIDA 1XXAA 1QO0D 2OU2A 1DD5A 1A04A 2XGDA 1WCMJ 4BBRJ 4ZH4F 3M8EA 4EJTA 2LY2A 3K4NA 1YTYA 3TL4X 1BBYA 2HNHA 3F9KA 3OL4A 3FWEA 3WU2C 4KMUA 3RYRA 4NBQA 3GEHA 3D5SC 3HTSB 3PNYA 3A2KA 1MD0A 3BTCA 3HC7A 1WQFA 2GAHC 3IUOA 1FOYA 4A3JC 3RKWA 2OZ6A 1XMAA 3HGGA 5EG0A 4BQNA 1U9NA 4ESJA 1WGXA 3NEUA 1BN5A 2KRCA 4WXHA 5KAIC 5DDGA 1YJ9I 1ENHA 2ZNYA 2MH2A 2A68F 1Z9CA 4A3JJ 3LSMA 2NS0A 1B59A 2L0KA 4ILDA 2IGOA 3I4PA 4P5AA 2ETHA 2ESNA 1OQYA 4I6ZA 4O2DA 3O2PE 3M1CA 2CSOA 4HQMA 4A6EA 2JMWA 4I01A 4PJJA 1MSFC 4E7ZA 3GMEA 4OIOA 1E3PA 3BP3A 1W0TA 2PMUA 1G4DA 4MIMA 3CO7C 2R7SA 3M7GA 2L4AA 2BY2A 2HTJA 4P96A 2J5OA 1WVRA 4M6XA 1UHWA 2LK2A 2DPDA 1XB4A 2XSDC 1OISA 3O8GA 2GA1A 3JRIA 3ZRGA 3ZQIA 3ZN0A 3FXQA 2EFWA 3MMLB 1K83C 1LE8B 2FMLA 1U9OA 5ED4A 1HI9A 4PJ0C 3J7AO 4HYEA 3RKXA 5HNFA 1NG6A 5GPCA 1ISEA 5J3LA 2E5ZA 1TWHC 1Y1WA 2R4GA 3RPUA 4BL0B 4RGUA 2K40A 4HNTA 3LSKA 2VIXA 4L5JA 3JAMK 1Y1WK 2VKHA 3JRAA 4FT8A 3BY6A 4CHUA 1IDZA 2QQ8A 2QQ9A 1GHCA 3ABUA 2DMUA 2DLLA 2JA8J 1IZ1A 2LTPA 1O2AA 3FF5A 5E1WA 2WWYA 2H09A 3MQ0A 1IBAA 2XV4S 1USSA 2R7WA 4V2FA 4NQWA 5B1AH 3KLOA 4HX8A 3W6VA 4CCLA 3TO6A 4M9XA 3F0CA 1QRYA 3A03A 3TOBA 3AG2H 5EZGA 2DODA 4BJ5C 4DZPA 2R7VA 1A36A 4D5FA 4PJNA 5IYCK 4GRIA 1MBGA 3OYMA 1V55H 5M5YJ 2MW8A 1BI3A 3W2AA 2NVTK 3ELKA 5GTHC 5D4RA 2HYJA 3HRTA 1P7JA 1IUYA 1IN6A 3A0HC 3S1RK 1R5ID 1I6HC 2KRFA 3JR9A 4DIQA 2EH3A 4YIFA 1O26A 2Y0SL 2A3SA 2JVHA 2V1NA 4A3CK 1XS9A 1WSVA 4NDLA 2LKXA 3HBLA 3HOVJ 5LGNA 3F8NA 5HLIA 1HSTA 3ZQHA 4AU7A 4E7KA 3TFIA 1OLTA 4ENJA 3FXMA 1RESA 5FKLA 3VDXA 4ZYHA 2QKMB 4A5NA 2XIGA 3CJRB 3MCZA 5JFRA 3RZDJ 2FQ4A 1VQ5I 3E0JB 2BE5F 3QPTA 4O6JA 5M5WJ 3R0JA 4ZTJA 4QLCU 3MZYA 1JXSA 3BZKA 1FNNA 4XORA 4A3EK 1BS2A 4R79A 3ZXSA 1D8KA 1ULYA 2EPFA 1IQ0A 4A3GK 3NAUA 4A3JK 1WSRA 5L3EA 1XD7A 2ZXIA 3IKTA 2JH3A 2CUEA 1BM9A 3HHHA 5IP7C 4XQFA 1FEXA 3RZOK 5HS9A 2O3FA 1S7AA 1WJAA 3HOUJ 3E6MA 2K9MA 1S72I 2IS4A 2DMNA 2E2IC 1B9NA 2M4GA 5CQGA 3VPRA 2EZKA 1W7PA 2JA7C 4D5CA 2O7OA 2CV0A 2LFBA 1WSUA 3S1QC 4G7OF 1W5TA 4YELA 3JW4A 4U7DA 5IT3A 1KYZA 1FOXA 3J7YJ 2ISYA 2HOSA 1HQMA 2G7UA 1A6IA 1OPCA 1YS7A 4G0VA 2DT5A 1LDJA 2CQNA 2EIJH 4IHYA 3OV8A 4LB5A 5HNHA 1FT9A 3C18A 2VXDA 1O57A 1KQ4A 4A3IK 2JA5C 3BOQA 1PUEE 3D5LA 3U1DA 2ISZA 2XB5A 2IEKA 1D0YA 5J4VA 2V6UA 4M6YA 4BQAA 1X3ZB 5GPAA 1F7UA 3GTPK 5E3MA 2F6CA 1T38A 1WWXA 2CQXA 3ECHA 4UV9A 2VKEA 1ZVUA 5A2QK 1N25A 1EH8A 2CRGA 4A93J 4B48A 3QODA 1AWCA 3RJPA 3GTJJ 1UFMA 3SYTA 4CYDA 3HUGA 5E68A 1OCOH 2MBFA 4L5IA 2DTZA 4KN7A 2HU9A 2K9NA 1ORKA 4AIHA 4F7ZA 2BE5A 2HDCA 3S1MC 3M8FA 2YR2A 1HQCA 1U5TB 2B0LA 1XXCA 2JTVA 4XLPF 5D6FA 2O6GE 4D9JA 3S15J 3I54A 5KCMA 3GX4X 2UV1A 4E7SA 4M73A 3BJAA 3E3VA 1K78B 3CLOA 2VQGA 4KT5C 2HOTA 5BPIA 3ZMSA 5HOOA 3ZP5A 4MQVA 5LRRA 4ZYEA 3GTJK 3HOZJ 1XCBA 1EI6A 4OU0A 4OIPA 4GCVA 5J4YA 5IYBJ 1O2BA 1E2XA 3GCMA 1XZQA 4CYCB 1HC8A 4GT9A 3BC8A 3LFUA 3NARA 1QVUA 2BGCA 2BY3A 3F72A 4XCHA 4Y13A 1ETVA 1T95A 2DBBA 3GVAA 3CCVI 1Z77A 1YRNB 1F4KA 3AQOA 1WI9A 2JSCA 4IXAA 1B72A 4XRMA 3T0YA 3ZGKA 5JLXA 1JHHA 3GTGK 4NB5A 3SHFA 3F3XA 1OR7C 1USOA 2WY8Q 3EUHC 4B09A 4OINF 4Q48A 5JLWA 1ACIA 2V1UA 3ECOA 2VQHA 3B6AA 1I1GA 4XM3A 5FJ8K 1G8XA 2GXAA 2IS2A 4GTBA 2PJPA 3M3YK 2H1KA 4S0HB 2Y0SA 3WTUC 5IP9J 4KAWX 4M1XA 4LLLA 3I4MK 3KLNA 3JRCA 5HS7A 1WFXA 1MBEA 4OAZA 1JKRC 1EV7A 1TWCA 4A3BC 1HA8A 3BR6A 1J6VA 4RAZA 2M7BA 3WTVC 4NC8A 3QOEA 2KIFA 5F27A 5HDGA 4WCGA 3I71A 2DW4A 2KIUA 1D1BA 4LD5A 5J40A 4I76A 3PFYA 5F64A 4OIOF 1M1EB 2HYGD 2O8XA 2FQOA 3SEQA 3HOTA 5IOYA 1BC7C 2ZXWH 5DCFA 1HDPA 4DQ2A 1BI0A 1AHDP 1ZELA 1LDDA 3ZMDA 2R93C 3F21A 4F93B 4XKCA 1G59A 1VQNI 3CCYA 2PA8L 3J7AY 1YE9A 3AG3H 3LA3A 4NOIA 2NNNA 5JI6A 2UXXA 1O24A 3K7AC 3M8JA 3CCUI 1XPPA 4CCMA 4LOCA 4MQ9A 3CMEI 3IH3A 3SQNA 3IAS2 2HPMA 5H20A 3L2RA 3ABMH 2DT6A 1P6RA 2KZVA 2ID3A 3FMSA 3E6BA 1ZG1A 1B72B 1ZK8A 2UZKA 4Y7NC 5GAGJ 3HEFA 3T1BA 3V8JA 4KARA 5ERIA 2E2JC 3G3ZA 1Y1WC 3CQZA 4CYCA 3QPSA 1KU7A 2PMZN 2CFXA 1DU0A 3OYNA 4HDUA 4KYWA 3BJ6A 4A3CJ 3OIQA 3TP0A 1VQ8I 3F6OA 3ABLH 2M4KA 1UV7A 4HF2A 1JTXA 3GBGA 2Q1ZB 2PI0A 1V4RA 1XN7A 3E97A 4WXCA 3CCMI 1SFUA 1NH3A 3GTOA 5ICCA 4G0UA 4AYBN 4ESBA 4UVAA 2HPIA 4RGRA 1UELB 1SEUA 4ASNA 3BQYA 1BR1A 2DPUA 4BJ6C 1I50K 4A3KC 4XRSA 3VOEA 4MEXA 3KP6A 1J98A 3BDDA 4I0BA 2LD5A 4D0PA 4CH7A 2RKHA 3LMMA 3I4NJ 1XZQB 3FKJA 1USTA 1TWAJ 1FIAA 1KQ0A 1XCVA 1PP7U 3REOA 2EINH 3K2ZA 3BQZA 1QZZA 2R92A 2Q2EA 4OMYA 2I5UA 3AD9C 4XLHA 2DOFA 3S1NC 3FXUA 3FIWA 1I50C 3DU6A 1RZ4A 1XPXA 1YNJA 2RC4A 3ZOBA 3HKZN 4F91B 4PCQA 2XAUA 3PL8A 1V5GA 1LB2A 4A93K 1YITI 5CJ9A 4PABA 1G6NA 4KC6A 3GTQC 1MW7A 2NVXA 2E2IA 1IGNA 4F55A 2MD0A 4FETA 4U0YA 3QOPA 1NG7A 3GTPJ 2DI3A 1ZN2A 2AS5F 1OKRA 3GTJC 2VBYA 4C2UA 1SFOC 5LEJA 2F5CA 4A3CC 3DPUA 3A8JA 1I3QJ 1TT0A 1TW3A 3BPXA 4D7NA 3H5RA 1E3OC 1SFEA 5CHPA 1P9QC 4PZJA 4C2MC 4KMDA 3T8TA 1PDNC 2Y3PA 2R92C 2CW8A 1UHMA 5L3CA 3A8IA 1OYIA 2W25A 3LA7A 4A12A 1O7LA 4F3QA 5L3BA 2XCQA 2OQRA 5C4XC 4CCOA 2A6EA 3TFHA 3I5UA 4RB0A 2OTJI 4BU2A 1DCOA 2L7FP 2HVQA 3O8HA 1VTNC 4C3JK 3E5XA 4C9YA 3I55I 1TTYA 4QJVB 4JQFA 2FD5A 2H1LA 2M9HA 3CF5F 3DPLC 1ZR2A 3DKXA 2L4MA 1IO2A 2E35A 1AU7A 2PMHA 2R5ZB 1IJWC 3HOUK 3BJOA 2Z33A 5D8LB 4J19A 3HOVC 2RGVA 1W7PB 4L9JA 4RMNA 4IQJA 5GAHJ 2JA7K 3TMOA 3ZQCA 4XL9A 3S1QK 1WH5A 4M3DA 4LLGA 4BBSC 1J0RA 5FRMA 4A3EJ 1MMGA 4IJAA 3EYYA 1G3TA 2YS9A 3ZCOA 3D5RC 1ZQ1C 3HHGA 4BAYA 1QU3A 3Q3SA 2K4BA 1QHHD 2XAFA 2ICWG 5JFEA 3L4KA 4JBAA 4LK1F 5HVQC 3S1MJ 1XMXA 2JPCA 2VE9A 1ZREA 1J7KA 2A6TA 4KFCA 2QQAA 2XAHA 1H9TA 3FM5A 3SXYA 4OINA 4RB3C 2ZFWA 2XGEA 2OAZA 2PBIA 2XF6A 3RYPA 5C4JJ 3K69A 4M3FA 2LBFA 2D6FC 1FC3A 4MFDA 3K1MA 5HDKA 2XRLA 2R7ZJ 4ZZDA 3ZQFA 4CICA 4ESFA 1BI1A 2F5DA 4MEYA 5IYCJ 1R23A 2XROA 4KISA 2WV1A 5KHDA 1TWFC 2JA5A 2R7OA 2KIMA 2KZGA 3CDHA 3S32A 3HPHA 4CCJA 5TRDA 1IRXA 1T0FC 1VH2A 1JKOC 2Y0MA 1YI2I 2YU9J 1Y6IA 1Y8QB 2XPUA 4LMYA 2NS8A 3HSRA 4KB4A 4UNOA 3GEZA 2VC0A 1P92A 3OPFA 3GDZA 1FSHA 5EGHA 4A3KK 4BY1C 2LOOA 2V9KA 1BR2A 2GSUA 1GUUA 1KQ9A 2AQEA 5DD4A 3PO2K 4NQWB 4E7JA 2FU4A 3OSFA 2E2IJ 1FIPA 2W82A 3S14J 2LP0A 2R7TA 4LJZA 1JGSA 2HQAA 1INNA 4XOPA 1IN4A 2L7KA 2RV8A 5DUIA 3BLYA 4ENNA 2CFAA 2PG4A 3WGHA 2EZIA 2STWA 2FSWA 2LY9A 2QVOA 2BYVE 1SMTA 4B3AA 3MKYB 3DPTA 4IHXA 1WJDA 2R7UA 2F4MB 4A5MA 1I3QC 4CZZA 1ETXA 2H8WA 4C3IC 3GTLC 4IVNA 4XSXF 1IRGA 1LKXA 1ZXOA 5IOTA 5DD8A 2NVXC 2JJ7A 4BY1K 1DCHA 3QX3A 3HTUA 2R7QA 3GZNB 4HF0A 3R61A 3OOPA 2WB1D 3CUQA 3BG5A 3S2HJ 4IHWA 2DA2A 1QA6A 4LOWA 2LDUA 2IP2A 2Q0OA 5F1JA 2B63C 4QWQA 5CVJA 2OQGA 3LOCA 1K4SA 1OJLA 4LR2A 2RH6A 3AD7C 1DU6A 3OIOA 3AL0C 1LFPA 4XKWA 1PJRA 1ON1A 2FBHA 1YNNA 2LC2A 3K4BA 4AWXB 1UCRA 2FRHA 3IHUA 2EIKH 4P5OA 4XSZF 1UAAA 2FXAA 4XLEA 1WOSA 3HB9A 4I0AA 2LYCA 2MA3A 2IRFG 1I6HK 1G2HA 1PUFA 1S3JA 1FBQA 4L18B 1Y0UA 2CO5A 1ZHFA 4B3XA 3S3MA 1D1AA 3SDBA 3GFLA 3CMMA 2EV5A 2EZHA 1GXPA 1D8JA 1VQ4I 2D1VA 1K4TA 2Z2SB 3VFZA 1QZEA 2TRTA 4BY1J 3PM1A 1UG2A 5L46A 5B3SH 3KPHA 1JI8A 2K27A 4MEYF 4XIDA 2EFOA 2M30A 3B02A 1H88C 2WAEA 3QU3A 1BW6A 2L01A 3KX2A 4KDDA 1RNLA 4WXDA 4HNVA 3F6VA 4BBSK 4OMZA 3HSFA 4PK4A 3OY9A 3L2QA 5J8CA 2BVLA 2HDWA 4E7IA 1FZPB 4HSRA 4MLOA 2V9VA 2VPRA 3B6CA 4UUSA 2QSGX 1ZG3A 3S3NA 5CYVA 2DJIA 1R49A 3KP3A 1K7AA 2RVCA 1X2MA 3DXJA 3R0AA 2VB6A 1FX7A 2V1XA 2AO9A 4M9SA 1DP3A 4AYBA 1MNDA 4BXXK 2B9SA 2IA2A 2FE3A 5ILUA 3J81Z 3EETA 3I64A 2MD5A 4EM1A 5LHGA 3MFKA 5JVGF 3F22A 2EBIA 3OYFA 1TW2A 2LG4A 3H0GJ 3RIRA 3V4GA 1GDTA 1AKHB 4A3MC 2WBMA 2R7ZK 1F1ZA 5EGOA 1LE8A 2CUJA 3GXOA 1B4BA 4IO9F 4BYYA 5LEKA 3CJTB 4A3MJ 2XPVA 2L9NA 2UUZA 1XMKA 1S6LA 3NWTA 2CYYA 3WE2A 3OEPA 2XCRB 4OAYA 3TEDA 3GF2A 2MFZA 3JRDA 4GDFA 4LK0A 1K83A 3HOZK 4KNYA 2BBYA 3QU6A 3LFKA 2EQRA 3ZR8X 2KDZA 5E20A 2VC1A 4M3EA 4KIGA 2R0QC 4M3GA 2AQFA 3G4CA 5D8KB 2VE8A 2R3SA 1B1BA 1BOBA 1OYWA 4N0BA 4E4HA 2ZJQF 5LLQA 4A3FC 1F9NA 2E2HC 3PUBA 2MYSA 2F5FA 1HW5A 2R93A 2ZUFA 5LHIA 1HOMA 1JJ8C 2KWAA 5IYCC 2RDPA 1DPRA 3KP5A 2R5YB 5KK1A 1RU0A 3MWMA 5C44C 2E2HA 4PSWA 2JA5J 2JA7J 2UXNA 2VKDA 3ABKH 1J6WA 4KMAA 3HOZC 5TMCA 3FOEA 3JSTA 3PUFA 1X2NA 3GTJA 5F0HA 5ILSA 1FP2A 1WJCA 1XSXA 2HGCA 5DEQA 2DCEA 2VONA 5B66C 3L2VA 1SMYA 1X1PA 1SD4A 4BY7J 1W7PD 3FX3A 2BXYA 4P9FA 3E6DA 2DA7A 2CV1A 4IHSA 2KLOA 4FX4A 4Y52C 1IW7F 4IRIA 4HF1A 1L0WA 2CWEA 2E5NA 3DV8A 3FZVA 4FHTA 4UHTA 3UKGA 4EV0A 5IYBC 3QQAA 1DP7P 1XTAA 2ZCWA 2XAGA 2CFOA 3N0CA 1X3WB 3DEEA 2ACJA 4ZTFA 3ISPA 1TWCK 4LQYA 5CQEA 4GGGA 5FLMK 3PFIA 3CJNA 3FBNB 3Q9VA 4RM3A 3KIOA 1VQOI 2M1BA 2TDXA 2GA2A 4MTDA 4XKBA 4OIQF 4Q47A 4U88A 3MEXA 5FKNA 4A3IJ 3AD8C 3GSIA 3WODF 4I7HA 5M3FJ 1RI7A 2XASA 5IP7K 3H5NA 2GOXB 2XGXA 2GZWA 4X1EA 4A69C 4B4CA 2VODA 3T00A 3VWBA 3BROA 5K5QA 3UR3C 5A2QZ 5FLMJ 3HOYK 1Y8RB 4JK1X 4ENMA 5C4XK 2Y75A 2GOMA 4M3BA 1NTCA 3BG3A 5F6FA 2K3FA 2DA6A 3OSGA 4P5BA 2K86A 3PJRA 4ITVA 1SC7A 5BNGA 1O3SA 5FLMC 4RM2A 5FGMA 3BR5A 3WTYC 4UUSB 2ZKZA 1T6SA 2X6XA 3FXRA 4HW0A 4RGXA 2V6SA 4S04A 4KN7X 5E3LA 5L3FA 3H3VL 4EGZA 3RZOJ 1JE8A 2HKOA 1XSVA 3DCFA 4AIKA 1V3FA 3PO3J 4D7MA 1BIAA 2ZBKA 3OS1A 2DK5A 2JA5K 2IS1A 4V2GA 5ICGA 4RBOA 4OIRA 4A0YA 2EV6A 3K9TA 4A3GJ 1ETYA 1WJEA 3P9CA 1U3EM 3FKIJ 1T39A 4RS8A 1CGPA 2FEZA 3JRHA 2QA4I 5IP6A 3OMYA 3DU5A 3H3VD 1F36A 2IJLA 3OL3A 1TWAA 3GTPC 4MGRA 1XDSA 2COMA 4N4NB 3DBLB 2HQRA 2LLKA 5CVRA 5J6XA 3CO6C 2EFNA 3C7JA 1PUFB 3OIPA 3T01A 3WTXC 4RMFA 1YOVB 1Z6RA 1LJ9A 4N4OB 4BE0A 1VQKI 4XICA 2GXBA 4A3LJ 2JA6C 3HOVK 3S14C 3EUHA 2VJIA 1KGSA 2EFQA 3KCCA 2ESHA 3G6EI 3VODA 3CMAI 3ULQB 5DCMB 1JOEA 4XLFA 3S0XA 3CUQC 3N4MA 2FNAA 5M5YK 2Q8KA 4XONA 3CMYA 3CC4I 1LNWA 1D5VA 3GWZA 1LFBA 3MZ8A 2BY1A 2P7VB 3IV5A 1GVJA 4G6DA 1MH3A 2WA0A 4IRHA 1MDMA 4RB1A 1X4PA 5DTDA 2L54A 1ZRCA 2EB7A 2QBYB 2FUG2 2PEXA 3V7SA 3S1NK 1OFCX 2KFDA 1B8IB 2VBWA 3RZDC 2LREA 1TBXA 4GTDA 2HQ5A 3L09A 1WQGA 5IYDC 2JN6A 4G6TB 2W7NA 3C3WA 2ECBA 4BGDA 3HOXC 2PFBA 1TWGA 1E17A 4PAAA 4TV7A 4XRFA 4DYQA 2NVQJ 1XGSA 5K5OA 1Y1WJ 3C2HA 2BV6A 3SFIA 4BJTA 5B5EC 3OS2A 1H89C 2ZMEA 4XLCA 2Y9ZA 4G7ZA 5K7FA 5EYRA 4UUTA 2AXTC 5FFZA 2X9DA 5EDNA 4NHJA 3GTOC 1LDKB 2CUZA 2DK8A 3H3UA 3TGNA 5E1XA 4O5VA 2Y31A 2DMQA 3WTTC 4U0WA 3A01A 1GLNA 3F23A 4IEJA 1F5TA 1WZ2A 1S8NA 2ZB9A 3WU1B 6PAXA 4YG2A 3HZJA 2WB1A 3HSEA 3UNGC 1N78A 2LBFB 1EH1A 1RC9A 3KYDB 2D5VA 4EM0B 3MMYB 5FJ8J 2QEXI 4KM9A 1QGPA 4A3FJ 4XN0A 2E1NA 5K7ZA 3S2HC 2NXNB 5J1RA 2PLYA 1T0FA 3H5AA 3WHBA 3CUQB 2GBYA 4RAFA 3HL2A 4ENKA 4XRSG 2BEOA 4G12A 4EJUA 2PMZL 3KEYA 5FLVA 4L9NA 3CCLI 1ZLKA 4ZYDA 5FKMA 4FE4A 3L9FA 4MO7A 2MG4A 1VZ0A 3ABTA 1D0XA 2ZSIB 4RB2C 2XB0X 1D5YA 2KT0A 1WH7A 2HOEA 3VYUB 3OOUA 3VSKA 2NNYA 2F5EA 3PSFA 2O9LA 3AAFA 1U0JA 2W00A 4A0ZA 3GUDA 1E3HA 3DWLE 5DUKA 2CFAB 4YFNA 3TFJA 4C3HC 2PJRB 1EKEA 1P7IA 3LSHA 3G71I 1A35A 3S1RC 3QYEA 3AKZA 3CQZC 3HM5A 2M7AA 1Z3XA 4ABZA 4FASD 5BS6A 2EILH 3L1PA 2GLOA 2WAQD 4XMYA 4O3MA 3S15K 4A0XA 1ETKA 2HFHA 3LSJA 1IRFA 1BJTA 3GTMA 4B8XA 1R9TJ 3T02A 2HXIA 3CC2I 2ZJPF 1I27A 3BPVA 4YG2F 1ZBSA 2JSPA 5D4DA 2E1CA 1VQPI 3QAHA 1ZARA 1BI2A 2OZUA 4PSXA 1ONVA 1WHUA 3IWZA 3HOSA 3TTGA 1HBXG 2BHZA 2YU9K 3MN2A 3S8PA 4EQQA 5J47A 1P2FA 1IN7A 5E8IA 1BR4A 1MNEA 2KJCA 2A68A 1W0UA 2Y2ZA 5LRSA 1J9IA 5M3MJ 5EZHA 1O3RA 2NVYK 4A3MK 2F4IA 3MKLA 2L9RA 1O2FB 3LPXA 1K79A 4DYRA 5TMFA 4J3NA 1YO5C 3L00A 3U9GA 3KYLA 2BXZA 2DA1A 1HXDA 1X1BA 2A05A 4QTRA 3I4NC 2JRTA 1JTYA 4YFKA 3HOXJ 5C4JK 3CF2A 4GTEA 4FZBA 1JQWA 4WX9A 5IY5H 2HKXA 2NVYJ 3BR3A 5E17F 2X6OA 2OJED 4AUXA 2O03A 4JP0A 5M5XJ 4G7HF 1XDUA 2WB1N 3GLXA 2HDDA 2IS6A 2YU9C 3EDPA 2E34A 3PIPF 2XF7A 2KDOA 3R60A 4A2UA 4BLBA 2E36A 5J1UA 1FTZA 2NVYC 1N77A 3BG6A 3C2GA 3BWGA 9ANTA 4Y33A 3JAMZ 3FDYA 2LRDA 4IOAF 5GP9A 4ZYAA 4LLGF 3QRFF 3HXAA 1J5YA 4A3IC 2AXLA 4UB8C 1KA8A 2Q2EB 1VJEA 1I6VA 2R7DA 2FX0A 3DP7A 2KQRA 3H9GA 2DTRA 5HLHA 3GEIA 1W1WE 1BL0A 3B73A 3CESA 2ZJRF 1FYLA 4BBSJ 3JRFA 1YHQI 4MTEA 2GSNA 3IRRA 4XNFA 4QJVA 3CDIA 1IW7A 1O25A 3HJEA 4AM3A 2P81A 1RR8C 3W2WA 3VSLA 5JVTA 2O5RA 3GEEA 1SVMA 2X6YA 4AH6A 3BR1A 4Q5SA 4KB2A 2R92K 2R5ZA 4KICA 1UMQA 2F48A 3I53A 5IT9Z 2LR8A 1DUXC 1TWCC 5EEAA 5M5WK 2JUGA 1HW1A 2NVYA 1L0OC 3GTKK 1QZYA 3CTAA 3O3KA 1MDMB 2C6YA 1WCMC 1ZTRA 3M07A 4IPAA 3TKYA 4BBRC 2F5VA 4X6AJ 1WRJA 3PQKA 2CQQA 3CUOA 4RAGA 2H8RA 2VUMC 1S7EA 4BXUA 1I6XA 3DKYA 3CJQB 3QYBA 1R1TA 2NRAC 5D5XB 2VI6A 3JCUC 2YX4A 3LSGA 2PQ8A 2WY7Q 3I59A 2XAJA 3S2HK 1OCPA 1JVIA 3ASOH 4Q4ZF 2WADA 2A6HF 3E5QA 5EJCA 4QIWN 2VKVA 1VQ9I 4UUVA 2HQNA 4PJMA 3K7AJ 3DEWA 2M8EA 2P5LC 1A5JA 3N97A 4DYCA 3IPJA 4MFEA 1CF7B 1Z67A 1V5EA 1B4AA 1Z1DA 2H6CA 5LBQA 2K7LA 4CXFA 2H6BA 5C3EC 3GTQA 2VT3A 4FM9A 1Z0XA 1OCTC 3DQVC 2ADUA 2EJRA 2FOKA 1RRJA 3VA7A 1IV8A 4Z2YA 4G7OA 4OWRB 4GYGA 2OUMA 3S17J 3FHZA 2EIMH 5LGUA 2LKSA 2WAQA 3ADAC 3HOYC 1XGNA 3PO2J 4HDVA 2FF4A 4M6VA 2ELHA 4J01A 1IL2A 4A3KJ 3S1NJ 4YIIA 1BJAA 2JA8K 1FLIA 3HYIA 2IW5A 2NS7A 2W57A 5JR3A 3S17K 3P9KA 3PO3C 1N75A 2OBPA 1MMDA 3TBIA 4ZDPA 1TWAK 1F93A 2V6CA 2LF8A 3HOWK 2M34A 4ZH4A 3GTGA 2K9SA 3PSIA 3BG7A 3K4JA 4OIRF 2FBIA 3D0SA 1TWGJ 1MBKA 2P6TA 2XUBA 4IHVA 1I50J 1Z05A 4KASA 2QENA 4U87A 3K7AK 2Y30A 3FXLA 3JSPA 2HXOA 2IAIA 3GFJA 4ZJZA 2G7HA 2OTLI 1Q1VA 2BHYA 4II2A 4M9ZA 5AONA 3ZN1A 3OYLA 4DGWB 1V54H 4LGWA 2V9PA 5TJ3A 2PX9A 4KA4A 2A5WA 2DOEA 1LEAA 3DEUA 2CQKA 3MD2A 3OYBA 4P1WA 5F04A 1O3TA 3S1MK 2KMUA 3FMRA 1XC5A 3ESWB 4LIUA 3V8LA 2E2HJ 4X6AK 2A61A 2RNJA 3IRQA 2VASA 2QWWA 4AVPA 3FK7A 3S2DK 1IV6A 3HKZD 4H4KC 4QSHA 3A4CA 2LKPA 2Y0SD 1FWZA 1U2WA 4EGYA 3BZ6A 4C3IK 3GTLK 1JUMA 3BT9A 4I99C 3V42A 4L9VA 3S1QJ 1SFOA 1U5TA 1R1VA 2L7ZA 3GW2A 1Y0NA 1TNTA 1HF0A 4YRVA 4X0GA 3DBHB 5FD6A 1ON2A 2CW0F 1K83J 1C0WA 2V4JC 3K0LA 5D4SA 4BY7C 2KRHA 2WAFA 5BOXA 1UB9A 2KL4A 3R6SA 3K70D 2Y69H 3IP4B 3K70C 1I50A 1RKTA 3HUGB 3KEQA 2KIQA 2H27A 2Y0SN 1E0EA 2GAUA 2V7FA 3U1KA 5H2FC 1VQ7I 1ZYRF 2E19A 3I58A 1D0ZA 1TQIA 2DN0A 4ZZLA 2XCOA 1FYKA 1U8RA 2NVQC 2XF5A 1WCMK 4BBRK 4XLNA 3QPHA 2QGUA 4Y52J 1DQUA 3MAJA 3WTWC 3I4MJ 4Y7NJ 3GTKA 3DTIA 1LEBA 3OYGA 1PJ7A 5IYDK 2CMPA 2DDAA 5IP9C 2NOJB 2DDBA 4PJLA 3CCRI 2YPRA 5IP7J 5M3FK 2DYSH 2GIVA 2XKPA 3D1NI 1NK3P 5M5XK 3MKZA 4BE2A 2LH9A 2B63A 1BJZA 1I3QK 4GZYA 3DLLF 2BVMA 2JRMA 2DO7A 4LK1A 2DOAA 5B1BH 1UG0A 4HPQA 1XSDA 4A3LC 1TWCJ 1GXQA 1QNTA 2L5QA 2MH9A 1TWHA 1RKWA 2IGKA 3J80Z 4C2MK 4IL6C 2H94A 5HODA 3BZCA 3Q9SA 4F52A 5M3MK 1IE0A 4GTFA 1X58A 3JTHA 1TWGC 2LMDA 5J8FA 4KT6A 4EEFG 1SFOK 1Z7LA 3OS0A 1O4XA 3CDLA 1VF9A 4A3EC 3IKVA 2A69F 2P8TA 3K4LA 4FCYA 4HEA2 4KUMA 1R9TK 3WTZA 2VUMJ 1D1CA 3BR2A 2STTA 2KJBA 1DPUA 2VJJA 5CLSA 1HSJA 5FLXK 3ERED 2JPBA 1QBJA 4WJ3M 1OCZH 2D2WA 2QSFX 4LIVA 4M72A 4HNUA 4IHTA 3T8RA 1IXRC 3TDUC 1XX5A 5HLGA 2CW0A 4BXXC 1USMA 3ZQGA 1I39A 4I02A 5IOQA 3CP2A 1IUFA 2W1OA 1VNDA 3W2VA 4UY8I 3OR2C 2R7ZA 3ML6A 3AFHA 1IN5A 1V5FA 4HOBA 4CA0A 1YQAA 3KFWX 1Y39A 1ZH5A 2FOWA 2MGQA 3LQRA 2R7ZC 2I10A 4ETSA 2HVSA 2E2JJ 2YU3A 1HKTA 4PGHA 1G3WA 4LG0B 2QYOA 2W84A 3BCBA 1SFKA 2P5VA 2VJ4A 3NUHA 4E7HA 5F08A 2OA4A 3T5XA 3WTSC 3LSTA 2A6EF 2EBBA 2DA4A 1LUJB 2DQLA 2YX7A 4G0WA 3L4JA 2FBKA 3H0DA 5C44J 3IAM2 1JUPA 2VL8A 2XSJC 3E1SA 3K10A 4WF2A 3M4OJ 1UHSA 4JK1A 1XG1A 4OOIA 1MKMA 3U2RA 1J6XA 2WAQL 4BQOA 4CCKA 3WODA 4U7BA 3DF8A 3K2AA 4Y7NK 5E79C 3Q3QA 2IVMA 1PJ6A 2P5MA 3VYSB 5H6RA 4GTLA 4Y52K 3OYAA 3RDIA 2K85A 3K4CA 3QYFA 5EF6A 4ZDLA 3OREA 2X85A 3RPUD 2EV0A 1YJWI 5K5RA 4P9SA 1J09A 4CUGA 4IX7A 2XHKA 2QF7A 3E5UA 3C1DA 3LWFA 2NVQK 5L3GA 2XAQA 4PUSA 2PJRA 5IORA 4PDKA 3LNQA 3H36A 4W1UA 3COAC 2GM4A 3L2CA 1Y1VA 1S5LC 2EK5A 2ME0A 3LAJA 3WHCA 5IPAA 5KNLA 3CC7I 3GO5A 2X0LA 3M1EA 5CVIA 4XSZA 3V7CA 1J75A 5IP9K 4L0ZB 2LNBA 3GTKC 3PNVA 3SJMA 2CUFA 5AIQA 5FB2A 4WK8F 1R4NB 4V19K 1AOYA 4EJOA 4JX6A 5C44K 2HOAA 1T98A 2F4OB 1I6HJ 3K1NA 4LG0A 4CDGA 3ONQA 1MGTA 4HAMA 2FQTA 1JT6A 2W48A 3GZ6A 4HZFA 1DCPA 3L2UA 4E70A 1XZPB 4JYKA 2DJNA 2V79A 2VQLA 2OPTA 3A02A 2A5YB 1IDYA 4BQQA 2BZTA 3S3OA 4K2EA 5BMZA 2PPBA 1O29A
chains in the Genus database with same CATH topology
4PGGA 3RKYA 3KE2A 3J81K 2K4JA 5FFXA 5JVOA 1W5SA 2G9WA 2VOOA 1X3UA 2VBZA 2QUFA 2EFPA 5D5UB 2XVCA 2HEOA 2P7CB 2HWVA 4BHBA 5AIPA 2HS5A 2HZTA 3S2WA 1P4AA 1YIOA 1SMYF 3HRMA 4GTCA 3AQPA 3DKWA 1WCMA 2EA4A 1S29A 1GE9A 5K1YA 4CGZA 1TNSA 1FPQA 2W85A 4IF4A 5JHUA 3G4AA 2IT0A 2QQBA 5DYMA 4P9UA 3W6KB 2FNPA 2RN7A 1RIOH 2FA5A 5DCMA 3GTLA 2JA6A 3F8MA 4Y17A 1IN8A 1J2XA 1U5TC 3WGIA 4BH9A 2Z9OA 4G8XA 3P7NA 4UVBA 2GWRA 2WC2A 3H0GA 1OYYA 2W24A 2D45A 2VN2A 1XGOA 3EYIA 3EQLF 2WTEA 2XKOA 4HX4A 2M5WA 4AIJA 4HLYA 4LLNA 1G3SA 3LQQA 4N9HA 4HQEA 2NYXA 5E18F 1ZLJA 5KVRA 5CVUA 1FBSA 1ZG5A 3V8KA 1I1SA 4UVCA 5IOSA 2EA2A 2RQPA 3TO7A 2V1DA 5FLXZ 3DFGA 3QP6A 2NAZA 1SD6A 1EH7A 1HKQA 3E6CC 4KIBA 3F8FA 2ZNZA 5HS8A 2DAOA 3WE3A 2VXZA 3K1PA 1MZBA 4GO1A 5FD5A 1R5HA 4L0YB 4Y15A 1PP8F 4U0VA 1B6AA 2E7XA 3SFZA 2DU9A 3KZZA 2YSRA 2GXGA 2Z3YA 1MJAA 2O0YA 2XRNA 3IL2A 5DV5A 2O61A 1KU2A 2WV0A 3N0BA 2QZ8A 4RGSA 4CO8A 4UXNA 1CF7A 4EMSA 4HLXA 2P6SA 1J59A 3I0TA 1TLHB 2JT1A 1ZAOA 4ON0A 4YFNF 2K02A 5ILVA 3Q5FA 3ZMTA 1ZRDA 3RI4A 3KZYA 3W6JB 4MHGA 1SFXA 1ZGAA 3L7WA 4R1HA 1O27A 4EJVA 1S7OA 3SZTA 4RAYA 2JZYA 1SAXA 3H3ZA 5D5WB 3KETA 5BPDA 4HV5A 1O7FA 2JA7A 2RGRA 3HRSA 4KDPA 3ZPLA 1SD5A 1D3YA 1K78A 4XBFA 1R7JA 1MJ9A 3RPQA 1R1UA 2LF7A 4KM8A 2CGPA 1HKSA 3F8BA 4G6QA 1FBUA 1OMIA 1RUOA 1B9MA 1R58A 3BP8A 5HDNA 4LJZF 4BKWA 4C3JC 3JTGA 1R5GA 1EK8A 1LVAA 2VOPA 5EGEA 1YLFA 1FP1D 3FM3A 4UV8A 4G94A 2KKOA 3I59B 2ZXJA 4L9TA 4KMHA 2E7WA 3WGGA 4DNCA 5L3DA 4EVIA 4MQ9F 3RTRA 3ZMUA 3IC7A 2VT2A 2HR3A 3V7RA 5F1RA 5D5VB 1WQHA 1O3QA 1YW9A 1WKMA 5LGTA 1YFHA 3GFMA 3QP5A 3TDZC 2PHCB 1JHFA 1H0MA 1YW8A 3WG9A 1STZA 1IXCA 3TOAA 4BNCA 1BIBA 1BGWA 1XGMA 1HW2A 2Z99A 3KEOA 4KIFA 1W4MA 5E8GA 1R36A 4GFQA 1SD7A 2ZJ2A 4S05A 1G3YA 1K6OA 1FY7A 3F8CA 4HBLA 2FMYA 4Q5SF 4DDQA 4BHPA 3VB2A 3SZPA 2PN6A 4LK0F 3AH5A 2YU9A 4GTAA 2P4WA 2FQ3A 1BC8C 3LA2A 4YFKF 4LB6B 1OR7A 2J5PA 1T2KA 1LQ1A 4ZYGA 3P9IA 2DFIA 4I2OA 3FKIA 3BUEA 4WWCA 1U6GA 3MZHA 1TQPA 5LHHA 1L3LA 4OIPF 2ZMEB 3H92A 3TO9A 3LAPA 1H9GA 4KMUX 1KYWA 2L02A 2P5KA 1XXBA 4P55A 3M9AA 3NRVA 1NHAA 3ZQ7A 3N3YA 4LFUA 1Q1HA 2A07F 2QBYA 2F2EA 1R00A 4EJWA 2HYFA 4KATA 4M74A 3VEPA 2EWNA 3ZMVA 3NQOA 2VBXA 1FOKA 4EM2A 1IF1A 1IAWA 3WU0A 4BHCA 5TJJA 1ODDA 2X4HA 1I3QA 2IA0A 1Z7UA 1YG2A 4HV6A 4G9YA 1R9TA 1I5ZA 3GYHX 1FYMA 4H0EA 1TQMA 3KP4A 5D6EA 1MJBA 1WQ2A 1YW7A 4HX7A 4BLAA 2MLKA 2L3DA 1P4WA 2GQQA 5EEHA 4KN4X 3G73A 1U78A 1TWFA 5H6QA 1RUNA 3HIFA 1ZGJA 1Z6TA 1YS6A 4R8HA 3CAGA 2M45A 4IRGA 4M71A 1WIHA 3PQJA 4MEXF 4GXOA 5BQTA 3FMQA 2D1HA 2CG4A 5EEGA 1QPMA 2M87A 2UWMA 2ZFZA 3J80K 1O28A 1R22A 3KP2A 4GYIA 2IA1A 3ZMZA 2ZO4A 4MNUA 4KMFA 4HA8A 2R7FA 2IPQX 3TQNA 1AB4A 1QQIA 1EH6A 5FO5A 1ZRFA 1P4XA 3JSOA 5ICFA 4A6DA 4I98B 3ROUA 4G7ZF 4YFXF 3FOFA 5CVVA 1FSEA 2Y48A 3GTPA 1BOAA 5IT9K 1KQ8A 2OD5A 2DQRA 5ICEA 4I09A 3R4KA 3O6BB 2QM3A 4XLNF 3KP7A 3DXJF 1REPC 4N9IA 2MC3A 1DDNA 2MLGA 2GSOA 1IS1A 2Z5UA 2HTSA 3IWFA 3GZ5A 1IXSB 1KU9A 2LSOA 1KU3A 2QLZA 3GFIA 5E1ZB 2VUMA 1YYVA 1Z91A 4FX0A 4AD9A 3HRUA 1XXAA 1QO0D 2OU2A 1DD5A 1A04A 4ZH4F 3M8EA 4EJTA 1YTYA 1BBYA 3FWEA 3RYRA 3HTSB 1MD0A 1WQFA 3RKWA 2OZ6A 1XMAA 4ESJA 3NEUA 1BN5A 4WXHA 5DDGA 2ZNYA 2MH2A 2A68F 1Z9CA 2NS0A 1B59A 4ILDA 4P5AA 3I4PA 2ETHA 2ESNA 3O2PE 2CSOA 4HQMA 4A6EA 4I01A 2PMUA 1G4DA 3CO7C 3M7GA 2L4AA 2HTJA 4P96A 2J5OA 4M6XA 1UHWA 2DPDA 1XB4A 2GA1A 3ZN0A 3FXQA 2EFWA 2FMLA 5ED4A 3J7AO 4HYEA 3RKXA 1ISEA 1Y1WA 3RPUA 4RGUA 4L5JA 3JAMK 4FT8A 3BY6A 4CHUA 2QQ9A 1GHCA 3ABUA 2DLLA 1IZ1A 1O2AA 3FF5A 5E1WA 2WWYA 2H09A 3MQ0A 2XV4S 1USSA 4NQWA 3KLOA 4HX8A 3TO6A 4M9XA 3TOBA 1BI3A 3ELKA 5D4RA 3HRTA 1IUYA 1IN6A 2KRFA 4YIFA 1O26A 2A3SA 5LGNA 3F8NA 5HLIA 1HSTA 4ENJA 4ZYHA 4A5NA 2XIGA 5JFRA 3MCZA 2BE5F 3QPTA 4O6JA 3R0JA 4QLCU 3MZYA 1JXSA 1FNNA 4R79A 1D8KA 1ULYA 5L3EA 1XD7A 3IKTA 2JH3A 1BM9A 3HHHA 5HS9A 2O3FA 1S7AA 3E6MA 1B9NA 1W7PA 1WSUA 4G7OF 1W5TA 3JW4A 4U7DA 5IT3A 1KYZA 2ISYA 2G7UA 4G0VA 1OPCA 1YS7A 2DT5A 1LDJA 3OV8A 4LB5A 1FT9A 3C18A 1O57A 1KQ4A 3BOQA 1PUEE 3D5LA 3U1DA 2ISZA 4M6YA 4BQAA 1T38A 1WWXA 3ECHA 4UV9A 1ZVUA 5A2QK 1EH8A 1AWCA 3RJPA 1UFMA 4CYDA 3HUGA 2MBFA 4L5IA 4AIHA 4F7ZA 2HDCA 3M8FA 2YR2A 1HQCA 1U5TB 2B0LA 1XXCA 2JTVA 4XLPF 5D6FA 2O6GE 3I54A 3GX4X 4M73A 3BJAA 3E3VA 1K78B 3CLOA 4KT5C 5BPIA 3ZMSA 5HOOA 3ZP5A 4MQVA 5LRRA 4ZYEA 1XCBA 4OU0A 4GCVA 1O2BA 1E2XA 4GT9A 2BGCA 3F72A 4Y13A 3AQOA 2DBBA 3GVAA 1F4KA 1WI9A 2JSCA 4IXAA 3T0YA 1JHHA 4NB5A 3SHFA 3F3XA 4B09A 4OINF 4Q48A 2V1UA 3ECOA 1I1GA 4GTBA 2PJPA 4KAWX 3WTUC 4M1XA 4LLLA 3KLNA 5HS7A 1EV7A 1TWCA 4RAZA 3WTVC 5HDGA 4WCGA 2KIFA 3I71A 2DW4A 2KIUA 4LD5A 5F64A 4OIOF 2HYGD 2O8XA 3HOTA 1BC7C 5DCFA 4DQ2A 1BI0A 3ZMDA 1LDDA 3F21A 3LA3A 2NNNA 5JI6A 2UXXA 1O24A 3SQNA 5H20A 1P6RA 3FMSA 3E6BA 1ZG1A 2UZKA 3T1BA 3V8JA 4KARA 5ERIA 3G3ZA 3CQZA 1KU7A 3MMLB 2CFXA 4HDUA 4KYWA 3BJ6A 3F6OA 4HF2A 2PI0A 1V4RA 1XN7A 3E97A 4WXCA 1SFUA 3GTOA 5ICCA 4G0UA 4ESBA 4UVAA 4RGRA 4ASNA 2DPUA 3VOEA 3KP6A 3BDDA 4I0BA 4D0PA 2RKHA 1USTA 1KQ0A 1XCVA 1PP7U 3REOA 3K2ZA 1QZZA 2R92A 2Q2EA 4OMYA 3FXUA 1RZ4A 2RC4A 4PCQA 1LB2A 5CJ9A 1G6NA 4KC6A 2NVXA 2E2IA 4U0YA 3QOPA 2DI3A 1ZN2A 2AS5F 1OKRA 2VBYA 5LEJA 2F5CA 1TW3A 3BPXA 1SFEA 5CHPA 4PZJA 4C2MC 4KMDA 3T8TA 1PDNC 2Y3PA 1UHMA 5L3CA 1OYIA 2W25A 3LA7A 4A12A 1O7LA 5L3BA 2XCQA 2OQRA 3I5UA 4RB0A 1VTNC 3E5XA 1TTYA 4JQFA 3DPLC 2L4MA 2PMHA 3BJOA 2Z33A 5D8LB 2RGVA 1W7PB 4L9JA 1J0RA 4IJAA 3EYYA 1G3TA 3HHGA 4BAYA 2K4BA 2XAFA 5JFEA 3L4KA 4JBAA 4LK1F 5HVQC 2JPCA 2VE9A 1ZREA 1J7KA 4KFCA 2QQAA 2XAHA 1H9TA 3FM5A 3SXYA 4RB3C 2ZFWA 2OAZA 2PBIA 3RYPA 3K69A 1FC3A 3K1MA 5HDKA 4ZZDA 4CICA 4ESFA 1BI1A 2F5DA 1R23A 2XROA 2JA5A 2KIMA 3CDHA 5TRDA 2Y0MA 4LMYA 3HSRA 4KB4A 4UNOA 3GEZA 2VC0A 1P92A 3OPFA 5EGHA 1FSHA 2GSUA 1KQ9A 5DD4A 2FU4A 1JGSA 1IN4A 5DUIA 2RV8A 4ENNA 2CFAA 2PG4A 3WGHA 2STWA 2FSWA 1LEBA 2QVOA 2BYVE 1SMTA 3DPTA 4A5MA 4CZZA 4C3IC 4IVNA 4XSXF 1IRGA 1ZXOA 5IOTA 5DD8A 3QX3A 3HTUA 4HF0A 3R61A 3OOPA 3CUQA 2LDUA 2IP2A 2Q0OA 4QWQA 5CVJA 2OQGA 4LR2A 2RH6A 1ON1A 2FBHA 4AWXB 1UCRA 2FRHA 3IHUA 4P5OA 4XSZF 2FXAA 4I0AA 2IRFG 2MA3A 1S3JA 1FBQA 4L18B 1Y0UA 2CO5A 1ZHFA 3GFLA 2EV5A 1GXPA 1D8JA 2D1VA 3VFZA 2K27A 4MEYF 2EFOA 2M30A 3B02A 3QU3A 2L01A 4KDDA 1RNLA 4WXDA 3F6VA 4OMZA 3HSFA 5J8CA 1FZPB 2V9VA 1ZG3A 5CYVA 3KP3A 1K7AA 2RVCA 3R0AA 1FX7A 2V1XA 4M9SA 2IA2A 2FE3A 5ILUA 3J81Z 3EETA 3I64A 2MD5A 4EM1A 5LHGA 3MFKA 3F22A 1TW2A 3RIRA 3V4GA 1F1ZA 3GXOA 1B4BA 4BYYA 5LEKA 1XMKA 1S6LA 2CYYA 3WE2A 3OEPA 2XCRB 3GF2A 1K83A 4KNYA 2BBYA 3QU6A 3LFKA 5E20A 2VC1A 4KIGA 3G4CA 5D8KB 2VE8A 2R3SA 1B1BA 1OYWA 4N0BA 5LLQA 1F9NA 2F5FA 1HW5A 2R93A 5LHIA 2KWAA 2RDPA 1DPRA 3KP5A 5KK1A 3MWMA 2E2HA 2UXNA 4KMAA 3FOEA 3GTJA 5ILSA 1FP2A 2HGCA 1XSXA 5DEQA 2VONA 1SD4A 1W7PD 3FX3A 4P9FA 3E6DA 4IHSA 4FX4A 1IW7F 4IRIA 4HF1A 2CWEA 3DV8A 3FZVA 4FHTA 4UHTA 4EV0A 1DP7P 2ZCWA 2XAGA 3N0CA 2ACJA 3ISPA 4LQYA 4GGGA 3PFIA 3CJNA 3Q9VA 2M1BA 2TDXA 2GA2A 4MTDA 4OIQF 4Q47A 4U88A 3MEXA 3WODF 4I7HA 1RI7A 2XASA 2XGXA 2GZWA 2VODA 3BROA 5K5QA 5A2QZ 4JK1X 4ENMA 2Y75A 5F6FA 4P5BA 2K86A 1O3SA 5FGMA 3WTYC 2ZKZA 1T6SA 3FXRA 4HW0A 4RGXA 4S04A 4KN7X 5L3FA 4EGZA 1JE8A 2HKOA 1XSVA 4AIKA 1V3FA 1BIAA 2ZBKA 2DK5A 5ICGA 4A0YA 2EV6A 3K9TA 3P9CA 1U3EM 1T39A 4RS8A 1CGPA 2FEZA 2IJLA 1TWAA 4MGRA 1XDSA 2COMA 5J6XA 3CO6C 2HQRA 5CVRA 2EFNA 3C7JA 3WTXC 1Z6RA 1LJ9A 2GXBA 3EUHA 1KGSA 2EFQA 3KCCA 2ESHA 3VODA 3ULQB 5DCMB 3S0XA 3CUQC 3N4MA 2FNAA 2Q8KA 1LNWA 1D5VA 3GWZA 2P7VB 1GVJA 4G6DA 4IRHA 1MDMA 4RB1A 2L54A 1ZRCA 2EB7A 2QBYB 2PEXA 3V7SA 2VBWA 1TBXA 4GTDA 3L09A 1WQGA 3C3WA 2PFBA 1TWGA 1E17A 4TV7A 4XRFA 5K5OA 1XGSA 2BV6A 2ZMEA 5FFZA 4NHJA 1LDKB 2DK8A 3H3UA 3TGNA 5E1XA 4O5VA 3WTTC 4U0WA 3F23A 1F5TA 1S8NA 3WU1B 6PAXA 3HSEA 1EH1A 4EM0B 4KM9A 1QGPA 2E1NA 2PLYA 1T0FA 3CUQB 4ENKA 2BEOA 4EJUA 4L9NA 1ZLKA 4ZYDA 3L9FA 3ABTA 4RB2C 2HOEA 2NNYA 2F5EA 3AAFA 4A0ZA 3GUDA 2CFAB 5DUKA 4C3HC 5BS6A 4O3MA 4A0XA 2HFHA 1IRFA 1BJTA 3GTMA 4B8XA 1I27A 3BPVA 4YG2F 1ZBSA 2E1CA 3QAHA 1ZARA 1BI2A 2OZUA 1ONVA 3IWZA 3HOSA 1HBXG 4EQQA 1P2FA 1IN7A 5E8IA 2KJCA 5LRSA 1J9IA 1O3RA 3LPXA 1K79A 4J3NA 1YO5C 3L00A 3U9GA 1HXDA 2JRTA 4GTEA 4FZBA 4WX9A 2HKXA 5E17F 2O03A 4G7HF 1XDUA 3GLXA 3EDPA 3R60A 4A2UA 4BLBA 3BWGA 3JAMZ 4LLGF 3QRFF 1J5YA 2AXLA 1KA8A 2R7DA 3DP7A 2DTRA 5HLHA 3B73A 1FYLA 4MTEA 2GSNA 3IRRA 1O25A 5JVTA 4KB2A 4KICA 3I53A 5IT9Z 1DUXC 1HW1A 2NVYA 1L0OC