1F9NA

Crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
KGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords ARGININE REPRESSOR/ACTIVATOR PROTEIN
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f9nA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1f9nA02
1HW5A 1USTA 4EM1A 2EV6A 3W6JB 4AVPA 1K79A 2XKOA 2VBWA 4HAMA 1MKMA 2QZ8A 3JSPA 4QWQA 4YFNF 3RI4A 2JSCA 4R79A 1J5YA 5D5VB 2GQQA 2P5LC 2FQ3A 1H0MA 3FM3A 1REPC 5H20A 4HDUA 3K0LA 1ZG5A 2XV4S 3EETA 2BGCA 2STWA 1UFMA 3F3XA 3AAFA 1P4XA 1FNNA 3IC7A 2NS0A 2P5MA 2CO5A 1Z6TA 4KUMA 1S6LA 3L9FA 5DEQA 5KK1A 2M30A 4NQWA 4IRIA 1DUXC 4HV6A 3GFLA 1T39A 1R36A 1I1GA 1WQGA 2QLZA 3T0YA 1QNTA 2K02A 2PMHA 3NRVA 2VXZA 2HOEA 4R1HA 2FNAA 3GF2A 2DAOA 2ETHA 5A2QK 4EJWA 3ZQ7A 4OIPF 2FOKA 1D8JA 5F1RA 4U88A 4A5MA 1XCBA 2ZNYA 4P9FA 4PGGA 3LWFA 4DNCA 4UVAA 3DEUA 1XD7A 2VBZA 3H92A 1QQIA 2DQLA 4XRFA 3BOQA 2YU3A 3RKXA 1NHAA 3L2CA 3KFWX 5HOOA 1CF7A 2CG4A 2MLKA 1PP7U 1C0WA 2CGPA 3JW4A 1Z1DA 3ROUA 1W7PB 1EH1A 1E17A 1EH7A 5LBQA 3P9KA 2R3SA 1B6AA 3WTZA 1ON2A 3I58A 2H94A 5K5RA 2W57A 4GYIA 1DD5A 4KYWA 4RS8A 3Q5FA 3C3WA 1IAWA 4NHJA 4BXUA 4N9IA 1EH6A 1ZREA 3QX3A 2EV5A 3J7AO 3JSOA 1MGTA 2KKOA 1OYIA 1FP2A 1HKQA 1ZG1A 4OOIA 4D0PA 5HLGA 1JGSA 2BV6A 2FF4A 2ISZA 3VA7A 4XBFA 2W25A 4KDDA 2VOOA 3K1NA 4WWCA 4WXDA 2EFQA 2XGXA 4Y17A 1O7LA 4IHTA 1Y0UA 2DTRA 4CZZA 2IA2A 4IHSA 2HDCA 2DU9A 1SFUA 3I0TA 1T0FA 3L09A 4KN7X 2M8EA 1RZ4A 5L3CA 2XAHA 2VOPA 3MEXA 1SFEA 1YIOA 4H0EA 2KJCA 2RC4A 3FMQA 3ZMTA 2A6HF 3DFGA 4IXAA 5K5QA 4HLXA 3GEZA 1ODDA 4EJOA 2VODA 1D3YA 4G7ZF 1LEAA 1FPQA 1BJTA 1TLHB 2F5DA 2NAZA 3V4GA 2K4BA 2M45A 2XCRB 4CHUA 2H09A 3KP2A 3KP7A 5DUKA 5L3GA 2A69F 3IKTA 2QWWA 1JE8A 1B59A 4MEXF 3B02A 2HYFA 1MJAA 2RDPA 2CSOA 4LG0B 4M72A 3I59B 3HTSB 2FMLA 1ZLKA 1LB2A 1K78A 3ZMUA 4Y13A 4UVBA 2ESHA 2UWMA 4OINF 4XSZF 1ZHFA 1IN6A 4ENKA 1IRGA 1R23A 2KIFA 2VT2A 3M1EA 3OPFA 4MQ9F 3IRQA 1QGPA 1SD4A 1U2WA 3TO6A 2RKHA 3QU6A 4U7DA 3WTUC 2OD5A 2VN2A 3FOFA 2HR3A 3E6BA 2QQ9A 3I64A 2WTEA 3FMRA 1R1TA 5E1XA 2ADUA 5JVTA 1DP7P 1ZYRF 3MFKA 3F6OA 2ZBKA 2P4WA 5DYMA 3KLOA 5JFRA 1KQ0A 3ZP5A 2CWEA 1OMIA 3WE2A 4HDVA 5J8FA 3QP6A 2DQRA 1MZBA 1I6XA 3V7CA 2BBYA 2GAUA 4M74A 1G4DA 4O3MA 3E97A 3HSRA 4HZFA 3GO5A 4EVIA 3PFIA 4P96A 2WV0A 3KP3A 4AWXB 1EK8A 5H6QA 5L3DA 3CUQB 5ILSA 2A3SA 4ENMA 1BC7C 2P6TA 3KZZA 1P2FA 2V1UA 2Z33A 1FSEA 2O0YA 3LQQA 5AIPA 5HVQC 4B09A 3DP7A 1FX7A 1B1BA 3SQNA 3HSFA 4OMYA 1LEBA 2E7XA 3GYHX 1S7AA 3WGHA 3IKVA 1WQFA 3WU0A 3LSTA 4BHPA 2LF7A 3N97A 1BI2A 2FBIA 5LRSA 4TV7A 2O03A 4HF0A 5LHHA 2IT0A 2LNBA 3BROA 4RGUA 2COMA 1FC3A 2RVCA 4OMZA 3GLXA 2PBIA 3QU3A 5DD8A 4Q47A 5CVJA 3WTWC 4EJVA 4EMSA 4HBLA 4IF4A 3WTSC 1BI3A 2PLYA 3SZTA 3L4KA 1Q1HA 4OIQF 4HA8A 1KQ8A 2JPBA 3IWZA 3CLOA 5E18F 3U9GA 1B9MA 3KEQA 3RYRA 2IRFG 2DFIA 4UV8A 1ZRCA 3TO9A 1B4BA 5FGMA 2YSRA 4AIKA 1R22A 3D5LA 3FM5A 3FZVA 3QPTA 3H3ZA 3EUHA 1SMYF 3BJ6A 3TQNA 4BAYA 4G8XA 2A61A 2HQRA 4L5IA 1U5TB 3IWFA 2GIVA 3FXRA 4A6DA 4FM9A 2EA2A 4MEYF 2EK5A 4L9NA 4ENNA 1HXDA 2QENA 3WG9A 2LSOA 1F9NA 1YO5C 3ABUA 1IXRC 5HDKA 4XLPF 3Q9VA 3GX4X 4N9HA 1QZYA 3HRMA 2FA5A 3HSEA 1O3SA 1BGWA 3F21A 4IPAA 1RIOH 4LLGF 2ZJ2A 4RB2C 3R0AA 5FFXA 5LGNA 4CGZA 2HTJA 3RTRA 2H6CA 4PCQA 1S3JA 2FXAA 3VOEA 3FHZA 1YFHA 4XSXF 4UUVA 3I59A 3R4KA 5JHUA 2GZWA 2JT1A 3SZPA 3L7WA 1P92A 1G6NA 4GO1A 4A12A 3ZMDA 5E17F 4EJTA 2H27A 3ZMVA 3VEPA 4L5JA 1JXSA 4KA4A 1FP1D 3V8JA 2O8XA 1BI0A 2YPRA 4HW0A 1XDUA 1FOKA 2OZUA 2PI0A 3K1MA 3DV8A 1WQHA 2GWRA 4JK1X 1J59A 5HLHA 4WK8F 4MTDA 2W24A 2GXGA 1RUNA 3V8LA 5BS6A 4KMUX 2CFXA 1PUEE 2OQGA 2AS5F 3ZPLA 4ZYGA 2F5EA 2D2WA 3KETA 1UB9A 3EDPA 4MTEA 4YFXF 4KMFA 2M87A 4L0YB 1USSA 4RB1A 1KGSA 5J6XA 1AWCA 2ZMEB 4RAYA 4YFKF 5K5OA 1LQ1A 1WKMA 1OPCA 1R1VA 2V1XA 3OOPA 1SAXA 5D8KB 4I7HA 2XCQA 4Z2YA 5BOXA 4RB3C 3NUHA 3CTAA 2JRTA 3JAMK 4S05A 5DCMB 1Z9CA 4A6EA 2QM3A 2XRNA 4I98B 2FRHA 5HS7A 5CVUA 4ASNA 3WGGA 2HFHA 1YTYA 4GYGA 2EA4A 3L00A 2K27A 4ETSA 1YS6A 2V9VA 2Y48A 4KC6A 3WE3A 3JTGA 1U5TA 5ICEA 1ZG3A 1QO0D 2TDXA 2W84A 2QYOA 1WQ2A 2WWYA 4ON0A 3HOSA 2A07F 2PN6A 5EEGA 1HKSA 3WTVC 4M73A 4KN4X 4KDPA 5HS8A 4LB6B 4M9SA 3MQ0A 2L3DA 4ZZDA 3GFIA 1SD7A 3M9AA 1X3UA 2D45A 3O2PE 4AIHA 3ZMZA 2X4HA 3PQJA 2LF8A 1R5HA 4YIFA 3WODF 1IW7F 1B4AA 3DQVC 3TOBA 1HSJA 1L0OC 4KIGA 2Y3PA 3ZMSA 4EJUA 2NNYA 2VE9A 4HV5A 1XSXA 4EM0B 5LLQA 1XSVA 4UVCA 4G6QA 4ZH4F 1KU2A 1PP8F 1O7FA 1J9IA 2AXLA 1JHFA 4U7BA 1W7PA 1LDDA 4MQVA 2G9WA 2XAGA 3R6SA 1PDNC 1OKRA 2HWVA 1XXCA 1UHWA 5AONA 1W4MA 1O57A 2Q2EA 3E5QA 2XAFA 4K2EA 2Y0MA 3MAJA 3ERED 3I71A 4M9ZA 3BP8A 4M9XA 2QUFA 1IXCA 2XVCA 2HS5A 2V1DA 1ZGJA 1ZRFA 4HX7A 4OU0A 1TBXA 4ZYDA 1ZVUA 1P4WA 2NNNA 2D1HA 2OAZA 3KE2A 1H9TA 3OEPA 2CQKA 1R7JA 4ESJA 2PFBA 3P9IA 5DCMA 4A5NA 5D4SA 3I54A 1P6RA 5E20A 4YIIA 4A0ZA 3HIFA 1XCVA 5LGUA 2YR2A 5LHIA 5TRDA 2M1BA 4I02A 3N4MA 3HRUA 4N0BA 4ZYEA 4G7OF 2XROA 2K4JA 4O6JA 2DK5A 1ZH5A 1HW2A 2HZTA 4R8HA 2EWNA 2E7WA 2MA3A 4LB5A 5E8IA 1XXAA 4KB4A 2XASA 5A2QZ 3RDIA 3IRRA 1GXQA 5D5XB 3BZ6A 5D5UB 1FBUA 1DDNA 3R60A 2K86A 2GA2A 1CGPA 2J5OA 2IP2A 3KCCA 2EFOA 5HDGA 4PGHA 4HF2A 3P7NA 1HSTA 1S7OA 2UXXA 2Y75A 2RQPA 5FLXK 3HRSA 4RB0A 2MH9A 5CVVA 1IN8A 2MBFA 3CO7C 4AIJA 2WC2A 3ELKA 4KFCA 2FE3A 2VONA 3TDZC 4L0ZB 5DV5A 2EFPA 2H6BA 3GFJA 1B9NA 1OYYA 1QZZA 2UXNA 3K1PA 1MJBA 3KZYA 1XMKA 4NB5A 1MDMA 4B8XA 1YYVA 2GA1A 1IXSB 1JHHA 2IJLA 3KLNA 3QP5A 3F72A 2RNJA 1Z6RA 3F8NA 1O3QA 1RI7A 3J81Z 3BWGA 3R61A 4U0YA 2ACJA 2YX4A 2HGCA 3I5UA 2O3FA 1J0RA 2DI3A 4GGGA 2FBKA 1I5ZA 2FBHA 3T5XA 3MMLB 5AIQA 4KB2A 4ESBA 1IS1A 1BI1A 1ZN2A 5J8CA 3WTYC 3SXYA 2EJRA 3CJNA 4LG0A 4WXCA 2PG4A 1BJAA 3DPLC 3JTHA 2GXBA 2IA1A 2ZCWA 3COAC 2EFNA 5EEHA 1U78A 3LPXA 1YG2A 2Z5UA 2IPQX 4BYYA 3E6CC 2QBYA 3Q9SA 5IT9K 2XAQA 3CO6C 3LAJA 1R5GA 5CJ9A 2EB7A 1W5SA 4RGRA 3MCZA 5DUIA 4Q4ZF 1XXBA 4XLNF 5BMZA 1FLIA 4GFQA 4M71A 4UHTA 1YW9A 3ZN1A 1TTYA 3C7JA 2R7FA 5H6RA 4L18B 2XHKA 1FYMA 4UXNA 1GHCA 3FF5A 3R0JA 2A68F 3B73A 4IRGA 2DO7A 2V6CA 3C18A 2HQNA 3HOTA 3K69A 4LD5A 2W85A 2DK8A 1LVAA 1HBXG 1VTNC 3FWEA 4I0BA 1BM9A 2VC1A 3QPHA 1ZGAA 2FSWA 5HDNA 2YX7A 2V79A 2RGRA 5D6EA 2P6SA 5BPDA 2F5FA 3VFZA 1TW2A 2Z9OA 3D0SA 2HYGD 3KP6A 1FYKA 1ZRDA 3ECOA 3V7SA 3LA3A 1ZARA 1F1ZA 4P5OA 3EYYA 1KU3A 5E1WA 2J5PA 2HTSA 2DW4A 3G73A 4UV9A 1TW3A 2Q0OA 4E70A 2UZKA 4UNOA 5ED4A 4WF2A 4J3NA 4OIOF 3RKWA 4FT8A 2FNPA 1A04A 1LDKB 1KU7A 3L4JA 3BPVA 2R7DA 3GW2A 4RAZA 1BIBA 3J80K 1IN5A 3E6DA 4EM2A 5L3EA 3E3VA 4AD9A 4LLNA 2LKPA 1GVJA 3T8RA 3W6KB 3S2WA 3GWZA 5ILVA 4MGRA 1S29A 4KAWX 2RN7A 1HKTA 5FFZA 1AOYA 5BPIA 1T2KA 1F5TA 1CF7B 2NRAC 2VC0A 1SFXA 1U6GA 3I53A 3MZHA 3LA2A 3VODA 1E2XA 2OQRA 5ILUA 2P5VA 4DQ2A 2O6GE 2XIGA 2IA0A 3TO7A 3HYIA 2A5YB 1U8RA 2FU4A 2IW5A 5LRRA 1MDMB 2PJPA 1BOAA 3SFZA 3ZN0A 2QBYB 5JVOA 2M5WA 3RPUA 1FBQA 1I1SA 1YLFA 4RGXA 5CVRA 3O6BB 3DXJF 1ONVA 2OBPA 2OU2A 1K6OA 4LFUA 1QPMA 1WWXA 1R1UA 1LDJA 3LFKA 3HUGA 3U2RA 3J81K 5LEKA 1D8KA 1YS7A 2HEOA 1TQMA 4ZZLA 1I27A 1SD6A 2L54A 1G3YA 5ICFA 2P5KA 2MH2A 4IVNA 1BN5A 1K7AA 3FX3A 3KP5A 2ZMEA 3REOA 2FEZA 4IRHA 3TKYA 1TQPA 3EQLF 2L4AA 2X0LA 3ABTA 5D6FA 3FXUA 4HYEA 1QBJA 1ON1A 2BEOA 4G7HF 4JQFA 1KU9A 5FLXZ 2P7CB 4G6DA 3WU1B 2EFWA 5D5WB 1XGMA 3FOEA 4KT5C 4L9TA 3KEOA 4I0AA 1RNLA 4HOBA 5IT3A 1KA8A 4HX8A 3O3KA 4BNCA 5LHGA 2KJBA 6PAXA 3QAHA 1XGNA 1WI9A 2RGVA 1O3RA 4G0VA 1FT9A 3WTTC 3GUDA 2HKXA 1R58A 2PMUA 1HQCA 3K9TA 3T8TA 4KICA 4HLYA 1XB4A 5ICGA 1D5VA 1S8NA 2IVMA 4G0UA 2K7LA 1STZA 3GVAA 1G3TA 2OA4A 1YW7A 3ISPA 5L3BA 2VT3A 3E5UA 2VE8A 5CYVA 1KYZA 2DT5A 3F8FA 4MHGA 3M7GA 2PHCB 1TNTA 3T1BA 3NQOA 2F2EA 1OR7A 3F6VA 1EV7A 4CDGA 5DDGA 3TGNA 4LMYA 4MNUA 3DF8A 4LGWA 1T98A 1UHMA 4KIBA 2BYVE 3J80Z 2OZ6A 3HHGA 2BE5F 1F4KA 1XMAA 3P9CA 3DKWA 5L3FA 1FZPB 3PQKA 3RJPA 3BY6A 5HLIA 4LK1F 1G3WA 2EV0A 3C1DA 3F8BA 5D8LB 1ULYA 1HW1A 3RYPA 2P7VB 4L9VA 4ZYHA 3GFMA 3HRTA 1FSHA 4I01A 1T6SA 1XGSA 4EGZA 4CYDA 5FD6A 4O5VA 3BJOA 1FBSA 4A0XA 1K78B 3WGIA 3E5XA 4ESFA 3CUOA 3FMSA 3RKYA 3WTXC 1WRJA 3H3UA 3RIRA 2HKOA 4G94A 3DPTA 3EYIA 2XUBA 5DD4A 4BHCA 2KIMA 1DPUA 1U5TC 1FWZA 1GXPA 4OIRF 4DDQA 4LJZF 1XN7A 2RV8A 1IZ1A 2ZKZA 2ZO4A 2A6EF 1L3LA 2VBYA 3F8CA 4ENJA 2P8TA 2ISYA 5FB2A 1GE9A 1XSDA 3LAPA 3F23A 4U0VA 2ZFZA 4G0WA 2KWAA 3OV8A 1IUYA 2G7UA 3ML6A 2Q8KA 1W7PD 3IHUA 1XGOA 5IT9Z 3K2ZA 5F64A 2LDUA 1V4RA 5ICCA 3F22A 4FX0A 3NEUA 5K1YA 4GCVA 4Q5SF 3QOPA 2L4MA 2G7HA 1SD5A 1XDSA 4Y15A 2DBBA 4P55A 3V7RA 2MC3A 3JAMZ 4U0WA 2KIUA 2XCOA 4LLLA 4KIFA 4BQAA 1FY7A 2ZFWA 4HQEA 2JPCA 2DPUA 2CW0F 4I09A 3VB2A 1ZLJA 1KQ9A 1IN7A 5JI6A 3LQRA 4IJAA 5TJJA 5DCFA 2PEXA 1Z91A 1LJ9A 4A0YA 2DPDA 4KNYA 1R00A 4PZJA 1G3SA 2D1VA 2XAJA 1O3TA 5E8GA 2VBXA 5CLSA 4EQQA 1Z7UA 1BBYA 1IN4A 3GXOA 3SHFA 1KYWA 3CDHA 1MD0A 1U3EM 5E1ZB 1W5TA 2DLLA 2O61A 5LEJA 5KVRA 1T38A 2C6YA 4HF1A 2QQBA 1BIAA 1TQIA 1Z05A 2E1NA 3GZ5A 4HQMA 3CAGA 3CUQA 1YQAA 1TNSA 4P9UA 3BPXA 1LNWA 3ULQB 4WCGA 4S04A 3RPQA 4I2OA 4F7ZA 3GZ6A 1WSUA 5FO5A 2F5CA 5FD5A 2MLGA 2NYXA 3BDDA 2ELHA 4BH9A 2ZXJA 2STTA 4A2UA 1DPRA 3MZYA 5HS9A 3QRFF 1SMTA 3LA7A 1OYWA 2Z3YA 1ISEA 1J2XA 2PQ8A 4JBAA 4QLCU 5ERIA 2JTVA 3BUEA 3TDUC 1IRFA 4M6XA 3HHHA 4Q48A 5CVIA 4PDKA 3E6MA 1WIHA 2KRFA 3ECHA 4EGYA 3KP4A 4BHBA 4G9YA 2B0LA 1RUOA 2L01A 4EV0A 3TOAA 2XKPA 4GXOA 1BC8C 3OREA 3CUQC 4FHTA 4CO8A 3G3ZA 2L02A 4HX4A 2MD5A 3F8MA 2ZNZA 3V8KA 2ESNA 4CXFA 1YW8A 2Z99A 3BJAA 3M8FA 1AB4A 3MWMA 1J7KA 4FX4A 3HTUA 4WX9A 1EH8A 1H9GA 5D4RA 3M8EA 2QVOA 1P4AA 3U1DA 5JR3A 3FXQA 4WXHA 1UCRA 1ZAOA 4RGSA 4M6YA 4LK0F 5F6FA 1J75A 2JZYA 4L9JA 4CICA 2CYYA 3I4PA 5BQTA 5LGTA 4YG2F 3IL2A 2E1CA 2FMYA 1MJ9A 1IF1A 1FYLA 2QQAA 1V3FA
chains in the Genus database with same CATH superfamily
1HW5A 4ITVA 2K3PA 4G12A 4PJLA 1VLOA 1E3HA 1USTA 2AXTC 3C2GA 1NH3A 5F1JA 1OLTA 4EM1A 2X1EA 2EV6A 3W6JB 4AVPA 1K79A 1B8IA 4CZCA 2E2HA 2XKOA 1DGWY 4XK4A 2PPBA 2HDWA 2VBWA 1ETXA 4HAMA 4KMHA 1MKMA 2QZ8A 3JSPA 1OFCX 2EINH 2M0CA 4NOIA 2IAIA 4QWQA 3TFJA 4PABA 4YFNF 3M4OK 2VKVA 3RI4A 2JSCA 1YRNA 4R79A 2WA0A 1J5YA 4YG2A 3TEDA 5D5VB 2GQQA 2P5LC 1XC5A 2H1LA 2FQ3A 3FDYA 2KLOA 1H0MA 3FM3A 1REPC 4OIQA 5H20A 4HDUA 2L9NA 4QJVA 1UMQA 3K0LA 1ZG5A 4B1RA 2XV4S 4LK0A 3EETA 2BGCA 2STWA 1WVRA 1ZELA 2KZGA 1UFMA 1WJEA 3F3XA 4FE4A 3AAFA 1P4XA 1FNNA 2GOMA 3AQPA 3G71I 3OS0A 2JA7A 3IC7A 2NS7A 1Z21A 2NS0A 2P5MA 3CP2A 2CO5A 1Z6TA 4KUMA 4RM3A 2CQNA 2R7ZC 1S6LA 3L9FA 5DEQA 2M4KA 2E19A 3HJEA 1WJAA 4GFBA 4F52A 3BG3A 1I50C 5C4JK 1PJRA 2OTJI 5KK1A 3ZR8X 3S1NC 2RREA 1WCMK 2M30A 4NQWA 1I6HJ 3HPGA 2HPIA 2OTLI 2R7WA 4IRIA 1Y39A 3FISA 1DUXC 4N4NB 4HV6A 4PJ0C 3GFLA 4W1UA 4DIQA 1R36A 2V9KA 1T39A 2FQOA 3S1RC 3OYCA 4XLHA 1G51A 1OCOH 1I1GA 3S1QC 1WH5A 1WQGA 2QLZA 3CP8A 3ESWB 4C45A 3HPHA 3T0YA 1QNTA 2K02A 2PMHA 3GTMK 3NRVA 2HOSA 2VUMC 1I3QJ 2VXZA 2HOEA 4R1HA 4PAAA 2FNAA 4Y52C 3MN2A 3GF2A 2DAOA 2ETHA 5A2QK 3GTKA 4EJWA 2JMWA 2LOOA 3KIOA 3ZQ7A 4OIPF 1IE0A 1D1BA 2FOKA 2RH6A 1ZTRA 1D8JA 3ASNH 5F1RA 4U88A 5J4VA 4A5MA 1ETKA 1XCBA 1U9OA 2ZNYA 4P9FA 4PGGA 2R92J 5E3LA 3LWFA 4DNCA 4UVAA 3DEUA 1XD7A 2VBZA 3DBRB 3H92A 5IP7J 5FRMA 1QQIA 3PO3K 4XICA 3M4OJ 2DQLA 4XRFA 3BOQA 3M07A 2YU3A 5M5WJ 4WJ4A 3DTEA 3RKXA 1NHAA 3L2CA 2E35A 2LH9A 3KFWX 2VQCA 1UZCA 3AG1H 3MD2A 1O2FB 3CCQI 5HOOA 1K6YA 1JUMA 1CF7A 2CG4A 5B5EC 2MLKA 2WBMA 5HODA 5C44J 1PP7U 1C0WA 2CGPA 3JW4A 3EPZA 4JYKA 3HOUK 3LSJA 4ILDA 1Z1DA 2B63A 5K7ZA 3ROUA 4A3JK 1W7PB 1EH1A 1E17A 1Y8RB 2O5IA 1EH7A 2W1OA 1SFOK 4DJAA 5LBQA 3P9KA 2R3SA 1B6AA 4C3IC 5K7FA 3S0XA 3WTZA 3IH3A 4A3GJ 1V55H 3L2UA 1ITYA 3T01A 2JA8K 2X48A 4BS9A 4GRIA 3HOXC 2OPTA 2PMZD 1ON2A 3G4SI 3I58A 4WILA 2H94A 3LMMA 3RZOK 1JVIA 4IHWA 3S2DK 2QA4I 1WCMA 5K5RA 2MGQA 2W57A 3M4OC 4GYIA 5JVGF 1DD5A 4KYWA 3S14K 4RS8A 5HLTA 1BS2A 3Q5FA 3OIOA 3K2AA 4DZJA 1JKQC 3A8JA 2BVLA 3CC7I 1D1CA 3C3WA 4ZYAA 2R7SA 3S32A 1IAWA 4NHJA 4BXUA 4N9IA 1YI2I 2VIXA 2LVSA 1EH6A 4OIPA 2EPFA 3K4JA 1ZREA 1EFWA 3QX3A 5C4XC 2EIMH 3BTCA 5C3EJ 2EV5A 4BE0A 2LLKA 3JSOA 1MGTA 2KKOA 1OYIA 3J7AO 4A3CJ 3FKIK 1FP2A 2TRTA 4E7ZA 1HKQA 1ZG1A 4OOIA 4D0PA 5HLGA 1JGSA 2BV6A 1D5YA 2FF4A 3DPUA 2K9QA 2GLOA 2ISZA 3AL0B 3CF5F 1J98A 2R7ZK 4LLGA 4LK1A 3RZDC 4X6AJ 3VA7A 4D7NA 4XBFA 2W25A 4KDDA 2Z1DA 4UUTA 2VOOA 4Y52K 5B1AH 3PIPF 3K1NA 4WWCA 3BR6A 4WXDA 2Q1ZB 4CCLA 3KZIC 2EFQA 2K9SA 2XGXA 4Y17A 1O7LA 4IHTA 1Y0UA 2DTRA 1PUFB 2JWTA 4CZZA 2M4GA 2IA2A 4IHSA 4RA2A 3BCAA 2XGEA 2DN0A 2HDCA 3S93A 2DU9A 1SFUA 2JA6K 4XL9A 5C3EC 1JT6A 3OYJA 3I0TA 1T0FA 3L09A 3G4CA 4A3LK 1V5GA 4KN7X 2DOEA 3SZZA 1JUSA 2GSOA 2M8EA 3TP0A 4BKWA 4NQWB 2DYRH 4Q4ZA 3IUOA 1RZ4A 4EEFG 5L3CA 2WY8Q 4QIWD 1JJ8C 2DA4A 4XMYA 1T08B 2XAHA 3H3VK 4V2GA 5GAGJ 2VOPA 2E71A 3MEXA 1SFEA 1YIOA 4H0EA 2KJCA 1QZEA 1Y1VJ 2RC4A 2ICWG 3DEEA 2FQTA 3FMQA 3CQZK 3ZMTA 2A6HF 2ZB9A 3ZQHA 1F7VA 2CFAA 3G4AA 1DGRM 5IYDK 4NDLA 2CUFA 2R93C 2ZXHA 3DFGA 4IXAA 1F93A 4II2A 5KAFC 5K5QA 1R6RA 1I3QC 4HLXA 3GEZA 3HOYC 1H88C 1ODDA 4EJOA 1F43A 5IP9J 4FTHA 2VODA 4HNTA 5J47A 3BR0A 3H0GJ 1D3YA 1LEAA 1FPQA 4NC7A 4G7ZF 1N78A 1FOWA 2HNHA 2V4JC 4BJ5C 2ZSIB 2LRDA 1BJTA 3P5JA 4ABZA 1TLHB 4M3BA 1GDTA 3ZQFA 2F5DA 2NAZA 2K4BA 2M45A 3V4GA 2O5JA 2XCRB 3KP2A 2H09A 4CHUA 3S1MJ 3KP7A 2B63C 1MSFC 4X6AK 5DUKA 5L3GA 2A69F 2R7ZJ 3IKTA 3ZQQA 2EIJH 1VQMI 1AA7A 1ETWA 2QWWA 1NTCA 1JE8A 4GZYA 2KDZA 1B59A 4MEXF 3B02A 2F5VA 4BY7K 2HYFA 1HCRA 1MJAA 2RDPA 2CSOA 4F92B 3VYTB 4MFDA 4LG0B 4M72A 3I59B 3S17C 3NWTA 1R9TA 5K7HA 5GTIC 3HTSB 2NVUB 2FMLA 2L7KA 1LB2A 1ZLKA 1WSVA 3GTLA 1K78A 3KYDB 3WODA 1IBAA 2A6TA 4PSWA 3ZMUA 3S1QJ 2NVQK 1MH4A 4Y13A 4UVBA 1MMNA 4XR6A 3CCYA 5E3NA 2OCEA 5FKMA 1DQUA 2ESHA 5B3SH 1TWHK 5EG0A 2UWMA 4OINF 4XSZF 4KJZA 2DA1A 1PYVA 2KIQA 4Y7NJ 1ZHFA 2HVQA 5EF6A 1IN6A 4ENKA 3JREA 1QHHD 1IRGA 1MNEA 1R23A 2JA6J 3OYMA 1I50J 4YFNA 2KIFA 2VT2A 1XZPA 2BW3A 2X6WA 3M1EA 3OPFA 4MQ9F 3IRQA 1QGPA 3N0CA 4E7HA 4C3IK 2YS9A 1SD4A 3CCLI 4NNJA 3SEZA 1U2WA 3OR2C 4L5EA 3TO6A 2RKHA 3QU6A 4U7DA 3WTUC 2OD5A 2VN2A 2F4IA 3FOFA 2HR3A 3AD7C 3E6BA 3M8JA 2QQ9A 3H5RA 1TWFJ 3I64A 2WTEA 5L46A 3FMRA 4RLQA 4A3GC 1GLNA 3I9V2 1R1TA 2HU9A 1WJBA 1RRJA 3QQAA 5E1XA 4V2FA 3HC7A 1YX5A 2ADUA 1VQKI 5JVTA 1FTZA 1DP7P 1ZYRF 4E7LA 3TW7A 2Z16A 1K83K 1X4OA 2IEKA 1YE9A 3MFKA 3OYAA 1W0UA 3AG4H 3OIQA 3F6OA 4PK4A 2ZBKA 2P4WA 2RAEA 3GTQC 4A3FC 5DYMA 5C44C 4OINA 1EJ9A 1A36A 3KLOA 2MC4A 5JFRA 1KQ0A 3ZP5A 3BG6A 4UY8I 1APLC 1ZK8A 2OUMA 2CWEA 4A3KJ 1IDYA 4C2MC 2K5CA 1TC3C 3Q3SA 1OMIA 3WE2A 2R92K 4HDVA 4AH6A 5J8FA 3CCVI 3RQ4A 5TMCA 2WAEA 1QVTA 1DCOA 5E3OA 2JH3A 3QP6A 4AU7A 1YRNB 2DJNA 2DQRA 5FLVA 1R71A 1MZBA 5DM7F 1TWAC 3I4NK 2BZTA 1SEUA 1HDDC 1I6XA 4XOTA 1EF4A 3V7CA 2BBYA 5IYBK 2GAUA 2CW7A 4M74A 3HZJA 1G4DA 4O3MA 5C4JC 3BC8A 3E97A 3HSRA 4YEJA 3Q0WA 4HZFA 4CCKA 3GO5A 1WHUA 4EVIA 1SFOJ 1QPIA 3PFIA 4P96A 2JA6A 2WV0A 3KP3A 4AWXB 2E2HJ 1EK8A 2CFAB 5H6QA 3SJMA 1GT0C 5L3DA 3CUQB 1KQ4A 1P7IA 1ZKGA 5ILSA 4A93C 1HA8A 2A3SA 4ENMA 2R7XA 2W48A 4YELA 1BC7C 3BZKA 4G7ZA 2P6TA 2BXZA 2COBA 1P2FA 3KZZA 2Z33A 2V1UA 1FSEA 2VL8A 3A8KA 2O0YA 2QQ8A 3LQQA 1ZQ3P 1RKWA 2FX0A 5AIPA 5HVQC 5GPCA 1YHQI 1KZHA 2XAUA 4B09A 5M5WK 3DP7A 2XSDC 1FX7A 1B1BA 3SQNA 3HSFA 4OMYA 1LEBA 2E7XA 5IYBJ 4LITA 3A2KA 5TJ3A 3GYHX 3CCUI 1J6VA 3JRGA 4XSZA 3RCOA 4DYQA 4M6VA 1CQTA 1S7AA 3WGHA 3RZDK 4BEHA 3IKVA 1Y1WJ 1WH7A 4XKBA 4IKFA 3WU0A 1W0TA 2NVTJ 1WQFA 3LSTA 4BHPA 2LF7A 3GTOC 2R7OA 3N97A 5J40A 5E79C 1BI2A 2FBIA 3X2QH 5LRSA 3CMYA 1VQ8I 1LFPA 3GTKK 3HOWC 3HGGA 4TV7A 3T02A 4BY1K 2O03A 4HF0A 2XPWA 5LHHA 4A3KK 2IT0A 2L7ZA 2DXIA 2LNBA 3BROA 4RGUA 3L2VA 1YNNA 2M34A 3BTIA 2COMA 4HEA2 3H0GA 4BDYA 1FC3A 2RVCA 4I6ZA 4OMZA 4A3JC 3GLXA 2WB1A 2PBIA 3QU3A 4B43A 1VQLI 3DEWA 2L7MP 5DD8A 4Q47A 1MBEA 1MBGA 5CVJA 1X31C 3WTWC 4Q5SA 1Y6IA 3ADAC 4WJ3M 1WCMJ 3ZXSA 4EJVA 3W2AA 2LFBA 2QEXI 4EMSA 1HOMA 4HBLA 1S9HA 4IF4A 3WTSC 4CA0A 3IP4B 1BI3A 2Q2EB 3H5NA 5EG0B 2GSNA 2XPUA 2PLYA 1RR8C 2E2HC 3SZTA 3L4KA 1Q1HA 4C30A 1VFCA 4OIQF 4HA8A 3HOVJ 1E0EA 3M1CA 1KQ8A 2JPBA 3GTPA 4PJNA 3Q0VA 3IWZA 3S2DC 4CYCA 3CLOA 5E18F 3U9GA 2YU9J 1B9MA 2E2JC 1XS9A 3KEQA 3RYRA 4XCHA 5CQGA 2IRFG 2JA8C 2H8RA 3K70D 2CQQA 2LKSA 2DFIA 3OYLA 3OSFA 4UV8A 5IYBC 1ZRCA 3TO9A 5EGHA 1B4BA 5FGMA 2IS1A 3FXKA 2YSRA 4KMUA 4XLEA 2V7FA 4AIKA 1R22A 4A3EC 3D5LA 3K70C 3FM5A 4HSTA 3FZVA 3QPTA 1VRQC 3H3ZA 3A0HC 3EUHA 1SMYF 3KEYA 3BJ6A 2M9HA 4LG3A 3TQNA 4KARA 2VJIA 3OYGA 4BAYA 4G8XA 2A61A 2HQRA 3HL2A 3HOYJ 4L5IA 1U5TB 2AQFA 3IWFA 2GIVA 2VPLA 3FXRA 4A6DA 4FM9A 2E2IC 2CUJA 2EA2A 3GTLK 3OWTA 4MEYF 2EK5A 4CCJA 1S72I 4L9NA 4I76A 3H35A 4ENNA 1HXDA 2QENA 3WG9A 1YITI 1O27A 2R7VA 2LSOA 1X2MA 1R9TC 3S1MK 1F9NA 1ORKA 2MW8A 1ZR4A 1H89C 2JA7K 1YO5C 1I6VA 3LSKA 3ABUA 2RNGA 2O7OA 5HL8A 4QPOA 2PJRB 1IXRC 3BZCA 4BQNA 5HDKA 4XLPF 3Q9VA 4BXXK 3Q3QA 4ZDPA 3GX4X 2DMUA 4N9HA 3QODA 3BQYA 4P5AA 1QZYA 3N3YA 1JI8A 3HRMA 5FKNA 5GPAA 1B72B 2JA6C 3HEFA 2ZJPF 4BU2A 2FA5A 3HSEA 2W7NA 4A3MK 1JT0A 3CCMI 3QPLA 1O3SA 3BR2A 1BGWA 3F21A 2JN6A 4IPAA 1X3WB 3OY9A 1RIOH 3FHNA 1TWHC 4LLGF 2ZUFA 2ZJ2A 4RB2C 3R0AA 2OC6A 2X6XA 1ENHA 5FFXA 5LGNA 4CGZA 2HTJA 3RTRA 4M3FA 2H6CA 2GAHC 4PCQA 1S3JA 3QOEA 1YJ9I 2FXAA 3VOEA 3RSNA 3TBIA 2XGDA 3FHZA 1YFHA 4XSXF 4UUVA 3I59A 2NVYC 4A3BJ 4P9SA 3R4KA 1S7EA 3CCEI 5JHUA 5EEAA 1GUUA 2GZWA 2L9RA 1WSRA 3GTQA 2JT1A 3SZPA 3DU6A 3L7WA 1P92A 1G6NA 4GO1A 4A12A 3G1LA 1HLVA 4OAZA 2DODA 1UJ8A 3ZMDA 3UR3C 5E17F 4EJTA 3H9QA 2H27A 2CW0A 2QCOA 3ZMVA 3VEPA 2E5ZA 4L5JA 1TWGK 2M7AA 1JXSA 4KA4A 2Y0SD 1FP1D 3FBNB 3V8JA 5C4XJ 2O8XA 2KQRA 3BR3A 1BI0A 2YPRA 1JTXA 4HW0A 2TCTA 4B3AA 1XDUA 1FOKA 1JKPC 2OZUA 3GCMA 5EGEA 2D5VA 2PI0A 3HOZK 3K1MA 4CUGA 2R4GA 2V9PA 2R93J 2HXIA 1OCZH 3DV8A 1WQHA 4M3EA 2GWRA 2LTPA 2KRCA 4JK1X 1J59A 4KN7A 1WJCA 5IPAA 2KDOA 5HLHA 4WK8F 3PJRA 3ZQGA 4MTDA 1YX2A 4XONA 2ECBA 2W24A 2GXGA 5E3MA 4BXFA 3E7LA 1TWHA 1EI6A 3ZQCA 1RUNA 3HKZD 3V8LA 5BS6A 4KMUX 2CFXA 2NVQC 4A3CK 2JA7C 2Y0SN 3SEQA 1PUEE 3BG9A 5FLMJ 5IY5H 2OQGA 2AS5F 2MSYA 4ZYGA 3ZPLA 5FRNA 2F5EA 3DLLF 3A02A 4A3MJ 2D2WA 3KETA 2E1MC 2VJJA 1TL8A 1O26A 1WFXA 2ZMEC 1LKXA 1R4NB 2CS3A 2XGCA 1UB9A 1MBKA 2DDBA 4AC0A 3EDPA 2OJED 4MTEA 4YFXF 1IRXA 3D5SC 3AG3H 4KMFA 1VF9A 4IL6C 1K4SA 3VWBA 2M87A 3RQIA 1HDPA 4L0YB 1USSA 2Y0SA 2RQQA 4RB1A 4MFEA 1HC8A 1KGSA 3TMOA 1JQWA 3H9JA 5J6XA 1AWCA 2LY1A 1XX5A 4A3FK 2ZMEB 1WOOA 2XC7A 4F91B 5B1BH 2V6UA 1TT0A 2E1MB 4RAYA 4YFKF 2JVHA 1IW7A 5K5OA 2JA7J 3GIRA 5TMFA 1LQ1A 1WKMA 1OPCA 1R1VA 1U0JA 2V1XA 3OOPA 2R92C 1VJEA 3HM5A 3PL8A 5D8KB 4I7HA 1SAXA 2XCQA 4IZZA 2LC2A 4Z2YA 5BOXA 1PJ7A 4RB3C 1JOEA 3NUHA 4PJJA 4Y4RA 4XORA 3CTAA 2AHQA 2JRTA 3JAMK 4S05A 3ZQLA 1R4MB 5DCMB 1Z9CA 4RAFA 4A6EA 4BQQA 2ZSHB 2QM3A 2XRNA 4I98B 2FRHA 2MABA 5HS7A 2BHYA 2X6OA 5CVUA 3TL4X 3WGGA 4ASNA 2HFHA 3TTGA 1YTYA 4BY1J 2DJIA 4GYGA 2EA4A 3L00A 3OL4A 5IOTA 2OV7A 2K27A 4ETSA 3JRFA 1YS6A 2IGOA 2V9VA 1YCLA 2Y48A 4KC6A 3AL0C 3WE3A 3JTGA 1DU6A 1IUFA 4W97A 1ACIA 3H5AA 1U5TA 2GOXB 3GTPJ 1X2NA 3H1CA 2KRHA 4KN4A 5ICEA 1ZG3A 4KM9A 1QO0D 3GTPC 2TDXA 2W84A 2QYOA 1G2HA 1WQ2A 2BY2A 3ZCOA 2WWYA 4ON0A 1OR7C 2EQRA 4DYRA 5LD2C 3S15C 2W4SA 3HOSA 3N05A 2A07F 4MO7A 3CC4I 1JKRC 1O28A 2EZHA 1LFBA 1RKTA 2PN6A 5CHPA 3U21A 1IG7A 5EEGA 1HKSA 3CZ6A 1VGXA 3WTVC 2WY7Q 2E36A 4M73A 2R0QC 1XZQA 4KN4X 1WORA 4IX7A 3S16K 2IS2A 4KDPA 5EYRA 1RU0A 5HS8A 1QRYA 4LB6B 1E3OC 4GDFA 4B47A 3PO2K 1IV8A 2DMQA 4M9SA 3HGYA 3O8HA 4A3CC 3CMMA 3MQ0A 3MKYB 4AYBA 3S8PA 1USMA 2DYSH 2L3DA 3BTJA 4ZZDA 4DBRA 3OSGA 4DW6A 5GAHJ 2NVXJ 3GFIA 1SD7A 3HOWK 3M9AA 4A93K 1X3UA 3IH2A 2D45A 3H3VD 3K4NA 3O2PE 4AIHA 2HOTA 2EZLA 3ZMZA 2HOAA 4GTBA 4O2DA 2X4HA 3PQJA 1FIPA 1GV5A 3VSLA 2LF8A 1R5HA 3TFIA 4QTRA 3I4NJ 4YIFA 3HKZL 3D1NI 5EJCA 2DOAA 4XRSA 3WODF 4C3HC 1IW7F 2X6YA 1B4AA 3DQVC 3A03A 3TOBA 3OYEA 4BJTA 1HSJA 1L0OC 4OIRA 1FIAA 2LR8A 3LSIA 4KIGA 1WI3A 1N77A 3CC2I 2EBBA 2Y3PA 4QPQA 1ZGWA 3NWSA 1IQ0A 3DKYA 3ZMSA 4EJUA 1WZ2A 2NNYA 4YFXA 4OIOA 2VE9A 4HV5A 1XSXA 4EM0B 5LLQA 1XSVA 3MKLA 4UVCA 2NVXK 5HNHA 3KPHA 2DFEA 2K85A 4ZTFA 1BW5A 4G6QA 4ZH4F 1KU2A 1PP8F 4IQJA 1TWGA 1VI0A 1O7FA 1X1AA 3HB9A 1J9IA 2V1NA 3LSMA 3AG2H 3GEIA 2LG4A 2AXLA 1JHFA 3SYTA 3FK7A 3WG7H 5M3MJ 4U7BA 1TZLA 1TWFK 2IGMA 4DBQA 3PSFA 1W7PA 1UV7A 1LDDA 4MQVA 4IO9F 2G9WA 2L9SA 4Z6YA 4IHXA 2XAGA 3R6SA 1PDNC 1TP4A 4ZDOA 1PJ6A 4FZBA 4OWRB 2ZXWH 5FKLA 1MBJA 1OKRA 2HWVA 1XXCA 1UHWA 5AONA 4XN0A 3S1NJ 1W4MA 4KASA 1O57A 1I50K 2Q2EA 1R5ID 3S2HK 1OQYA 4DZPA 3E5QA 2XAFA 4K2EA 2Y0MA 4QJVB 3MAJA 4Y7NK 3GTPK 3ERED 2M0MA 4X1EA 2GAGC 3M3YC 2VXDA 3I71A 4C3JK 4M9ZA 3BP8A 5IYCC 4M9XA 3CQZA 5J1YA 2VKEA 2QUFA 3LNQA 3G6EI 1IXCA 2XVCA 2HS5A 2KL4A 1QHGA 4FQGA 1VH2A 2F6CA 4Y33A 2V1DA 1ZGJA 1ZRFA 2CUEA 3GDZA 4E7KA 4HX7A 4OU0A 2F4MB 2HYJA 1TBXA 4ZYDA 1ZVUA 1P4WA 3S17K 2NNNA 2ID6A 2D1HA 2EH3A 2OAZA 1RPWA 3KE2A 1H9TA 3OEPA 2CQKA 1R7JA 4UB6C 2IXSA 4AYBL 1POGA 1TWFA 4ESJA 2PFBA 3P9IA 1K83J 2D6FC 3G1OA 4RAGA 5DCMA 4A5NA 5IYCJ 4B44A 1Z3XA 3I54A 5D4SA 1P6RA 4BBSK 3B6CA 4AVZA 3W3CA 5J1RA 3PM1A 3ABMH 5E20A 1RETA 4YIIA 3H3VL 5F04A 4BLBA 4GTFA 1TWCA 5M3FJ 4A0ZA 3HIFA 5LFAA 1XCVA 4QSHA 9ANTA 3EQLA 5LGUA 4A3IJ 2YR2A 4FETA 5LHIA 4BBRJ 2ELKA 2KFDA 2M1BA 5TRDA 4I02A 3N4MA 3BG5A 3HRUA 4N0BA 4ZYEA 4G7OF 2XROA 2K4JA 1Y8QB 2OF7A 4O6JA 3I4MC 2DK5A 1ZH5A 1HW2A 3HOXJ 2V26A 2NVYJ 5DTDA 3L2QA 2HZTA 4R8HA 2BOLA 2Y69H 4H4KC 1AKHA 4HG2A 2EWNA 3K4CA 1V54H 5FLMK 2E7WA 3ABKH 2MA3A 1GVDA 3CQZJ 5FJ8K 4MLOA 1H8AC 1OISA 4LB5A 1Y1VK 5E8IA 2IS4A 2NS8A 1Y0NA 2VB6A 1XXAA 2XSJC 1J6XA 4LOWA 4KB4A 2XASA 5A2QZ 5F08A 1VQ5I 4GTEA 3CF2A 3RDIA 4BY7J 3IRRA 3OYHA 4IQ4A 1GXQA 1X1BA 2DFHA 3DBLB 2E2IJ 3PNYA 1O4XA 3OYNA 5D5XB 3C2HA 4E7JA 3BZ6A 3JRAA 4MEYA 5D5UB 1FBUA 1DDNA 1I39A 2P81A 3R60A 3CCSI 3H0DA 2K86A 1VQ6I 2GA2A 1CGPA 2J5OA 1ZYRA 2IP2A 4M3DA 2JA5J 3GTLC 3KCCA 1UG2A 3FK6A 3HOZC 2EFOA 3K6GA 3NAUA 5HDGA 3QWLA 1SMYA 3I3LA 2DA3A 4PGHA 3IH4A 1TWGJ 1BR2A 4HF2A 2Y0SL 5GP9A 3P7NA 2PA8L 1HSTA 1S7OA 2UXXA 2Y75A 2RQPA 5FLXK 1FTTA 3HRSA 2E5NA 4RB0A 2MH9A 3K7AJ 5CVVA 1IN8A 3HG9A 2MBFA 3CO7C 4AIJA 3OS1A 2WC2A 3ELKA 3ABLH 4KFCA 2FE3A 2VONA 3TDZC 4L0ZB 5DV5A 2EFPA 2H6BA 4Y52J 3GEEA 3GFJA 1B9NA 1OYYA 1SVLA 2DA6A 5GAEJ 3J7AY 2HQAA 1QZZA 1WPKA 2UXNA 3K1PA 1DCHA 1MJBA 3HDDA 2K9NA 3KZYA 5E68A 1XMKA 3JSTA 4NB5A 1MDMA 4N4OB 4B8XA 1YYVA 2GA1A 1IXSB 1WCMC 5JLWA 1JHHA 4BQOA 2IJLA 3KLNA 5F27A 3QP5A 2DDAA 1D0XA 1XZQB 3F72A 1VQPI 2QGUA 2EILH 3ERMA 4YRVA 3GTJJ 2M8GX 2RNJA 1W36C 3CD6I 1Z6RA 1FEXA 2HDDA 3F8NA 3TP3A 1OCTC 2VUMA 1O3QA 1ZXOA 1RI7A 2NVXA 3J81Z 3O8GA 3BWGA 1K61A 1FOYA 3R61A 2WAQL 2XB5A 4U0YA 1WJFA 3LL7A 5EGOB 2ACJA 2YX4A 4PJMA 3FXOA 2HGCA 3I5UA 2O3FA 1J0RA 2NVYK 3A01A 4HRIA 4BBRC 2E2JJ 2HI3A 2DI3A 3HOXK 4GGGA 2FBKA 3CJRB 4XLFA 4BBSC 3S2DJ 1SAUA 2I8DA 3S3NA 1I5ZA 2FBHA 2VQHA 4A3DC 2FUG2 3T5XA 2JK3A 3S2HJ 2DMPA 2VJ5A 5AIQA 3MMLB 4KB2A 1Z3YA 4ESBA 1IS1A 1X1PA 3S14C 4A3GK 1BI1A 1ZN2A 2HPMA 1VQ7I 3CJQB 1Y56A 2CMPA 5J8CA 3VYSB 3OYKA 3WTYC 5F0FA 3SXYA 3DXJA 2EJRA 1O29A 3VSKA 2O8KA 5JFEA 3CJNA 2W00A 4LG0A 5F0CA 3M3YK 4WXCA 2PG4A 1BJAA 3DPLC 3JTHA 4BBSJ 1TT5B 2GXBA 1F36A 4BL0B 2IA1A 1TWCJ 4F93B 2ZCWA 3COAC 2EFNA 5C44K 3IV5A 4BEHB 2AO9A 5EEHA 2EZKA 1ZBSA 2H1KA 1ZR2A 3L2RA 3K4MA 2LY9A 2BVMA 1U78A 1VQ4I 2R5ZB 2B63J 1IJWC 3LPXA 1YG2A 1TWGC 2Z5UA 1HF0A 1BJZA 1SFOC 3S1RK 3GZNB 2IPQX 4BYYA 3E6CC 2QBYA 2JA5C 1QVUA 3Q9SA 2NVYA 3GTOJ 4KMAA 3QYEA 3DBHB 2XAQA 5IT9K 2V6TA 3ZOBA 3LSPA 2X9DA 3CO6C 3LAJA 1R5GA 5CJ9A 2EB7A 1OCPA 1RR7A 1IO2A 1W5SA 5IP9C 3DLAA 4RGRA 4P1WA 3S15K 1AKHB 3H36A 3MCZA 1WJDA 1YJWI 5DUIA 4Q4ZF 2ZJRF 1XXBA 3K10A 3GTOA 2KISA 4XLNF 5BMZA 1FLIA 4GFQA 1EA3A 4M71A 1SVMA 4UHTA 1YW9A 3ZN1A 1TTYA 3C7JA 2R7FA 5H6RA 4L18B 2VUMK 2XHKA 4A93J 4F3QA 1FYMA 2KHMA 2JA5A 4UXNA 1GHCA 4C3JC 4JX4A 3FF5A 3R0JA 3VYRB 4ZDLA 4GTLA 4I99C 1ETYA 2A68F 3B73A 4KITB 4C2UA 4KM8A 4BUPA 1S5LC 5C4JJ 2A68A 2QKLB 4IRGA 2DO7A 4M3GA 5M5YK 2V6CA 5EZHA 3C18A 2HQNA 3MMYB 5KNLA 3HOTA 1WOSA 3K69A 4LD5A 4A3IC 3N0BA 2W85A 2DK8A 4II3A 1TWAJ 2PMZN 1LVAA 1HBXG 1VTNC 3FXJA 2CUZA 3EUHC 3HUGB 3PO3J 3FWEA 5IP7K 3A4CA 1R49A 1N75A 4XKVA 1K4TA 4RDUA 3E0JB 4I0BA 1BM9A 5H2FC 2VC1A 3QPHA 1ZGAA 1PVEA 3OL3A 1TWAA 2FSWA 5HDNA 2YX7A 2V79A 1K83C 5D6EA 2RGRA 2P6SA 5BPDA 3AD9C 4BE2A 4YIRX 2F5FA 1I3QA 4G7OA 3VFZA 1TW2A 2QSHX 2Z9OA 2WAQA 2HYGD 3D0SA 2L9VA 3KP6A 5IP6A 1FYKA 1ZRDA 1Y1VA 3ECOA 3V7SA 4AUXA 2CFOA 3IAS2 1Q1VA 3LA3A 1ZARA 1XPXA 1JGGA 1F1ZA 4P5OA 2K3FA 1FOXA 2IGKA 2MFZA 3J7YJ 4D5CA 1X19A 4BLAA 3ZQIA 3EYYA 2EBIA 5F0HA 1KU3A 1WJ5A 3A1YA 4XRSG 3OYDA 1TWFC 5E1WA 3LSRA 1A35A 3AQOA 2J5PA 2HTSA 3MVPA 2DW4A 4OAYA 2ME6A 3G73A 2E2HK 1I50A 4UV9A 2DCEA 1TW3A 2NOGA 1MMGA 2Q0OA 1I6HK 2WAQN 4E70A 2UZKA 1XPPA 2PJRA 4UNOA 1BR4A 5JLXA 5ED4A 4CCMA 2KT0A 5KAIC 4FE7A 4WF2A 5FROA 4J3NA 4OIOF 3RKWA 4IHYA 4FT8A 3I55I 2LREA 2FNPA 4HPQA 2I5UA 1XMXA 2QKMB 1W36D 1A04A 1LDKB 2MD0A 2A6EA 1KU7A 1LFUP 3JRIA 3L4JA 3BPVA 2R7DA 3GW2A 2R5YA 4RAZA 4ZTJA 1BIBA 3J80K 3BP8C 1IN5A 3E6DA 4EM2A 1R9TJ 1J6WA 5L3EA 4B4CA 3E3VA 4AD9A 4LLNA 2LKPA 2E60A 4RM2A 2VLAA 1GVJA 3T8RA 3W6KB 4QIWN 3S2WA 2B9SA 3GWZA 2DA7A 2XF6A 1ETOA 5ILVA 4MGRA 3TFHA 2G0EA 1S29A 2E2IA 4KAWX 1VNDA 2RN7A 4HSRA 2Y9ZA 1HKTA 4EATA 5FFZA 1MNMC 1AOYA 5BPIA 1T2KA 1HI9A 1F5TA 3V42A 1LPQA 1CF7B 3OS2A 2VC0A 3DKXA 2NRAC 1SFXA 1TWCK 4KATA 1U6GA 3OYFA 3I53A 3PUFA 3MZHA 4CYCB 3LA2A 3VODA 1E2XA 3GMEA 4HNUA 1F7UA 1L0WA 4C2MJ 4A3KC 3F9KA 2OQRA 5ILUA 2P5VA 1DU0A 1U9NA 3HKZN 2VASA 5DM6F 4DQ2A 3HXLA 2O6GE 3IAM2 2DOFA 2XIGA 3HOVC 2IA0A 1J09A 4JK1A 3TO7A 3HYIA 2NVXC 2A5YB 1EKEA 4A3MC 4A3DK 1RC9A 1ETVA 1LVKA 2WADA 2JA2A 1U8RA 1FMVA 3BP3A 2FU4A 2GBYA 5D4DA 4E7SA 3A01B 2WB1N 2IW5A 5LRRA 1MDMB 2PJPA 4FCYA 3S2HC 2NVQJ 1BOAA 3HKZA 4UUSB 2E1OA 3SFZA 2HQ5A 3ZN0A 5J4YA 2QBYB 5JVOA 2M5WA 3RPUA 3B6AA 3S1RJ 1FBQA 4AYBD 1I1SA 5TISC 4KISA 1YLFA 2WAFA 4RGXA 5CVRA 3O6BB 5CPRB 4BDZA 4J01A 4E7IA 2BHZA 2DMNA 4JX6A 2B63K 4X6AC 1WGXA 3BR5A 3DXJF 1ONVA 3UNGC 2OBPA 2OU2A 3OIPA 4D5FA 4LFUA 1K6OA 1IV6A 1QPMA 1WWXA 4J00A 1V5VA 5IORA 1R1UA 1EQRA 1DP3A 1LDJA 3LFKA 3NARA 3HUGA 3U2RA 3BR1A 3J81K 1P9QC 4IEJA 1U8BA 5LEKA 1D8KA 2JUCA 1YS7A 2NVTC 1TQMA 4ZZLA 2HEOA 4IHVA 3M3YJ 1JKOC 1I27A 3OMYA 4A3EK 2R92A 1SANA 2IBDA 1SD6A 2L54A 1G3YA 5ICFA 2R93A 1V5FA 1OCRH 2MH2A 2P5KA 2BY1A 4PSXA 4IVNA 1UELB 1BN5A 2EZIA 2WV1A 1K7AA 5IP9K 3FX3A 2IGNA 5GTHC 3FBIB 3KP5A 4BXXJ 2ZMEA 3F0CA 3REOA 3SZGA 2LP0A 2YUSA 1JUPA 2FEZA 2JA5K 4IRHA 3JRCA 1G8XA 3TKYA 1TQPA 1O24A 3EQLF 2A5WA 2MYSA 2L4AA 1YIJI 2X0LA 3L1PA 3ABTA 5D6FA 3FXUA 2XDVA 4HYEA 1QBJA 1ON1A 2BEOA 4XN3A 4G7HF 4JQFA 1KU9A 5FLXZ 1DCPA 2P7CB 4G6DA 3WU1B 1MMSA 2EFWA 4P5BA 2LBFA 2L7FP 3GTGC 3GTJK 4UB8C 5D5WB 2E34A 2IS6A 1XGMA 3FOEA 4KT5C 4L9TA 3WHBA 1BOBA 3KEOA 3PSIA 4BY1C 2H8WA 4I0AA 2L5QA 2X51A 2R5ZA 1RNLA 1UAAA 5FJ8J 1FJLA 4LOCA 4HOBA 5FKKA 5JHFA 3MKWB 5IT3A 3WU2C 1KA8A 3K4KA 4ZC3A 3L2WA 2ZJQF 2R7UA 3GTGJ 4HX8A 4XRMA 3O3KA 4BNCA 5LHGA 2KJBA 4XIDA 6PAXA 3CQZC 3QAHA 5IP7C 4BACA 2VQLA 1XGNA 2CH0A 1WI9A 2RGVA 2GXAA 4LJZA 1N25A 3GBGA 4DYCA 1O3RA 1FT9A 2CV2A 2FOWA 3PIOF 3CDIA 4G0VA 2ZC2A 3WTTC 4BBRK 3GUDA 2HKXA 4A3IK 1R58A 2PMUA 1HQCA 1Y1WK 3I4MJ 2GIZA 3K9TA 3T8TA 3W6VA 2XPVA 2R7ZA 2QSGX 3HOVK 4M1XA 4KICA 3MZ8A 2F4OB 4HLYA 1XB4A 5ICGA 1D5VA 3S3MA 2PX9A 3DU5A 1S8NA 5EDNA 2IVMA 4G0UA 2CU7A 4XQFA 2K7LA 3DTKA 1IC8A 2I10A 1STZA 2AQEA 2QF7A 3GVAA 2VKDA 1G3TA 1MMDA 1D1AA 2VQGA 2ZUEA 1MMAA 2OA4A 2E2IK 1YW7A 3ISPA 5L3BA 4XLNA 5FKOA 2HXOA 1NG6A 4XKWA 1I6HC 2CQ7A 2X85A 2VT3A 3VDXA 2CW8A 1XG1A 3E5UA 4ZH4A 4Y7NC 2BY0A 2VE8A 5CYVA 1KYZA 2DT5A 2DA5A 3F8FA 3GTKJ 3LSGA 3OYIA 1BR1A 4MHGA 3M7GA 3CMEI 1QA6A 1TNTA 2PHCB 3JCUC 2DFFA 3T1BA 3NQOA 2F2EA 2F48A 1T95A 1OR7A 2NVTK 4BXXC 3F6VA 2A69A 4CCNA 1EV7A 3RZDJ 1YOVB 4CDGA 4J19A 5DDGA 3TGNA 4RMFA 3GTJA 4LMYA 2ME0A 3QYBA 4MNUA 4KT6A 1XZPB 3DF8A 2PMZA 4LGWA 1LE8B 3S1NK 1T98A 3I56I 1UHMA 4LIVA 4LR2A 2YU9K 4KIBA 2BYVE 2ID3A 3J80Z 2LKXA 2OZ6A 3IPJA 3GTKC 3HHGA 2JSPA 2BE5F 3CCJI 1F4KA 1XMAA 3OOUA 3DKWA 3P9CA 4MIMA 3GLLA 4A3JJ 2BE5A 3C2BA 4BKXA 1AHDP 5M3MK 2PA8D 3A8IA 5L3FA 1MBFA 1FZPB 1MIJA 1OCCH 3PQKA 3RJPA 3GTGA 2L0KA 3BY6A 5HLIA 2Y9YA 4LK1F 1W1WE 4XSXA 2JQ7A 3PO3C 5BNGA 1G3WA 1INNA 1ERDA 2JRMA 3C1DA 2EV0A 4CH7A 1NG7A 3F8BA 5D8LB 4C9YA 1YNJA 4FASD 3ZGKA 1ULYA 4IOAF 1HW1A 4G6TB 1MH3A 4NC6A 4V19K 1KONA 3RYPA 2P7VB 5KCMA 2R5YB 2LD5A 4MQ9A 4L9VA 4GTDA 3GTQK 4ZYHA 3GFMA 3HRTA 5GADJ 3QYFA 1D0ZA 2HVSA 1FSHA 4I01A 5FLMC 1T6SA 1T56A 3PUBA 1UG0A 1T0FC 1XGSA 2Y30A 4CYDA 4EGZA 2M3AA 2XB0X 3PFYA 4C3JJ 3AD8C 5IOZA 3AKZA 5FD6A 3G1MA 2Z2SB 3BJOA 4O5VA 4LQYA 2XF5A 2XRLA 3KYCB 5CQEA 1Y1VC 1VZ0A 3DTIA 1FBSA 1I3QK 4B48A 4A0XA 2ZFUA 2DA2A 2JUGA 1K78B 3GTMJ 3UKGA 3WGIA 3E5XA 4D1QA 4ESFA 3EUAA 2KP6A 3CUOA 3FMSA 4AIDA 1TWAK 3I4NC 3RKYA 3WTXC 1WRJA 3CESA 4XKCA 5M5YJ 1ETQA 1MNDA 2R7QA 2FJ1A 3H3UA 3JR9A 3K4LA 3RIRA 2R7RA 3PO2J 2N8GA 1BA5A 1T33A 2HKOA 4G94A 3LOCA 2HZDA 3DPTA 1PJ5A 3EYIA 2XUBA 2MG4A 2BW3B 2KZVA 5DD4A 4BHCA 2KIMA 1DPUA 2OCCH 4CSWA 1U5TC 1FWZA 1GXPA 2DMTA 4OIRF 4DDQA 4LJZF 1MW7A 1XN7A 1MSEC 2WB1D 2V6EA 2VUMJ 3FXMA 5TGTA 1A6IA 2RV8A 1IZ1A 4E6KG 2CRGA 1X4PA 2ZKZA 2ZO4A 4BE1A 2A6EF 1OJLA 1L3LA 2VBYA 3ASOH 3F8CA 3JRBA 4ENJA 2P8TA 2ISYA 3S15J 3VYUB 5FB2A 1NK3P 2KPMA 5IOQA 4CCOA 1GE9A 1XSDA 4A3BC 2FD5A 4XNFA 3LAPA 2O9LA 3F23A 4U0VA 2ZFZA 3OYBA 3GTQJ 4G0WA 4AYBN 4UUSA 2KWAA 3OV8A 4GTAA 1IUYA 3S16C 2G7UA 3GTOK 4JP0A 3ML6A 4PUSA 1D0YA 2Q8KA 1Z0XA 3AH5A 1W7PD 3IHUA 1XGOA 2A05A 5IT9Z 4B3XA 3HOUC 1VQOI 4KMDA 1MBHA 3K2ZA 2LDUA 1V4RA 5F64A 3HOWJ 1HQMA 3GEHA 2ELJA 4ANJA 5ICCA 1A31A 3F22A 4FX0A 3CLQA 2BY3A 1XTAA 2JJ7A 3NEUA 5K1YA 4GCVA 4Q5SF 1G59A 2WB1L 3QOPA 1Z77A 2CV1A 2L4MA 2G7HA 1SFOA 1SD5A 1XDSA 4Y15A 3FKJA 3ZRGA 5M5XK 1UHSA 2DBBA 5J3LA 3S16J 5DS9A 1O2BA 4MEXA 4XOPA 4P55A 3V7RA 2CV0A 3CJTB 2MC3A 3JAMZ 4U0WA 3U1KA 2KIUA 3GTJC 3I4MK 4C3IJ 4AM3A 2XCOA 4LLLA 2NXNB 4KIFA 3OR1C 5EZGA 3SDGA 3MKZA 4BQAA 3G2BA 1FY7A 2ZFWA 4HQEA 2JPCA 3Q0UA 2DPUA 4XLAA 5B66C 3K4BA 1IDZA 1VQ9I 2CW0F 3ONQA 1TWHJ 4I09A 3FKIA 3DWLE 2E2JK 3VB2A 1V5EA 1ZLJA 1KQ9A 1IN7A 1JTYA 5JI6A 1IGNA 2LK2A 3LQRA 4IJAA 3S1QK 3AFHA 3FKIC 1X3ZB 3E1SA 5TJJA 5DCFA 2PEXA 1Z91A 1LJ9A 4A0YA 2XF7A 3JRHA 2DPDA 4KNYA 1R00A 4PZJA 1B72A 1G3SA 3PO2C 2DTZA 4YFKA 4NC8A 2D1VA 2XAJA 4U87A 1O3TA 1B8IB 1USOA 2VKHA 4QIWL 5E8GA 2R93K 2VBXA 4LIUA 3HOZJ 1X1CA 5CLSA 2R7TA 2A6HA 4EQQA 1FMWA 3GSIA 1Z7UA 3DCFA 1BBYA 3WHCA 1IN4A 3BLYA 3GXOA 2P0WA 1ZQ1C 3SHFA 1KYWA 3CDHA 3SDBA 1MD0A 3VPRA 1U3EM 3A0BC 5E1ZB 1TWCC 1W5TA 2DLLA 2O61A 1P7JA 4A3LJ 4A69C 5LEJA 2ECCA 3LFUA 4JX5A 4A3FJ 4NUBA 5KVRA 1K83A 1T38A 2C6YA 4HF1A 1A5JA 3K7AK 3BQZA 2GM4A 3KX2A 2QQBA 3H0GK 2CJJA 1BIAA 1TQIA 1Z05A 2E1NA 3GZ5A 4FISA 4HQMA 4D7MA 2M7BA 2UUZA 3W2WA 4Y3OA 3BG7A 4NBQA 3CAGA 4XLPA 3S3OA 3CUQA 3HBLA 1GV2A 4A3EJ 1YQAA 1TNSA 4P9UA 3BPXA 2HVRA 1W5CC 1LNWA 2X1CA 3ULQB 4S04A 4WCGA 3RPQA 5IYDJ 4I2OA 4F7ZA 5KHDA 1BW6A 3GZ6A 2VPRA 1AU7A 1JJ6C 3GTGK 1WSUA 1Z67A 1QU3A 3BTLA 3D5RC 4C3HJ 2K40A 5FO5A 2F5CA 4BGDA 5FD5A 4GTCA 2MLGA 2NYXA 3BDDA 3TW6A 3FKIJ 2ZXIA 2ELHA 3FIWA 5C3EK 2YU9C 3GTMA 3T00A 4C3HK 4BH9A 4IOCF 1LUJB 2ZXJA 2STTA 3LSHA 2LBFB 4A2UA 5J1UA 1DPRA 3MZYA 5HS9A 3QRFF 1SMTA 3LA7A 1OYWA 4RLFA 2Z3YA 1O25A 3CCRI 1IL2A 1ISEA 2NOJB 1J2XA 2PQ8A 1Z7LA 3S14J 4JBAA 4XLCA 4QLCU 1X58A 2CQXA 2JTVA 2X1DA 4XM3A 5ERIA 3TDUC 4ZJZA 3BUEA 1T8IA 1M1EB 1IRFA 2LMDA 4BJ6C 4M6XA 4F55A 1Y1WA 4D9JA 3CMAI 2K9LA 4A3DJ 5IOYA 2FQ4A 2PMZL 3HHHA 5C4XK 4Q48A 5CVIA 2V6SA 3BT9A 1X1DA 1YX3A 2VJ4A 4PDKA 3E6MA 1WIHA 2KRFA 3HXAA 3J7ZI 4RBOA 3ECHA 4EGYA 3KP4A 1PUFA 2JVGA 4BHBA 4G9YA 4DGWB 2B0LA 5M3FK 4DOZA 1RUOA 4C2MK 4JOMA 1BL0A 5IYDC 1VQNI 4HNVA 2L01A 4EV0A 1BDFA 3TOAA 2XKPA 4GXOA 3H9GA 3PNVA 1BC8C 3OREA 3CUQC 4X0GA 4FHTA 1NK2P 3QPSA 2Y31A 4CO8A 3GTLJ 3HOUJ 5IYCK 3G3ZA 2L02A 1O2AA 4HX4A 3JRDA 1RESA 2MD5A 3F8MA 2ZNZA 3V8KA 1Y1WC 4A3BK 2DT6A 2ESNA 3HOYK 1YJNI 1YW8A 2Z99A 3BJAA 4CXFA 5EGOA 3M8FA 2Y2ZA 3RZOC 1AB4A 2GSUA 3MWMA 1E3PA 1I3AA 3FXLA 3SFIA 3PNTA 1SC7A 3S17J 4BY7C 1J7KA 2WAQD 4A3LC 4FX4A 5IOSA 3HTUA 5CKTA 4WX9A 1EH8A 1H9GA 5D4RA 2B7EA 2LYCA 3M8EA 3W2VA 2QVOA 1P4AA 3U1DA 4S0HB 3K7AC 2YU9A 3EUKL 5JR3A 3GTMC 3CDLA 2VI6A 2W7VA 3FXQA 3BCBA 4WXHA 1UCRA 1ZAOA 4PFPA 4RGSA 2UV1A 2EIKH 1A6QA 4M6YA 1R9TK 4C2TA 4G7HA 3S1MC 2O5RA 2QSFX 4LK0F 5F6FA 1J75A 1IRZA 2JZYA 1SVOA 4L9JA 4CICA 5HNFA 2CYYA 3I4PA 3RZOJ 2LY2A 5BQTA 4GT9A 2W82A 5LGTA 4RMNA 3RPUD 4E4HA 4YG2F 3IL2A 2E1CA 2JA8J 3SZYA 3RKQA 1MJ9A 2DT7B 2FMYA 1WOPA 3H0GC 2BXYA 1SFKA 5M5XJ 1IF1A 1C0AA 2K9MA 1LE8A 2M2EA 3KYLA 1FYLA 2QQAA 4PFOA 2L2OA 2KMUA 1V3FA
chains in the Genus database with same CATH topology
1HW5A 1USTA 4EM1A 2EV6A 3W6JB 4AVPA 1K79A 2E2HA 2XKOA 2VBWA 4HAMA 4KMHA 1MKMA 2QZ8A 3JSPA 4QWQA 4YFNF 3RI4A 2JSCA 4R79A 1J5YA 5D5VB 2GQQA 2P5LC 2FQ3A 1H0MA 3FM3A 1REPC 5H20A 4HDUA 3K0LA 1ZG5A 2XV4S 3EETA 2BGCA 2STWA 1UFMA 3F3XA 3AAFA 1P4XA 1FNNA 3AQPA 2JA7A 3IC7A 2NS0A 2P5MA 2CO5A 1Z6TA 4KUMA 1S6LA 3L9FA 5DEQA 5KK1A 2M30A 4NQWA 4IRIA 1DUXC 4HV6A 3GFLA 1T39A 1R36A 1I1GA 1WQGA 2QLZA 3T0YA 1QNTA 2K02A 2PMHA 3NRVA 2VXZA 2HOEA 4R1HA 2FNAA 3GF2A 2DAOA 2ETHA 5A2QK 3GTKA 4EJWA 3ZQ7A 4OIPF 2FOKA 2RH6A 1D8JA 5F1RA 4U88A 4A5MA 1XCBA 2ZNYA 4P9FA 4PGGA 3LWFA 4DNCA 4UVAA 3DEUA 1XD7A 2VBZA 3H92A 1QQIA 2DQLA 4XRFA 3BOQA 2YU3A 3RKXA 1NHAA 3L2CA 3KFWX 5HOOA 1CF7A 2CG4A 2MLKA 1PP7U 1C0WA 2CGPA 3JW4A 4ILDA 1Z1DA 2B63A 3ROUA 1W7PB 1EH1A 1E17A 1EH7A 5LBQA 3P9KA 2R3SA 1B6AA 4C3IC 3S0XA 3WTZA 1ON2A 3I58A 2H94A 1WCMA 5K5RA 2W57A 4GYIA 1DD5A 4KYWA 4RS8A 3Q5FA 3C3WA 1IAWA 4NHJA 4BXUA 4N9IA 1EH6A 1ZREA 3QX3A 2EV5A 3J7AO 3JSOA 1MGTA 2KKOA 1OYIA 1FP2A 1HKQA 1ZG1A 4OOIA 4D0PA 5HLGA 1JGSA 2BV6A 2FF4A 2ISZA 3VA7A 4XBFA 2W25A 4KDDA 2VOOA 3K1NA 4WWCA 4WXDA 2EFQA 2XGXA 4Y17A 1O7LA 4IHTA 1Y0UA 2DTRA 4CZZA 2IA2A 4IHSA 2HDCA 2DU9A 1SFUA 3I0TA 1T0FA 3L09A 3G4CA 4KN7X 2GSOA 2M8EA 4BKWA 1RZ4A 5L3CA 2XAHA 2VOPA 3MEXA 1SFEA 1YIOA 4H0EA 2KJCA 2RC4A 3FMQA 3ZMTA 2A6HF 2CFAA 3G4AA 3DFGA 4IXAA 5K5QA 4HLXA 3GEZA 1ODDA 4EJOA 2VODA 1D3YA 4G7ZF 1LEAA 1FPQA 1BJTA 1TLHB 2F5DA 2NAZA 3V4GA 2K4BA 2M45A 2XCRB 4CHUA 2H09A 3KP2A 3KP7A 5DUKA 5L3GA 2A69F 3IKTA 2QWWA 1JE8A 1B59A 4MEXF 3B02A 2HYFA 1MJAA 2RDPA 2CSOA 4LG0B 4M72A 3I59B 1R9TA 3HTSB 2FMLA 1ZLKA 1LB2A 3GTLA 1K78A 3ZMUA 4Y13A 4UVBA 2ESHA 2UWMA 4OINF 4XSZF 1ZHFA 1IN6A 4ENKA 1IRGA 1R23A 2KIFA 2VT2A 3M1EA 3OPFA 4MQ9F 3IRQA 1QGPA 3N0CA 1SD4A 1U2WA 3TO6A 2RKHA 3QU6A 4U7DA 3WTUC 2OD5A 2VN2A 3FOFA 2HR3A 3E6BA 2QQ9A 3I64A 2WTEA 3FMRA 1R1TA 5E1XA 2ADUA 5JVTA 1DP7P 1ZYRF 3MFKA 3F6OA 2ZBKA 2P4WA 5DYMA 3KLOA 5JFRA 1KQ0A 3ZP5A 2CWEA 4C2MC 1OMIA 3WE2A 4HDVA 5J8FA 2JH3A 3QP6A 2DQRA 1MZBA 1I6XA 3V7CA 2BBYA 2GAUA 4M74A 1G4DA 4O3MA 3E97A 3HSRA 4HZFA 3GO5A 4EVIA 3PFIA 4P96A 2JA6A 2WV0A 3KP3A 4AWXB 1EK8A 2CFAB 5H6QA 5L3DA 3CUQB 1KQ4A 5ILSA 2A3SA 4ENMA 1BC7C 2P6TA 3KZZA 1P2FA 2V1UA 2Z33A 1FSEA 2O0YA 3LQQA 5AIPA 5HVQC 4B09A 3DP7A 1FX7A 1B1BA 3SQNA 3HSFA 4OMYA 1LEBA 2E7XA 5TJ3A 3GYHX 1S7AA 3WGHA 3IKVA 1WQFA 3WU0A 3LSTA 4BHPA 2LF7A 3N97A 1BI2A 2FBIA 5LRSA 4TV7A 2O03A 4HF0A 5LHHA 2IT0A 2LNBA 3BROA 4RGUA 2COMA 3H0GA 1FC3A 2RVCA 4OMZA 3GLXA 2PBIA 3QU3A 5DD8A 4Q47A 5CVJA 3WTWC 4EJVA 4EMSA 4HBLA 4IF4A 3WTSC 1BI3A 2GSNA 2PLYA 3SZTA 3L4KA 1Q1HA 4OIQF 4HA8A 1KQ8A 2JPBA 3GTPA 3IWZA 3CLOA 5E18F 3U9GA 1B9MA 3KEQA 3RYRA 2IRFG 2DFIA 4UV8A 1ZRCA 3TO9A 5EGHA 1B4BA 5FGMA 2YSRA 4AIKA 1R22A 3D5LA 3FM5A 3FZVA 3QPTA 3H3ZA 3EUHA 1SMYF 3BJ6A 3TQNA 4KARA 4BAYA 4G8XA 2A61A 2HQRA 4L5IA 1U5TB 3IWFA 2GIVA 3FXRA 4A6DA 4FM9A 2EA2A 4MEYF 2EK5A 4L9NA 4ENNA 1HXDA 2QENA 3WG9A 1O27A 2LSOA 1F9NA 1YO5C 3ABUA 1IXRC 5HDKA 4XLPF 3Q9VA 3Q3QA 3GX4X 4N9HA 4P5AA 1QZYA 3N3YA 3HRMA 2FA5A 3HSEA 1O3SA 1BGWA 3F21A 4IPAA 1RIOH 4LLGF 2ZJ2A 4RB2C 3R0AA 5FFXA 5LGNA 4CGZA 2HTJA 3RTRA 2H6CA 4PCQA 1S3JA 2FXAA 3VOEA 3FHZA 1YFHA 4XSXF 4UUVA 3I59A 3R4KA 5JHUA 2GZWA 3GTQA 2JT1A 3SZPA 3L7WA 1P92A 1G6NA 4GO1A 4A12A 3ZMDA 5E17F 4EJTA 2H27A 3ZMVA 3VEPA 4L5JA 1JXSA 4KA4A 1FP1D 3V8JA 2O8XA 1BI0A 2YPRA 4HW0A 1XDUA 1FOKA 2OZUA 5EGEA 2PI0A 3K1MA 3DV8A 1WQHA 2GWRA 4JK1X 1J59A 5HLHA 4WK8F 4MTDA 2W24A 2GXGA 1TWHA 1RUNA 3V8LA 5BS6A 4KMUX 2CFXA 1PUEE 2OQGA 2AS5F 3ZPLA 4ZYGA 2F5EA 2D2WA 3KETA 1O26A 1UB9A 3EDPA 4MTEA 4YFXF 4KMFA 2M87A 4L0YB 1USSA 4RB1A 1KGSA 5J6XA 1AWCA 2ZMEB 4RAYA 4YFKF 5K5OA 1LQ1A 1WKMA 1OPCA 1R1VA 2V1XA 3OOPA 1SAXA 5D8KB 4I7HA 2XCQA 4Z2YA 5BOXA 4RB3C 3NUHA 3CTAA 2JRTA 3JAMK 4S05A 5DCMB 1Z9CA 4A6EA 2QM3A 2XRNA 4I98B 2FRHA 5HS7A 5CVUA 4ASNA 3WGGA 2HFHA 1YTYA 4GYGA 2EA4A 3L00A 5IOTA 2K27A 4ETSA 1YS6A 2V9VA 2Y48A 4KC6A 3WE3A 3JTGA 1U5TA 5ICEA 1ZG3A 4KM9A 1QO0D 2TDXA 2W84A 2QYOA 1WQ2A 2WWYA 4ON0A 3HOSA 2A07F 1O28A 2PN6A 5CHPA 5EEGA 1HKSA 3WTVC 4M73A 4KN4X 4KDPA 5HS8A 4LB6B 4M9SA 3MQ0A 2L3DA 4ZZDA 3GFIA 1SD7A 3M9AA 1X3UA 2D45A 3O2PE 4AIHA 3ZMZA 4GTBA 2X4HA 3PQJA 2LF8A 1R5HA 4YIFA 3WODF 4C3HC 1IW7F 1B4AA 3DQVC 3TOBA 1HSJA 1L0OC 4KIGA 2Y3PA 3ZMSA 4EJUA 2NNYA 2VE9A 4HV5A 1XSXA 4EM0B 5LLQA 1XSVA 4UVCA 4G6QA 4ZH4F 1KU2A 1PP8F 1TWGA 1O7FA 1J9IA 2AXLA 1JHFA 4U7BA 1W7PA 1LDDA 4MQVA 2G9WA 2XAGA 3R6SA 1PDNC 4FZBA 1OKRA 2HWVA 1XXCA 1UHWA 5AONA 1W4MA 4KASA 1O57A 2Q2EA 3E5QA 2XAFA 4K2EA 2Y0MA 3MAJA 3ERED 3I71A 4M9ZA 3BP8A 4M9XA 3CQZA 2QUFA 1IXCA 2XVCA 2HS5A 2V1DA 1ZGJA 1ZRFA 4HX7A 4OU0A 1TBXA 4ZYDA 1ZVUA 1P4WA 2NNNA 2D1HA 2OAZA 3KE2A 1H9TA 3OEPA 2CQKA 1R7JA 1TWFA 4ESJA 2PFBA 3P9IA 5DCMA 4A5NA 5D4SA 3I54A 1P6RA 5E20A 4YIIA 4BLBA 4GTFA 1TWCA 4A0ZA 3HIFA 1XCVA 5LGUA 2YR2A 5LHIA 5TRDA 2M1BA 4I02A 3N4MA 3HRUA 4N0BA 4ZYEA 4G7OF 2XROA 2K4JA 4O6JA 2DK5A 1ZH5A 1HW2A 2HZTA 4R8HA 2EWNA 2E7WA 2MA3A 4LB5A 5E8IA 1XXAA 4KB4A 2XASA 5A2QZ 4GTEA 3RDIA 3IRRA 1GXQA 5D5XB 3BZ6A 5D5UB 1FBUA 1DDNA 3R60A 2K86A 2GA2A 1CGPA 2J5OA 2IP2A 3KCCA 2EFOA 5HDGA 4PGHA 4HF2A 3P7NA 1HSTA 1S7OA 2UXXA 2Y75A 2RQPA 5FLXK 3HRSA 4RB0A 2MH9A 5CVVA 1IN8A 2MBFA 3CO7C 4AIJA 2WC2A 3ELKA 4KFCA 2FE3A 2VONA 3TDZC 4L0ZB 5DV5A 2EFPA 2H6BA 3GFJA 1B9NA 1OYYA 1QZZA 2UXNA 3K1PA 1MJBA 3KZYA 1XMKA 4NB5A 1MDMA 4B8XA 1YYVA 2GA1A 1IXSB 1JHHA 2IJLA 3KLNA 3QP5A 3F72A 2RNJA 1Z6RA 3F8NA 2VUMA 1O3QA 1ZXOA 1RI7A 2NVXA 3J81Z 3BWGA 3R61A 4U0YA 2ACJA 2YX4A 2HGCA 3I5UA 2O3FA 1J0RA 2DI3A 4GGGA 2FBKA 1I5ZA 2FBHA 3T5XA 3MMLB 5AIQA 4KB2A 4ESBA 1IS1A 1BI1A 1ZN2A 5J8CA 3WTYC 3SXYA 2EJRA 1O29A 5JFEA 3CJNA 4LG0A 4WXCA 2PG4A 1BJAA 3DPLC 3JTHA 2GXBA 2IA1A 2ZCWA 3COAC 2EFNA 5EEHA 1ZBSA 1U78A 3LPXA 1YG2A 2Z5UA 2IPQX 4BYYA 3E6CC 2QBYA 3Q9SA 2NVYA 4KMAA 5IT9K 2XAQA 3CO6C 3LAJA 1R5GA 5CJ9A 2EB7A 1W5SA 4RGRA 3MCZA 5DUIA 4Q4ZF 1XXBA 3GTOA 4XLNF 5BMZA 1FLIA 4GFQA 4M71A 4UHTA 1YW9A 3ZN1A 1TTYA 3C7JA 2R7FA 5H6RA 4L18B 2XHKA 1FYMA 2JA5A 4UXNA 1GHCA 4C3JC 3FF5A 3R0JA 4GTLA 2A68F 3B73A 4KM8A 4IRGA 2DO7A 2V6CA 3C18A 2HQNA 3HOTA 3K69A 4LD5A 3N0BA 2W85A 2DK8A 1LVAA 1HBXG 1VTNC 3FWEA 4I0BA 1BM9A 2VC1A 3QPHA 1ZGAA 1TWAA 2FSWA 5HDNA 2YX7A 2V79A 2RGRA 5D6EA 2P6SA 5BPDA 1I3QA 2F5FA 3VFZA 1TW2A 2Z9OA 3D0SA 2HYGD 3KP6A 1FYKA 1ZRDA 1Y1VA 3ECOA 3V7SA 3LA3A 1ZARA 1F1ZA 4P5OA 4BLAA 3EYYA 1KU3A 5E1WA 3AQOA 2J5PA 2HTSA 2DW4A 3G73A 1I50A 4UV9A 1TW3A 2Q0OA 4E70A 2UZKA 4UNOA 5ED4A 4WF2A 4J3NA 4OIOF 3RKWA 4FT8A 2FNPA 1A04A 1LDKB 1KU7A 3L4JA 3BPVA 2R7DA 3GW2A 4RAZA 1BIBA 3J80K 1IN5A 3E6DA 4EM2A 5L3EA 3E3VA 4AD9A 4LLNA 2LKPA 1GVJA 3T8RA 3W6KB 3S2WA 3GWZA 5ILVA 4MGRA 1S29A 2E2IA 4KAWX 2RN7A 1HKTA 5FFZA 1AOYA 5BPIA 1T2KA 1F5TA 1CF7B 2NRAC 2VC0A 1SFXA 4KATA 1U6GA 3I53A 3MZHA 3LA2A 3VODA 1E2XA 2OQRA 5ILUA 2P5VA 4DQ2A 2O6GE 2XIGA 2IA0A 3TO7A 3HYIA 2A5YB 1U8RA 2FU4A 2IW5A 5LRRA 1MDMB 2PJPA 1BOAA 3SFZA 3ZN0A 2QBYB 5JVOA 2M5WA 3RPUA 1FBQA 1I1SA 1YLFA 4RGXA 5CVRA 3O6BB 3DXJF 1ONVA 2OBPA 2OU2A 1K6OA 4LFUA 1QPMA 1WWXA 5IORA 1R1UA 1LDJA 3LFKA 3HUGA 3U2RA 3J81K 5LEKA 1D8KA 1YS7A 2HEOA 1TQMA 4ZZLA 2R92A 1I27A 1SD6A 2L54A 1G3YA 5ICFA 2R93A 2P5KA 2MH2A 4IVNA 1BN5A 1K7AA 3FX3A 3KP5A 2ZMEA 3REOA 2FEZA 4IRHA 3TKYA 1TQPA 1O24A 3EQLF 2L4AA 2X0LA 3ABTA 5D6FA 3FXUA 4HYEA 1QBJA 1ON1A 2BEOA 4G7HF 4JQFA 1KU9A 5FLXZ 2P7CB 4G6DA 3WU1B 2EFWA 4P5BA 5D5WB 1XGMA 3FOEA 4KT5C 4L9TA 3KEOA 4I0AA 1RNLA 4HOBA 5IT3A 1KA8A 4HX8A 3O3KA 4BNCA 5LHGA 2KJBA 6PAXA 3QAHA 1XGNA 1WI9A 2RGVA 1O3RA 4G0VA 1FT9A 3WTTC 3GUDA 2HKXA 1R58A 2PMUA 1HQCA 3K9TA 3T8TA 2R7ZA 4M1XA 4KICA 4HLYA 1XB4A 5ICGA 1D5VA 1S8NA 2IVMA 4G0UA 2K7LA 1STZA 3GVAA 1G3TA 2OA4A 1YW7A 3ISPA 5L3BA 2VT3A 3E5UA 2VE8A 5CYVA 1KYZA 2DT5A 3F8FA 4MHGA 3M7GA 2PHCB 1TNTA 3T1BA 3NQOA 2F2EA 1OR7A 3F6VA 1EV7A 4CDGA 5DDGA 3TGNA 3GTJA 4LMYA 4MNUA 3DF8A 4LGWA 1T98A 1UHMA 4LR2A 4KIBA 2BYVE 3J80Z 2OZ6A 3HHGA 2BE5F 1F4KA 1XMAA 3P9CA 3DKWA 5L3FA 1FZPB 3PQKA 3RJPA 3GTGA 3BY6A 5HLIA 4LK1F 1G3WA 2EV0A 3C1DA 3F8BA 5D8LB 1ULYA 1HW1A 3RYPA 2P7VB 4L9VA 4GTDA 4ZYHA 3GFMA 3HRTA 1FSHA 4I01A 1T6SA 1XGSA 4EGZA 4CYDA 5FD6A 4O5VA 3BJOA 4LQYA 1FBSA 4A0XA 1K78B 3WGIA 3E5XA 4ESFA 3CUOA 3FMSA 3RKYA 3WTXC 1WRJA 3H3UA 3RIRA 2HKOA 4G94A 3DPTA 3EYIA 2XUBA 5DD4A 4BHCA 2KIMA 1DPUA 1U5TC 1FWZA 1GXPA 4OIRF 4DDQA 4LJZF 1XN7A 2RV8A 1IZ1A 2ZKZA 2ZO4A