1F9NA

Crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
KGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords ARGININE REPRESSOR/ACTIVATOR PROTEIN
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f9nA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1f9nA02
4G6DA 2DO7A 2LNBA 1GXQA 4BH9A 3IL2A 3GUDA 3N97A 1ZLKA 4HW0A 4LG0B 1ZH5A 3NRVA 3S2WA 1XGNA 3T1BA 3KZZA 1J2XA 5ERIA 4Y15A 2EV5A 3WTZA 4EVIA 3ABTA 1QPMA 1D3YA 4A0XA 1Z7UA 1J75A 4XBFA 2GWRA 2H6CA 1U5TB 1ZRDA 3VOEA 2E7XA 4P5OA 3LA3A 4LFUA 1L3LA 2O03A 4HX8A 4EJOA 1AB4A 4IRIA 3CO6C 1TLHB 1ZARA 4O3MA 3T8TA 2VC1A 2IP2A 3FF5A 3TGNA 6PAXA 3WG9A 3KE2A 2VBWA 1U2WA 4A0YA 2RNJA 4BHBA 5LEJA 3E5XA 2IRFG 2GXGA 3ABUA 4KMFA 3K9TA 3KP5A 1EV7A 3QU3A 1TQMA 2HQNA 2PQ8A 1XMKA 4AVPA 4HYEA 1ZN2A 3HHGA 1FWZA 3SHFA 1OYYA 3BROA 3ROUA 1DD5A 3FHZA 2HKXA 1PP8F 1W7PA 3I59A 4GXOA 4N9IA 3VEPA 1W7PB 2F5CA 1SFXA 2CQKA 3IWZA 1YLFA 2HR3A 4L5IA 1B6AA 1NHAA 2O3FA 3P9KA 4TV7A 3DXJF 1FP2A 2EFOA 2OZUA 4G7OF 3KP3A 2AXLA 3L7WA 4LJZF 3V8LA 1TNSA 3I0TA 3DF8A 4IXAA 3E5QA 3L9FA 3GFLA 5CLSA 3RKYA 2G7UA 4UVAA 3H92A 1YO5C 2NS0A 3F21A 4PGHA 3BJ6A 1U5TC 2L4MA 5K5RA 2STTA 1SMYF 5F64A 4YFKF 4KIBA 2XAGA 3PQJA 2D1HA 5ED4A 1DDNA 1U8RA 4RS8A 3SQNA 1QBJA 1HXDA 5LHGA 3JAMZ 4I98B 5AONA 5E8IA 5K5QA 4ZZLA 3TO6A 3E6DA 3LAJA 1FZPB 4BXUA 3OEPA 5FFXA 4BYYA 2HEOA 4A5MA 4G9YA 3GXOA 3HUGA 1AWCA 2KIMA 4RGXA 1ZG3A 3QOPA 3LPXA 1RI7A 3BPXA 5FO5A 3V4GA 2XHKA 2RN7A 2P5KA 2RDPA 1B4BA 3KLOA 1CF7A 2HWVA 4HZFA 1ZRFA 2QWWA 2Q0OA 3ECOA 3ERED 3M8EA 2FRHA 1R1UA 2F5FA 3I53A 2ZFWA 2PG4A 3E97A 3L2CA 3GFIA 4KB2A 1H9TA 1I1GA 4PCQA 1S3JA 2Z9OA 2GIVA 2Q8KA 2FBHA 3L00A 3QRFF 4BNCA 2K4JA 2NNYA 3WTTC 1F1ZA 1Y0UA 3KFWX 5J8FA 5LGUA 4Q48A 4ASNA 1IRFA 3JW4A 1E17A 3GZ5A 1FC3A 5E17F 3NQOA 1KU2A 4LK1F 2NNNA 3F6VA 4AIHA 2A3SA 4KICA 4S04A 4CGZA 2HDCA 5JR3A 5BQTA 3GLXA 5LBQA 1HKQA 1JHFA 2HKOA 2JZYA 5L3EA 1CGPA 4L0ZB 1O3RA 2M30A 1VTNC 5LHHA 4A0ZA 1O57A 2Y75A 4XRFA 2IA2A 4UXNA 4EMSA 1R5HA 4EM1A 3SFZA 2VBYA 4YIFA 2XGXA 1H9GA 3F3XA 1IN7A 3U9GA 1OPCA 1G6NA 3TKYA 2ZCWA 1UB9A 3GFJA 5ILSA 1LQ1A 3N4MA 2EB7A 5KK1A 1P2FA 2ZKZA 5JVOA 3J80Z 4G94A 2RVCA 2DQLA 4NHJA 2FNPA 4KAWX 1XB4A 2FOKA 5IT9K 2AS5F 3GX4X 3GZ6A 4RGSA 3R6SA 3LQQA 3P9CA 1ZREA 3VA7A 2M1BA 3HYIA 4HQMA 1LB2A 4WXCA 4CDGA 4F7ZA 2BE5F 4Y17A 2EA2A 3ZN1A 1K6OA 4I7HA 5A2QK 4HDVA 1YW7A 3FXQA 4ENMA 2OU2A 5EEGA 1WKMA 3G3ZA 1RNLA 1YQAA 1RZ4A 2JRTA 1S29A 4U7BA 2QYOA 4KDPA 3WE2A 2MD5A 1XXCA 2DW4A 2FMYA 3WE3A 1EH8A 1DPRA 3RTRA 3GYHX 3IRQA 4EJTA 5JHUA 1Z1DA 1BM9A 5D8LB 2A68F 2V6CA 1W5SA 1FYKA 1SFUA 2ZMEB 2CGPA 2DK5A 2OBPA 1XSDA 4P55A 4HQEA 2EV6A 4WWCA 4M73A 4OMYA 1D5VA 1R5GA 1DUXC 2K86A 4IHSA 4A5NA 4RB1A 5D6FA 1BC7C 3C7JA 4EJVA 1ZGAA 2XAQA 1J59A 4ZYDA 1LDKB 1MDMB 4CHUA 3FOEA 2WTEA 1DP7P 1MJ9A 5CVIA 4B09A 1YW9A 3VFZA 4HLXA 3MWMA 2H27A 3HHHA 3C18A 3T8RA 1BI0A 4RB3C 4YFNF 1FNNA 2K7LA 3TOBA 2Z99A 1G3TA 2XROA 3TO7A 2IT0A 5FD6A 3ECHA 3FX3A 1FPQA 1OMIA 1XCVA 1IF1A 2RQPA 4LB5A 3WTUC 4A6EA 3J7AO 1P6RA 1PP7U 3F23A 3RPQA 1B9MA 2DPDA 3IC7A 1TTYA 1QZZA 4I09A 1MGTA 3JSPA 1IUYA 3BJAA 3E3VA 1B4AA 1GVJA 4OIOF 4KN7X 2BV6A 5BPDA 5DV5A 3OOPA 5K5OA 3SZTA 3BOQA 2ESHA 1T98A 4OIPF 3E6BA 3CDHA 4M9SA 4I01A 5TRDA 3F8NA 1P92A 1HQCA 4E70A 2DTRA 3CO7C 2OQGA 5F6FA 2KJCA 2STWA 4L5JA 5K1YA 1B59A 1Q1HA 2DU9A 3I4PA 2ZXJA 5LGTA 1LDDA 5CYVA 1FY7A 1ZG1A 4HLYA 4FHTA 4BAYA 2XKPA 1SAXA 5CVRA 3V7CA 4P96A 2GXBA 2NRAC 1IW7F 1SD6A 1KU9A 2RV8A 4KT5C 4A12A 3JTGA 1FSEA 1XDSA 2HFHA 2KRFA 4L9VA 3DEUA 3SZPA 1I5ZA 1TBXA 2COMA 1HBXG 3C1DA 3KZYA 2VODA 4LLLA 2QQAA 1XSXA 5H6RA 4EGYA 3WODF 4XLPF 5D5VB 3ZQ7A 1O3QA 1IXRC 2KKOA 1XXBA 2A5YB 1J9IA 3WGHA 5J6XA 2YR2A 5H6QA 4HDUA 4ON0A 1USSA 3WTYC 1JE8A 4KYWA 5DYMA 3I58A 1ON1A 4M9ZA 1WQGA 3BWGA 1R23A 3GF2A 2D2WA 4IHTA 4JQFA 1R36A 2IJLA 2J5PA 4HA8A 4L9NA 2M5WA 4G0UA 2QBYB 1KU3A 2FQ3A 1PDNC 2MLKA 1S7OA 4G7ZF 2H09A 3DP7A 5A2QZ 2MH2A 1D8KA 3TQNA 3E5UA 2PJPA 1HW5A 2BYVE 3I54A 4KDDA 4EM2A 1ZAOA 3LA2A 3L4JA 1ULYA 2YSRA 1IN5A 1RIOH 4KNYA 2QQ9A 3HOTA 4S05A 1BI2A 4UV8A 1W5TA 1LVAA 3QAHA 3PFIA 1KYWA 5AIPA 1AOYA 1WQHA 2LDUA 2XCOA 4ESJA 1B9NA 5ILVA 3JTHA 2GZWA 5E1XA 3HRUA 2XAHA 2A61A 2UWMA 5BPIA 5HS7A 1HSTA 4M6XA 2ETHA 1KA8A 1MKMA 1IRGA 3V8KA 1R7JA 5JI6A 1S7AA 3DPLC 1ON2A 2TDXA 3HSEA 4MQ9F 3WGIA 2DFIA 4HF2A 2FBIA 2VT3A 3NEUA 1FYMA 2F5EA 4ENKA 1FT9A 1QNTA 3RKXA 5FLXZ 2UXNA 2HGCA 4HF1A 2KIUA 2P7VB 3Q9SA 5AIQA 4CXFA 3MZYA 5CVUA 4ENJA 2Y0MA 1Z6TA 1WQFA 1BIAA 1R1VA 4HBLA 4QWQA 1XGMA 1REPC 5BOXA 2CWEA 2XASA 2OZ6A 4H0EA 2QVOA 1Z9CA 4WF2A 3I64A 1FBSA 1P4AA 4RGRA 1BBYA 1MDMA 3KP4A 3WTSC 4ZYGA 4K2EA 1USTA 5E1ZB 3MQ0A 4EJUA 3FMSA 1J0RA 3FMQA 3O3KA 2L3DA 1IZ1A 3LSTA 1T39A 3P9IA 2CW0F 4ZYHA 4M72A 3MAJA 3CLOA 2B0LA 2VOOA 4N0BA 2Z33A 5HDKA 2XUBA 5EEHA 3OREA 5ICEA 2EFPA 2OD5A 1ZVUA 1WSUA 3CAGA 2FA5A 1OYIA 2VE9A 4AWXB 2VBXA 1P4WA 1ONVA 4RB0A 5LGNA 1MD0A 3FXUA 3QPTA 3U2RA 5E20A 2ISYA 4OU0A 3MCZA 2EA4A 1K78B 3TDZC 5DEQA 1BI3A 5HLHA 3FMRA 1D8JA 4A2UA 1FBQA 4OOIA 1PUEE 2DPUA 4OMZA 2BEOA 2QZ8A 2W57A 5TJJA 1GXPA 4P9FA 1ISEA 2Y3PA 1YW8A 4LMYA 3R61A 1P4XA 2PLYA 1XDUA 1TQPA 4L9JA 1XXAA 3EQLF 4G7HF 4O5VA 2NYXA 4G0WA 1WQ2A 1YS6A 5LLQA 4XSXF 2R3SA 4M71A 4IPAA 3R4KA 3HRTA 3FXRA 3V8JA 2H6BA 2LF7A 1K79A 2GQQA 1MZBA 1U78A 1YFHA 3WU1B 1B1BA 3BUEA 1T38A 4CYDA 2DBBA 2P5LC 1O7LA 4RB2C 3HTSB 2VC0A 4WXDA 3M9AA 1XGOA 5E18F 5F1RA 1RUOA 2L02A 3SXYA 4HV6A 2VT2A 2KWAA 1ODDA 3ZMVA 3DPTA 4OIQF 2UZKA 2G9WA 4D0PA 3W6JB 4UUVA 2JPBA 1T6SA 2P4WA 2Y48A 3MZHA 1ZRCA 4HV5A 1F5TA 1EH1A 4ESFA 3QU6A 1HW1A 5HLIA 2VBZA 1UFMA 2CYYA 4XLNF 3K1PA 3OPFA 1JXSA 2CG4A 4I02A 1A04A 2MBFA 1F9NA 1IN6A 5E8GA 4ETSA 4IJAA 2QLZA 2XAFA 3DV8A 2HQRA 2LF8A 1LEAA 1SFEA 3I71A 4KUMA 5LRRA 1HKTA 3WGGA 4YG2F 2EJRA 3J81Z 5DCMB 4RAYA 1L0OC 2QQBA 3GVAA 4KB4A 1IXSB 4YIIA 1EH6A 2NAZA 2E1CA 3WTXC 2OQRA 1BJAA 3F22A 5LHIA 1KU7A 2V79A 2E1NA 2HZTA 4EGZA 1CF7B 2EWNA 3BDDA 1DPUA 3ML6A 2ADUA 3M8FA 4HF0A 1T0FA 4G8XA 4OINF 2XRNA 3CUQA 4MEXF 5L3GA 3K0LA 5LEKA 5DDGA 2D1VA 1I1SA 5D5UB 3T5XA 2YPRA 3H3UA 3HTUA 4AIKA 2G7HA 2Q2EA 2WWYA 3O6BB 3M1EA 2ZFZA 1LDJA 4U88A 1FYLA 2JPCA 3COAC 2FXAA 1BI1A 1J7KA 2ISZA 1IXCA 2JT1A 5BMZA 1YYVA 4LLGF 3R0AA 4UVCA 2ZBKA 4IVNA 1ZYRF 4RGUA 4ENNA 1ZGJA 3ZP5A 4GFQA 2VE8A 3NUHA 2V1DA 2BGCA 2FF4A 3RI4A 2ELHA 4GYGA 1TW2A 2XCRB 2WC2A 5JFRA 2DI3A 5HOOA 2ZMEA 3F6OA 2HTSA 3LFKA 1OR7A 5HVQC 1EK8A 1XMAA 4R1HA 2P7CB 2W84A 4IRGA 1BJTA 2BBYA 1S8NA 3PQKA 2GA1A 4HX7A 2QUFA 4Q4ZF 1X3UA 2HOEA 2W24A 2ZNYA 1WIHA 4DQ2A 4IRHA 2A69F 3L09A 4L18B 4L0YB 3K1MA 2A6EF 3RIRA 1QGPA 2A6HF 3J80K 2DT5A 1SD5A 4GGGA 4DNCA 2ZNZA 3KCCA 2RGRA 3LWFA 3ZMUA 5L3BA 3L4KA 3DFGA 5IT9Z 2JTVA 3HRSA 2QM3A 5BS6A 2KJBA 3LA7A 5L3CA 2W85A 1FSHA 4R79A 3C3WA 3ISPA 3F8FA 3BJOA 2K02A 2X4HA 2EFQA 3ZN0A 2D45A 1KQ0A 3E6MA 3WTVC 2IVMA 4U0VA 2DQRA 2Z5UA 1QZYA 5FD5A 4PZJA 1O3SA 4Q5SF 4KIFA 2DAOA 1FLIA 4P9UA 4OIRF 2MA3A 4CICA 4RAZA 1WWXA 3R60A 2IPQX 3F8CA 3HSFA 3F8MA 3GFMA 5DD4A 5L3DA 2FSWA 1K7AA 4MEYF 5J8CA 1UHMA 3M7GA 1WI9A 2PMHA 5KVRA 1F4KA 4LLNA 1MJAA 1SD7A 2IA1A 2CO5A 2M87A 3I5UA 1TW3A 4KC6A 1G3SA 2CFXA 4ZZDA 1IN8A 4G0VA 3U1DA 3KP2A 2VN2A 4LG0A 3CUQB 1JGSA 4NB5A 2DK8A 2F5DA 3OV8A 4HAMA 4AIJA 4M74A 5FB2A 2LSOA 2LKPA 5D6EA 2H94A 1FBUA 2EFNA 2P6TA 3ELKA 1BGWA 3B73A 3BZ6A 1KGSA 4CO8A 3GO5A 3D0SA 4EM0B 3QP6A 2XKOA 2E7WA 2XVCA 3E6CC 2R7FA 2KIFA 3IKTA 4I0BA 2VONA 2VXZA 4ZYEA 3EUHA 1H0MA 2CSOA 4FX4A 1KQ8A 5D8KB 4U0WA 1V3FA 3KETA 3P7NA 1YG2A 2WV0A 4WX9A 4U7DA 3FM3A 1O3TA 3IRRA 5FGMA 3RJPA 3RDIA 3GWZA 5CVVA 4A6DA 2YX4A 3HOSA 3HRMA 4PGGA 3RKWA 2PHCB 1XGSA 1IN4A 2FU4A 2FEZA 2R7DA 4UNOA 3BP8A 1C0WA 4AD9A 2P5VA 1HW2A 5FLXK 2K27A 4XSZF 1TNTA 4KN4X 3KLNA 4M9XA 1I27A 1RUNA 5CJ9A 5DUIA 2IW5A 2L4AA 2RGVA 3FM5A 2JSCA 1Z91A 4G6QA 2PFBA 4MHGA 4I2OA 5DD8A 3MEXA 3Q9VA 2M45A 3FZVA 3W6KB 2FNAA 3Q5FA 3R0JA 2MC3A 2EK5A 3F8BA 4FT8A 4IF4A 5CVJA 1ZHFA 3DKWA 1O7FA 3V7SA 3QP5A 3BPVA 4I0AA 4LK0F 1SMTA 1YS7A 4GYIA 2MLGA 1OYWA 3ZMDA 1FX7A 1GHCA 1R58A 3RYPA 3EETA 1BN5A 3I59B 3WU0A 4Q47A 1JHHA 4KIGA 5D4RA 1HKSA 3KEOA 1U6GA 3IHUA 4BQAA 2XCQA 4WK8F 1G3YA 1XN7A 4MQVA 5LRSA 3CJNA 1K78A 5DUKA 2ACJA 5HDGA 4HX4A 1OKRA 5DCMA 4EQQA 1ZG5A 4LGWA 2OAZA 4LD5A 4ZH4F 4JK1X 2HYFA 2OA4A 2FBKA 3K69A 3QPHA 4DDQA 5D4SA 1TQIA 2V1UA 4Z2YA 2XIGA 5JVTA 3ZPLA 3BY6A 2PMUA 2C6YA 2PBIA 2YX7A 4ESBA 3K2ZA 1XD7A 4L9TA 3TOAA 3RYRA 3EDPA 4N9HA 1U3EM 3ULQB 3H3ZA 3K1NA 3EYYA 1BIBA 1YTYA 5HDNA 1V4RA 1Z05A 3LQRA 4UVBA 1R00A 2L01A 1WRJA 3FWEA 2XV4S 4PDKA 4QLCU 4CZZA 4EV0A 3DQVC 3IWFA 3B02A 4M6YA 3CUOA 1KQ9A 3KEQA 2EFWA 1KYZA 1E2XA 2W25A 2XAJA 5HS9A 2GA2A 5HLGA 1GE9A 3T0YA 1R1TA 1HSJA 1W4MA 3JSOA 4HOBA 3REOA 3ZMTA 1ZLJA 3VB2A 5H20A 4B8XA 3V7RA 2K4BA 2QBYA 3EYIA 2HS5A 1XSVA 2FMLA 3QX3A 1LNWA 3F72A 1FOKA 2EV0A 1W7PD 5E1WA 1BC8C 1G3WA 2UXXA 1EH7A 4UV9A 3WTWC 2PI0A 1IS1A 3J81K 1YIOA 3HIFA 4U0YA 3O2PE 4O6JA 5HS8A 3G73A 2PEXA 2RC4A 1SD4A 4KA4A 2VOPA 2O6GE 1FP1D 3FOFA 2O0YA 1UCRA 2YU3A 4FX0A 2O61A 4MGRA 4WCGA 5ILUA 3HSRA 2A07F 1BOAA 2HYGD 5DCFA 5L3FA 1T2KA 3KP6A 3VODA 4LB6B 5ICCA 4JBAA 1LEBA 1S6LA 2J5OA 5D5XB 3JAMK 2O8XA 1U5TA 5D5WB 3AAFA 2Z3YA 3IKVA 1G4DA 2DLLA 3TDUC 4UHTA 1IAWA 3RPUA 4FM9A 4BHPA 4Y13A 5ICFA 3MFKA 2M8EA 2ZJ2A 1Z6RA 2P8TA 4MTDA 2X0LA 2HTJA 1J5YA 3CUQC 2MH9A 2RKHA 3D5LA 1XCBA 2ZO4A 2PN6A 3ZMSA 2ESNA 3GEZA 5IT3A 2F2EA 4WXHA 3MMLB 2V1XA 3TO9A 4MTEA 1QQIA 3CTAA 4GO1A 3GW2A 2V9VA 1UHWA 4YFXF 5FFZA 2P6SA 2GAUA 4J3NA 4MNUA 1STZA 1I6XA 3ZMZA 4GCVA 4BHCA 4KMUX 2IA0A 3KP7A 5ICGA 2P5MA 1R22A 2QENA 3LAPA 4NQWA 1QO0D 4KFCA 1LJ9A 2FE3A 4R8HA 2L54A 4EJWA 1MJBA
chains in the Genus database with same CATH superfamily
2PX9A 2BOLA 2NVQC 5IOQA 1SC7A 3ZXSA 4XLNA 3JRHA 2QSGX 4G6DA 2DO7A 4NC6A 3S1NC 2LNBA 1GXQA 3RSNA 4BH9A 1O2AA 3JR9A 3IL2A 4BGDA 5GADJ 3GUDA 3N97A 1ZLKA 3T00A 3MD2A 2MG4A 4HW0A 4LG0B 3G6EI 1ZH5A 2NVYJ 2KRCA 3NRVA 3S2WA 2Y0SL 4E7JA 1XGNA 3JREA 2VL8A 3V42A 1TWGA 1YJWI 2R7ZA 3T1BA 3KZZA 1J2XA 1FMWA 4LK0A 1DCOA 3DBHB 3H0GC 2CRGA 5DM6F 1ZK8A 1TWFC 4BBRJ 3HOYC 1RC9A 2DT7B 5ERIA 1JTYA 4Y15A 2EV5A 3WTZA 3GEEA 2JA5J 3CMYA 1VQ6I 1Z3YA 4EVIA 3GTPJ 3ABTA 1QPMA 4FE4A 2R7RA 4F92B 2EQRA 2E2JJ 4KISA 1D3YA 4A0XA 1Z7UA 2OTLI 1KQ4A 1J75A 4XBFA 1JKQC 1UJ8A 1G8XA 5B3SH 5DM7F 4S0HB 2GWRA 2VKHA 4DZPA 2H6CA 2K9SA 2VKDA 1U5TB 4V2FA 3PO2K 3CCRI 4GZYA 5IP9J 5C3EK 1ZRDA 3VOEA 2E7XA 2L9SA 1F43A 4P5OA 3LA3A 4LFUA 2WB1N 3S8PA 5J47A 1L3LA 2LR8A 2O03A 2R7TA 1FOWA 4HNVA 4HX8A 4EJOA 1AB4A 2Y2ZA 3PL8A 3HOUC 5GTHC 1ETVA 1MMAA 1GV2A 3O8HA 1VQMI 3CO6C 1TLHB 4IRIA 4A3JK 1I6HC 1ZARA 5H2FC 3SEZA 1A36A 4O3MA 2ZB9A 3T8TA 1QHGA 2VC1A 2IP2A 4XKVA 3FF5A 3TGNA 6PAXA 3GSIA 3WG9A 1BL0A 1O4XA 2WB1L 3KE2A 3IH3A 2UUZA 2VBWA 1U2WA 4A0YA 5M3FK 2RNJA 4BHBA 5LEJA 4B3AA 3E5XA 4BJ6C 1VQ7I 2WY8Q 3K7AC 2FX0A 3K2AA 3K4BA 2IRFG 2Z16A 1USMA 2HI3A 2GXGA 3ABUA 4JX6A 1ZTRA 3GTOK 4DJAA 3W2VA 1OCRH 4KMFA 2IGOA 3K9TA 3KP5A 4RM3A 1EV7A 5B1BH 2V6SA 3BP3A 3QU3A 1TQMA 2JA6K 4BBSK 3LSJA 3GTLK 2KPMA 2IS2A 3PSFA 2HQNA 4ZJZA 1Z67A 2PQ8A 1XMKA 2ELJA 2MC4A 4AVPA 4HYEA 1ZN2A 2DOAA 2JA8K 1EI6A 4XQFA 2XB5A 3HHGA 3SZGA 1XZPA 1SFOK 5IORA 1FWZA 4P5BA 3GTGA 3SHFA 3JRDA 2CQQA 4M1XA 3OIPA 1OYYA 3JRGA 3BROA 1FTZA 3KYCB 4A93J 2G0EA 3QODA 3ROUA 1DD5A 3FHZA 2HKXA 1PP8F 5FKLA 1NG7A 1W7PA 2HPMA 2GM4A 2M8GX 3I59A 1VQOI 4PJMA 1IRZA 1EJ9A 1HDPA 4GXOA 4N9IA 3OYIA 1UV7A 4OINA 3FKIJ 1D0YA 3VEPA 1J6WA 1W7PB 2CMPA 2F5CA 1SFXA 2VLAA 2CQKA 3IWZA 4GTDA 4XKBA 2ZC2A 4BE0A 1YLFA 2M2EA 1MBEA 5M5YJ 2HR3A 4L5IA 1B6AA 1NHAA 2O3FA 3BR0A 3E0JB 4CYCA 3HKZD 1YX2A 4QIWL 3P9KA 4TV7A 3A03A 3GTKA 3CCVI 4BKWA 2XRLA 1W1WE 5GPAA 3DXJF 3S2HC 1FP2A 1PJ5A 2EFOA 2OZUA 4G7OF 3KP3A 2O7OA 2AXLA 3H0GJ 3L7WA 4LJZF 3V8LA 5TMFA 1USOA 1TNSA 3I0TA 1XZQB 3DF8A 4IXAA 3E5QA 1YX5A 3L9FA 3GFLA 2VUMK 5CLSA 1I3QK 5M5XJ 5TGTA 4C3IK 3CF5F 3RKYA 4OIPA 5HODA 2EBBA 4GFBA 4AYBL 2G7UA 4UVAA 4PFOA 3H92A 2E5NA 2X6YA 3H9JA 3CQZC 1YO5C 2NS0A 3F21A 1BS2A 4PGHA 2BW3B 3S1RJ 3BJ6A 3SYTA 1U5TC 3OWTA 2BW3A 2L4MA 3FHNA 3K70D 2WAQD 4NOIA 4CCJA 5IP7C 5K5RA 1NK3P 3G4AA 2STTA 1SMYF 5F64A 4UUTA 1JUMA 2HXIA 4YFKF 4B4CA 2DOFA 3HOVC 4E7IA 4KIBA 3GTPK 5J1UA 2XAGA 3PQJA 2F6CA 2Q1ZB 2A05A 4F55A 3FXLA 2D1HA 5ED4A 1DDNA 4PJLA 1U8RA 1N25A 4BUPA 4BXXJ 4RS8A 2Y9YA 3SQNA 4A3LK 4GTFA 3LSKA 3K7AJ 1QBJA 1HXDA 3CCSI 3LL7A 1WGXA 3IH4A 2GBYA 1MNEA 4II2A 5LHGA 3JAMZ 4I98B 5AONA 2XGCA 5E8IA 5CKTA 5K5QA 1DP3A 2CJJA 4N4OB 4ZZLA 3TO6A 3E6DA 3HKZN 4BXFA 1VQKI 5TJ3A 3LSMA 3LAJA 1FZPB 2KL4A 2VASA 4BXUA 3OEPA 5FFXA 4BYYA 2HEOA 5C4XC 4A5MA 4G9YA 1MH3A 3GXOA 3HUGA 1HDDC 3H3VK 2KDOA 3IAM2 1AWCA 3EUKL 2XSJC 2KIMA 2W7VA 1ZG3A 3QOPA 4RGXA 2BXYA 3LPXA 1RI7A 3BPXA 1K83J 4PK4A 2R7XA 3SDGA 3TFIA 2EZLA 5FO5A 4AC0A 3V4GA 2XHKA 2RN7A 3CJTB 3PO2J 1R4MB 3A8IA 4C45A 2P5KA 2RDPA 4RA2A 4C3JJ 3KLOA 3IV5A 1OISA 1CF7A 1B4BA 2HWVA 4HZFA 1ZRFA 3OL4A 2QWWA 5EJCA 2Q0OA 1AKHB 2K9NA 4XN0A 3OY9A 3FXKA 3HC7A 3ECOA 2L9NA 1PYVA 4C2MJ 3ERED 3M8EA 4KMUA 2FRHA 1R1UA 1U9OA 2F5FA 1H88C 2X1DA 3I53A 3PO3J 1TWFJ 3HOYJ 1MMNA 1SFOJ 1WJFA 2ZFWA 3HZJA 4IQ4A 4GTAA 2PG4A 3DKXA 1EFWA 2LFBA 3ABMH 1OCOH 2VJ5A 2WADA 3HOUJ 3E97A 3L2CA 4A3JC 3ERMA 5JHFA 4BE1A 3GFIA 2IGNA 4KB2A 2LYCA 1H9TA 1I1GA 4PCQA 1S3JA 2L5QA 3GTGC 4DZJA 2Z9OA 2GIVA 2XGDA 3H36A 2Q8KA 2FBHA 3L00A 4A3EJ 3QRFF 3G4CA 4BNCA 2K4JA 3CQZJ 3WTTC 1WJCA 2NNYA 1YOVB 5TMCA 1FIPA 1F1ZA 1XPXA 3J7ZI 3H3VL 3M4OK 1H89C 2R92J 1Y0UA 1WCMC 1Z3XA 4KN7A 3KFWX 3RZOJ 2XAUA 5J8FA 3ZQLA 5LGUA 1I6HJ 2O5IA 2JUGA 4Q48A 4ASNA 1IRFA 3JW4A 2JVGA 2R5ZA 4P5AA 1Y39A 2B63A 1E17A 3GZ5A 1FC3A 3HKZA 2COBA 4C3IJ 4EATA 5E17F 3NQOA 4A3MC 4JP0A 2JJ7A 1KU2A 4LK1F 4OAYA 2NNNA 3F6VA 4AIHA 2A3SA 4KICA 4S04A 4CGZA 2CW0A 2HDCA 2NVXK 5JR3A 2I10A 5BQTA 3GLXA 5LBQA 1HKQA 1JHFA 2DA3A 1WJBA 4BL0B 2HKOA 2YU9K 3ASNH 1PUFB 2JZYA 1LFPA 3PM1A 5L3EA 1F7VA 1CGPA 4L0ZB 3CQZA 1O3RA 3S0XA 4RLFA 3W6VA 2WAEA 3OYJA 4QIWD 1VTNC 1K61A 5LHHA 4PJNA 4A0ZA 1O57A 2Y75A 5FKMA 3I4MJ 1TWHC 3OMYA 3G1OA 1TWHK 4AUXA 2DA6A 3FKJA 4XRFA 1WH7A 5B5EC 2IA2A 4UXNA 4EMSA 1R5HA 2VUMA 4EM1A 3SFZA 1C0AA 2VBYA 4YIFA 5J4YA 3S15C 2XGXA 3GTMA 1H9GA 1TWAK 1X19A 2P0WA 3F3XA 4KM9A 1IN7A 2JA8J 2OC6A 2V6UA 3GTMC 3BC8A 2HOSA 3U9GA 1OPCA 1ZGWA 1WI3A 4IHXA 3H0DA 1G6NA 3WU2C 3TKYA 3FISA 2ZCWA 2L9VA 1LPQA 3Q3QA 2B63K 2AHQA 1MBKA 3L2UA 1IRXA 1UB9A 3GFJA 5ILSA 3OS1A 1N77A 1RU0A 3ESWB 2JN6A 2K3PA 3NWSA 2E5ZA 2Z2SB 2A5WA 2XF7A 2X1EA 1LQ1A 3N4MA 2EB7A 1MNMC 3A02A 4X0GA 5KK1A 3J7AY 1P2FA 2K3FA 3PUFA 2ZKZA 4IQJA 4ZDOA 5JVOA 4A3GJ 3J80Z 4G94A 1E3OC 2HNHA 3HGGA 2RVCA 1Y8QB 2DQLA 4NHJA 4D5FA 2FNPA 4KAWX 1J09A 1XB4A 2FOKA 2H1LA 2JSPA 4ZTFA 5IT9K 3OS0A 3GX4X 3DU6A 4RGSA 3R6SA 3GZ6A 3LQQA 3P9CA 2AS5F 3GTKC 2W1OA 3LSHA 1ZREA 3S17K 4PSWA 3SFIA 3VA7A 2NVTJ 2M1BA 1GUUA 1PJ6A 4MQ9A 1I50C 3HYIA 1QVTA 4HQMA 5IP9K 4Y7NJ 1LB2A 4C3HJ 4WXCA 4CDGA 3FK6A 4F7ZA 3A2KA 3DPUA 2BE5F 2KT0A 2VIXA 4Y17A 2EA2A 5F0CA 3ZN1A 1K6OA 3EQLA 2LC2A 4XKCA 1MBGA 4I7HA 4AU7A 1BR4A 1YW7A 3FXQA 5A2QK 4HDVA 4ENMA 4LOWA 2OU2A 4NC7A 5EEGA 5F04A 1WKMA 3F0CA 3G3ZA 4QSHA 1RKWA 3FIWA 5KAFC 1RNLA 1YQAA 1RZ4A 2JRTA 4B44A 1S29A 4U7BA 1LFUP 2E2IK 2QYOA 4KDPA 3WE2A 2MD5A 1XXCA 2DW4A 4N4NB 2FMYA 3WE3A 1EH8A 5E3NA 3ZRGA 1DPRA 1EKEA 3K4JA 3RTRA 2M4GA 5KHDA 3IRQA 3GYHX 4EJTA 5JHUA 1Z1DA 3IUOA 2A6TA 1BM9A 5D8LB 3CMAI 2A68F 3PFYA 2E2HK 2V6CA 5E3MA 1W5SA 2HVSA 1FYKA 1GV5A 3QOEA 1MBHA 1SFUA 2ZMEB 2CGPA 4DYRA 1WOSA 2NVQJ 2DK5A 4RAGA 2OBPA 1XSDA 1TP4A 4P55A 4QJVB 4HQEA 2E2HJ 3L1PA 2EV6A 3G71I 4WWCA 4M73A 4OMYA 4E7HA 1D5VA 1BOBA 1R5GA 1TWGJ 2R7ZJ 1FEXA 3S1QC 1DUXC 5EGHA 2K86A 4IHSA 4A5NA 4RB1A 1K83K 4A3KC 4RMNA 1YIJI 1VGXA 5D6FA 1OQYA 2F5VA 2E1MC 2QEXI 3C7JA 1BC7C 2DJNA 4EJVA 2KRHA 3PO2C 1LVKA 1ZGAA 2XAQA 2QKLB 1J59A 4ZYDA 4KASA 1WZ2A 2WAQA 1ERDA 1LDKB 1MDMB 2CQXA 1DCPA 4CHUA 3FOEA 2WTEA 1DP7P 1IUFA 1MJ9A 4W1UA 5CVIA 4B09A 1YW9A 2R5ZB 3VFZA 3TMOA 4HLXA 3MWMA 5FLVA 3FKIA 3DEEA 2H27A 3HHHA 3C18A 1H8AC 2LKXA 2BY1A 3T8RA 1BI0A 4RB3C 4YFNF 1A35A 5L46A 1FNNA 2KHMA 1K4TA 1IDZA 2K7LA 1ZBSA 2CFAA 3BCAA 3TOBA 3WG7H 1B72A 2NVTK 2E2IC 2Z99A 1OJLA 1G3TA 5GP9A 2XROA 3TO7A 4LQYA 3JRCA 3N0CA 3FK7A 2X48A 4MLOA 3TBIA 5EF6A 4KMAA 2IT0A 3S14K 5FD6A 1HQMA 3S32A 4YG2A 3ECHA 4D7MA 3FX3A 1M1EB 1FPQA 1OMIA 2OV7A 3GTGJ 1XCVA 1IF1A 2RQPA 4LB5A 4AVZA 1EF4A 4XLCA 3WTUC 4FETA 4FQGA 4A6EA 4XLHA 3J7AO 3AQPA 1S72I 2R93J 1P6RA 1PP7U 3F23A 3RPQA 1B9MA 4A93K 3OIOA 3OYEA 4CH7A 1ITYA 3CJRB 4C9YA 3RQ4A 2DPDA 4BXXK 3DBLB 3IC7A 4GT9A 3MVPA 1TTYA 3BR1A 1QZZA 4LIUA 2OJED 1X58A 4I09A 1MGTA 4Y7NK 2L2OA 2FQTA 3JSPA 3MKYB 3BJAA 1IUYA 3E3VA 4WILA 1B4AA 1GVJA 1QZEA 4A3MJ 2JWTA 4OIOF 4KN7X 3CDLA 2VPRA 1R9TA 4A3DK 2BV6A 5BPDA 4CCKA 2ZSHB 5DV5A 3WODA 3OOPA 2LG4A 1O27A 5K5OA 3KX2A 3VSKA 5F27A 3SZTA 3BOQA 2ESHA 1NG6A 4YFNA 1DGWY 1T98A 2QA4I 4OIPF 3E6BA 2HDWA 4JOMA 4YEJA 4ZH4A 1IGNA 3N0BA 5CHPA 3CDHA 3N3YA 4M9SA 4I01A 5TRDA 3F8NA 1OR7C 2WAQL 2CQ7A 5E3LA 1P92A 3QWLA 4AM3A 1HQCA 4E70A 2DTRA 2K85A 2V1NA 1I3QJ 3CO7C 3PJRA 4A3IC 3GTPC 2OQGA 5F6FA 5HLTA 2IAIA 2KJCA 2STWA 4MEXA 4L5JA 5K1YA 1B59A 3FDYA 5FRNA 2H8RA 1V5FA 1VQ9I 4IOAF 3FKIC 4H4KC 1Q1HA 4D5CA 4BJTA 2DU9A 3BZCA 2F48A 4IHVA 3I4PA 2ZXJA 2EIKH 5LGTA 4KM8A 1LDDA 5CYVA 1FY7A 1ZG1A 3S1QJ 1Y1VJ 4HLYA 1V5VA 2JA8C 1P9QC 4FHTA 1PJ7A 2X6WA 4BAYA 3TEDA 1D1AA 2XKPA 3Q0WA 4I76A 3HJEA 3A1YA 2DA7A 1SAXA 2CV1A 5CVRA 3V7CA 4P96A 2GXBA 5FROA 2NRAC 3N05A 4KITB 1IW7F 1SD6A 3GIRA 1KU9A 2RV8A 4KT5C 4A12A 3JTGA 1O2BA 3JSTA 1FSEA 1XDSA 4ZDLA 2HFHA 2KRFA 3T01A 4L9VA 1VQPI 5IYBK 1TWCA 4OIQA 3DEUA 3DLAA 3SZPA 3ZQFA 4M6VA 3GEHA 1I5ZA 4DGWB 4CYCB 3GMEA 1TBXA 1OCTC 2COMA 1HBXG 4GTLA 4A3KK 2R93K 3C1DA 3KZYA 3QYFA 3QPLA 2VODA 4LLLA 3S1RC 2QQAA 1VQ4I 1XSXA 5H6RA 4EGYA 2DCEA 3WODF 4XLPF 5D5VB 2GOXB 4X1EA 1VQ8I 2H1KA 3ZQ7A 1O3QA 2DTZA 2R7UA 4X6AK 1IXRC 2KKOA 3SEQA 1XXBA 2A5YB 1J9IA 4HG2A 4CCMA 4PAAA 2B9SA 1BR2A 1WJEA 4UB8C 3WGHA 5J6XA 2YR2A 1E3HA 5H6QA 4HDUA 4OIRA 1T33A 2Y30A 1TZLA 2FQOA 4ON0A 4XK4A 5K7FA 1E3PA 3HM5A 4HEA2 4G12A 3I55I 4HRIA 3HXAA 1USSA 3WTYC 1JE8A 5J1RA 2TRTA 2VQHA 4KYWA 5DYMA 3I58A 1ON1A 1O2FB 4M9ZA 1G2HA 2EZHA 4BXXC 2RNGA 1WQGA 3BWGA 1R23A 2ID3A 2VI6A 3GF2A 1S7EA 2D2WA 4IHTA 4JQFA 1R36A 2IJLA 2J5PA 2LTPA 3OL3A 4HA8A 4CCOA 1HA8A 3JCUC 1ZELA 4L9NA 1XC5A 2BE5A 2M5WA 3HG9A 4G0UA 1QRYA 4Y3OA 1I39A 4BU2A 1VQ5I 3GZNB 4NDLA 2QBYB 1KU3A 2FQ3A 1GDTA 1PDNC 1OCZH 2MLKA 1S7OA 4GRIA 4BBRK 4G7ZF 2H09A 3DP7A 2PMZD 2DDBA 5A2QZ 5IYDJ 2A6EA 1IG7A 2MH2A 3PNVA 1D8KA 3TQNA 2BVLA 1XZPB 3E5UA 2VJJA 4PSXA 3PIOF 4XLPA 2PJPA 1HW5A 2DN0A 1Y1VK 2BYVE 3S2HJ 2NVXC 5EGOA 3I54A 4KDDA 4XLEA 4EM2A 1HLVA 3GTKK 1ZAOA 5C4XK 1GVDA 2NVYA 3LA2A 4E6KG 3ZOBA 1VLOA 3B6CA 3DBRB 3L4JA 1ULYA 2YSRA 1IN5A 1RIOH 4KNYA 3U21A 4M3EA 4M3BA 2QQ9A 3HOTA 4XN3A 4KN4A 4S05A 3GTJK 2W82A 1BI2A 4UV8A 1W5TA 2M7BA 4BS9A 2GAHC 1INNA 4Q5SA 1LVAA 3QAHA 2LLKA 2E2IJ 3PFIA 1KYWA 3SZZA 1IBAA 1EQRA 1SFKA 5AIPA 1AOYA 1WQHA 3K4LA 2LDUA 1IW7A 2D6FC 2XCOA 3PNTA 1WCMA 4ESJA 1VNDA 5M5WK 1X1AA 1B9NA 5ILVA 3G2BA 4XIDA 2V9PA 3ASOH 1ZQ1C 3JTHA 4A3LC 2GZWA 5E1XA 3HRUA 2XAHA 4J01A 3HOZC 4FZBA 2VKVA 2A61A 2DA2A 4BKXA 1PJRA 1JJ8C 2UWMA 5BPIA 4PJ0C 1IC8A 5HS7A 4I6ZA 1HSTA 2ZUFA 3LSRA 4HNTA 3A8JA 4M6XA 4FE7A 1TWCK 2ETHA 3WHBA 5IOZA 3RZOC 3AH5A 1KA8A 1MKMA 1T56A 2E60A 1Z7LA 4FASD 3OOUA 4LOCA 1IRGA 1F36A 3SJMA 4F52A 2HYJA 3V8KA 2Y0SD 1G59A 5IYCJ 1R7JA 4A3BC 1ETXA 3S14C 5JI6A 2KZGA 2DMNA 1S7AA 2V4JC 3DPLC 2JA7J 5C4XJ 1ON2A 2TDXA 3K10A 4D1QA 3HSEA 4MQ9F 3WGIA 2O5JA 2DFIA 2A68A 4HF2A 2FBIA 3CQZK 1Y1WJ 2BXZA 2VT3A 3NEUA 4LR2A 1FYMA 2F5EA 2H8WA 1U8BA 4ENKA 3A4CA 2RREA 4E7KA 1FT9A 1QNTA 2BZTA 5F0FA 1R9TJ 2CW8A 2BHZA 3RKXA 3M1CA 4RMFA 5FLXZ 2R4GA 3OYCA 2UXNA 3KYLA 1R4NB 2HGCA 4HF1A 2KIUA 2P7VB 3Q9SA 5AIQA 4CXFA 3O8GA 3MZYA 5CVUA 3HOWK 3I4MC 3OR1C 4ENJA 4B1RA 2Y0MA 2W48A 3L2VA 1Z6TA 2ZXHA 2HDDA 4A3FC 2W7NA 1D1BA 1BIAA 1UMQA 1R1VA 3OR2C 4HBLA 1TWAC 3LOCA 1B72B 4QWQA 1XGMA 1REPC 5BOXA 2CWEA 4A3CJ 5IOSA 3AG3H 4QPOA 2XASA 2OZ6A 1WQFA 4ABZA 5EGEA 4Y52K 3I4MK 1A6IA 3UNGC 4H0EA 2LMDA 3UKGA 4PABA 1W0TA 2QVOA 4BQNA 2WB1D 3U1KA 4WF2A 1Z9CA 1B8IB 3I64A 4OAZA 1FBSA 4Y4RA 1P4AA 3AL0B 4RGRA 1BBYA 1MDMA 1OFCX 3KP4A 5E79C 4ZYGA 4K2EA 3WTSC 3HB9A 1USTA 3H5NA 1XPPA 4C2MC 5E1ZB 3MQ0A 1NH3A 4Y52J 2NXNB 4CCLA 3H0GK 2L7ZA 2CUZA 1VI0A 4CA0A 2QSHX 1FTTA 4XR6A 3GTMK 4EJUA 3FMSA 3CD6I 1J0RA 4XOTA 4MO7A 1O26A 4BY1K 3FMQA 1XTAA 1AHDP 3O3KA 2L3DA 4BY1C 1IZ1A 1R71A 3LSTA 1T39A 2EPFA 1IE0A 3P9IA 4XOPA 2DYSH 2M7AA 2CW0F 4RAFA 4ZYHA 4M72A 1NTCA 2KMUA 3MAJA 3CLOA 3S1MJ 1L0WA 4A3JJ 2B0LA 2VOOA 5E68A 3SZYA 2GAGC 2R5YB 2CFOA 5KCMA 1S9HA 4N0BA 3HXLA 5HDKA 1LKXA 2UV1A 2XUBA 2Z33A 5EEHA 5FJ8J 1IJWC 1T8IA 3RZOK 1YHQI 3OREA 4MFDA 5ICEA 2EFPA 2OD5A 1QA6A 2DDAA 2P81A 1ZVUA 5C44C 4IHYA 1WSUA 4XLAA 3CAGA 1WCMJ 2LY2A 2R92C 2FA5A 1OYIA 2VE9A 4Q4ZA 4HNUA 4F91B 4AWXB 2VBXA 1I50K 1P4WA 1ONVA 2BY0A 4RB0A 1S5LC 1Y0NA 5LGNA 1MD0A 2DMTA 2IS6A 4LK1A 3H1CA 1MSEC 3FXUA 3QPTA 3U2RA 5E20A 2D5VA 2ISYA 1WOPA 4IL6C 4FCYA 1QPIA 2DA5A 4OU0A 3MCZA 2EA4A 1YNJA 2LVSA 3GTQJ 1K78B 3TDZC 2IBDA 1R9TK 2XDVA 4XLFA 5DEQA 4AYBA 1BI3A 5HLHA 3AD8C 3FMRA 3HEFA 2PA8D 1D8JA 2KIQA 2PJRB 4BDZA 4A2UA 2IS1A 1FBQA 1IDYA 4OOIA 1PUEE 2DPUA 4XSZA 1POGA 1ORKA 3W3CA 4OMZA 1X3WB 1HCRA 1HOMA 2BEOA 2QZ8A 2W57A 5TJJA 2E35A 1GXPA 4P9FA 1ISEA 2Y3PA 1N75A 3GTMJ 2JA7A 1YW8A 4LMYA 3R61A 1P4XA 3H9GA 2HPIA 5K7HA 1SFOA 2PLYA 1LE8B 1XZQA 1XDUA 1TQPA 4L9JA 3I56I 2E2JK 3OS2A 3GTOC 1XXAA 2E2IA 1Y6IA 3EQLF 3A8KA 2F4IA 4G7HF 3VSLA 5EG0A 2E2HC 3S3NA 1X1DA 1ZR4A 3BP8C 4O5VA 3BG7A 2NYXA 4G0WA 3BG3A 4KT6A 3FXOA 1WQ2A 1YS6A 2MGQA 5LLQA 3M4OJ 4BBRC 1QHHD 3S16J 3I3LA 3HOZK 1MMDA 2JA5C 4XSXF 2R3SA 4M71A 4IPAA 2XPVA 3R4KA 3HRTA 3MKWB 2L7KA 4WJ4A 3FXRA 3V8JA 3OYDA 2H6BA 2LF7A 1K79A 1O24A 1VH2A 3L2WA 1VQNI 2GQQA 2CV0A 5JLWA 1MZBA 4A3LJ 2IGKA 1QU3A 1HF0A 1U78A 2DA1A 4DYQA 3ZQGA 1YFHA 1JT6A 2NVTC 3WU1B 1B1BA 3BUEA 1T38A 4CYDA 4OWRB 4B3XA 2DBBA 3DU5A 1TT5B 1O7LA 2P5LC 3K4CA 4RB2C 3HTSB 4C3HC 2VC0A 4WXDA 3ZQCA 1JQWA 4XKWA 2ID6A 2M4KA 4GDFA 1W5CC 4BY1J 3CCQI 3M9AA 1XGOA 2DOEA 2JA5A 2V9KA 5B1AH 5F1RA 5E18F 1RUOA 2IGMA 2L02A 4ZDPA 5M3MK 1T95A 3NARA 3SXYA 2ZUEA 2HVQA 4HV6A 2ECCA 2ZJPF 3HOXJ 1RPWA 3OYFA 5IYCK 2VT2A 5EYRA 1W36C 2KP6A 2KWAA 5GAGJ 3E1SA 3TW6A 1ODDA 4QPQA 1F7UA 1Y56A 3ZMVA 3DPTA 3WHCA 1VJEA 4OIQF 4PJJA 4Y7NC 1SVLA 2UZKA 1JUPA 2G9WA 2HOAA 3BQYA 4D0PA 5F1JA 1TWCJ 2JRMA 1Y1WC 5FLMK 3W6JB 4V2GA 4UUVA 3LNQA 2JPBA 1T6SA 2P4WA 4M3GA 3DTKA 2Y48A 4A3FK 3MZHA 1YRNA 4XNFA 5HL8A 3BR2A 2L54A 1TWGK 2R7ZK 4XICA 1ZRCA 4KATA 1BDFA 4HV5A 4A3BJ 1F5TA 4QIWN 1EH1A 4ESFA 3QU6A 1HW1A 5HLIA 2VBZA 4C2TA 1UFMA 3I4NJ 4A3FJ 4UUSA 2EZIA 3CC4I 2CYYA 4XLNF 3K1PA 3Q0VA 3OPFA 1JXSA 4A3KJ 1FIAA 2CG4A 2A69A 3HKZL 4I02A 1A04A 1UAAA 3ZQIA 2MBFA 1F9NA 3FKIK 2B63J 1IN6A 5E8GA 2RH6A 2LRDA 4IJAA 2QLZA 3GCMA 4ETSA 3LSGA 2XAFA 1B8IA 4C2UA 5M3MJ 3DV8A 1I3QC 4BACA 2HQRA 3RQIA 4DW6A 3L2RA 2LF8A 1TWGC 2R7ZC 1LEAA 1P7IA 3G1LA 4QTRA 1SFEA 3I71A 4KUMA 3EUAA 4NQWB 3MKLA 5LRRA 3WGGA 4D9JA 4YG2F 2EJRA 2QKMB 4Y33A 1HKTA 4BLAA 2DJIA 3J81Z 5DCMB 2ELKA 1W0UA 3FBIB 4RAYA 1L0OC 2QQBA 3GVAA 3GTJA 4KB4A 1IXSB 4I99C 4YIIA 3PUBA 4O2DA 3M3YC 4XSXA 1EH6A 2NAZA 2E1CA 3WTXC 2XSDC 4BQQA 2OQRA 1BJAA 3F22A 5LHIA 3EUHC 2V79A 1KU7A 2E1NA 2HZTA 4EGZA 1CF7B 2EWNA 3BDDA 1DPUA 3ML6A 3CESA 5EGOB 2ADUA 3BZKA 3M8FA 3VPRA 4HF0A 1AA7A 1T0FA 2NS7A 2VUMJ 4XMYA 4G8XA 4NBQA 1RETA 4OINF 5IOTA 3K4KA 1Y1VA 4B43A 2XRNA 3M3YK 2LD5A 2Y9ZA 3G1MA 2R93C 3CUQA 1Z21A 3I9V2 4KJZA 2X1CA 4CCNA 2NVYK 3I4NK 2OCCH 4MEXF 5L3GA 4D7NA 3K0LA 2Y31A 2N8GA 5DDGA 5LEKA 2ICWG 4A3EC 3C2HA 5HNFA 2D1VA 1I1SA 5D5UB 3NAUA 3A0HC 2BY2A 3T5XA 3RZDJ 2YPRA 3H3UA 4JYKA 5LD2C 1WFXA 3HTUA 4AH6A 4AIKA 2X51A 3S1NK 1ZQ3P 3GTQK 4A69C 1IV6A 2G7HA 3AQOA 2Q2EA 2JH3A 2WWYA 1JUSA 5C44J 1DU0A 4A3DJ 3O6BB 2K9QA 2AO9A 3M1EA 3ZQHA 4GTCA 2ZFZA 1OCCH 1LDJA 4BLBA 2YU9A 4U88A 4E7ZA 1FYLA 4A3EK 3PSIA 2JPCA 3COAC 2FXAA 2OTJI 5C3EC 1BI1A 1J7KA 2ISZA 1IXCA 2JT1A 4UUSB 1WVRA 3GTQC 4BY7K 2E1OA 3ZGKA 5BMZA 2F4OB 1YYVA 1BW5A 4A3IK 1QVUA 4LLGF 5JFEA 3R0AA 4UVCA 2ZBKA 4YIRX 4IVNA 5C4JC 3GTQA 3GDZA 4E4HA 1ZYRF 4RGUA 4ENNA 3A0BC 1ZGJA 3ZP5A 1KZHA 4GFQA 3I4NC 3MKZA 5CQGA 1Y1WK 2VE8A 3NUHA 2V1DA 3GTJC 3M4OC 2BGCA 2FF4A 3RI4A 2ELHA 1HC8A 4GYGA 1TW2A 2JA7K 5IY5H 5LFAA 3PIPF 3JRIA 1MSFC 2XCRB 2B63C 2CUJA 3Q3SA 1X4PA 2WC2A 4XL9A 4KARA 5JFRA 2DI3A 3K6GA 5HOOA 2LH9A 2VJIA 2WAQN 2ZMEA 3F6OA 2HTSA 3LFKA 3RZDK 3VYTB 1OLTA 1OR7A 3KZIC 5HVQC 2KDZA 1EK8A 1XMAA 3BR5A 3KYDB 4R1HA 1FJLA 3C2GA 3OYAA 2R7VA 3GTPA 4ZYAA 2P7CB 2R92K 1SVMA 2W84A 1MMGA 4IRGA 1BJTA 2BBYA 3CLQA 3E7LA 4F3QA 5J40A 3HOVJ 3AG2H 3ZQQA 1S8NA 3PQKA 4RBOA 4MEYA 1XX5A 3CCJI 2CH0A 5EZGA 3CZ6A 2GA1A 3TP3A 2JA6C 1VFCA 4C3IC 4YFXA 2FQ4A 5CPRB 2ZMEC 2O9LA 4HX7A 5IPAA 3T02A 3LSPA 3AL0C 2QUFA 3D5RC 3LMMA 4Q4ZF 1X3UA 2HOEA 2HZDA 2W24A 1TWCC 3H3VD 5FRMA 2ZNYA 1WIHA 4DQ2A 1XMXA 3PNYA 3J7YJ 1I50J 5CQEA 1D0ZA 4FISA 1EA3A 1V55H 2ZXIA 5BNGA 4IRHA 1SANA 1ENHA 2HQ5A 2A69F 3L09A 4L18B 1ZYRA 3BTCA 3K1MA 2A6EF 3RIRA 4L0YB 1WOOA 3AKZA 1QGPA 3BTIA 3HPGA 2A6HF 2NS8A 5K7ZA 3J80K 2DT5A 4ILDA 3H35A 1SD5A 1ZKGA 4GGGA 4DNCA 2ZNZA 3KCCA 5GTIC 2CUEA 1U9NA 2ZFUA 1YE9A 2NVXA 2RGRA 2GSNA 1K83C 3CDIA 1UELB 2E19A 3LWFA 1U0JA 4AIDA 4DIQA 3ZMUA 2OF7A 5IYDC 5L3BA 3L4KA 3DFGA 4NC8A 2BY3A 5IT9Z 2JTVA 2HU9A 2EINH 5C3EJ 3HRSA 4C3JC 2QM3A 5BS6A 2KJBA 1J6XA 4M3DA 3LA7A 4KMDA 2V26A 2MFZA 5L3CA 2W85A 4BDYA 3A01B 1FSHA 1YITI 5M5WJ 2LREA 4R79A 3C3WA 2V7FA 3ISPA 3JRAA 2MW8A 2WB1A 3F8FA 3BJOA 3B6AA 3PO3C 2K02A 3G4SI 5J3LA 2JA5K 2AQFA 2LY9A 5EEAA 2X4HA 5TISC 2EFQA 3ZN0A 2D45A 1KQ0A 3E6MA 3WTVC 4L5EA 2IVMA 4G6TB 1YJ9I 4U0VA 5IP9C 2GIZA 2DQRA 5JVGF 3MN2A 3GTJJ 4ZTJA 1TT0A 2Z5UA 2KFDA 1X4OA 3AD7C 3S17C 3C2BA 1QZYA 1ETWA 5FD5A 2E2JC 4X6AJ 1Q1VA 4PZJA 1O3SA 4Q5SF 2R0QC 4KIFA 1R5ID 3HL2A 3GTKJ 2NVQK 2DAOA 3H5AA 3FXJA 1FLIA 1MNDA 4P9UA 4OIRF 2DXIA 1TL8A 3L2QA 2MA3A 2JMWA 2XF5A 1I3AA 4CICA 4RAZA 1WWXA 1PUFA 3BTJA 3R60A 3HSFA 2IPQX 3F8CA 3F8MA 3GFMA 5DD4A 4RDUA 2IS4A 3BQZA 3S2DK 3UR3C 5L3DA 2FSWA 1K7AA 2W00A 4MEYF 4CZCA 5J8CA 3RCOA 1UHMA 3BCBA 3M7GA 1WI9A 2PMHA 4KMHA 3OIQA 1TC3C 3S1MC 2VKEA 2JA2A 5KVRA 5M5XK 1F4KA 4LLNA 2Y0SA 1MJAA 1SD7A 2CU7A 2IA1A 4A3DC 2CO5A 2M87A 1YRNB 3I5UA 2HVRA 1TW3A 2V6EA 3HOZJ 4KC6A 1G3SA 1I6VA 3IH2A 2CFXA 2PMZL 1WJAA 4LG3A 4C3HK 4ZZDA 1X1PA 1D5YA 1IN8A 4G0VA 2K5CA 3DLLF 4MIMA 1WH5A 3U1DA 3KP2A 4IX7A 2VN2A 4LG0A 2V6TA 3CP8A 3CUQB 1TWHJ 3S1NJ 3OSFA 1JGSA 4NB5A 2DK8A 1X1BA 4IO9F 2F5DA 3OV8A 4HAMA 3A01A 4AIJA 4Z6YA 5IYCC 2PMZN 3P5JA 3GTLC 5C4JK 1VZ0A 4M74A 5FB2A 2JA7C 3HDDA 2LSOA 5FKNA 2LKPA 5D6EA 2H94A 3S15K 1FBUA 3CP2A 2EFNA 2P6TA 3ELKA 1BGWA 3B73A 3BZ6A 1KGSA 3LFUA 4CO8A 3GO5A 3D0SA 4EM0B 3QP6A 5FKKA 4A3CC 3K7AK 1IQ0A 1JTXA 4DBQA 1XG1A 2XKOA 2AQEA 2E7WA 2XVCA 3CMEI 1ETQA 3E6CC 2R7FA 2KIFA 3IKTA 4I0BA 2VONA 2HOTA 2VXZA 2GSOA 1I3QA 3HBLA 1A6QA 2HXOA 4ZYEA 2GOMA 2ZJQF 4G7OA 3EUHA 1H0MA 1V5EA 4A3MK 4A3IJ 1W36D 2CSOA 4II3A 3CC7I 3GEIA 5DTDA 4BQOA 1V5GA 1Z77A 4FX4A 3DCFA 3GTOJ 1TWAJ 4NNJA 4DBRA 3GBGA 1KQ8A 4GTEA 5D8KB 2BHYA 3AG1H 2M0CA 3BG6A 1WCMK 1IO2A 1X1CA 1V3FA 2CQNA 2LK2A 2XB0X 3ABLH 4U0WA 4C2MK 4G7ZA 3KETA 1JGGA 3P7NA 2RQQA 4ANJA 1YG2A 2I8DA 2WV0A 3LSIA 2GLOA 3DTIA 3HOXK 2FJ1A 4WX9A 4U7DA 3CMMA 2NVUB 3FM3A 1O3TA 1NK2P 1JT0A 2VXDA 3IRRA 1JVIA 5FGMA 2F4MB 1WJ5A 1ZR2A 2QF7A 3RJPA 1K83A 4Y52C 3RDIA 3GWZA 3ONQA 2R7SA 3S1MK 3VDXA 5CVVA 4BEHA 1MIJA 4A6DA 2YX4A 3ZCOA 3HOSA 1TWAA 1I50A 2EBIA 3HRMA 3IAS2 4PGGA 1TWFK 3HOYK 2K40A 3RKWA 2VQGA 1YX3A 2KISA 2VQLA 1XGSA 2E71A 2PHCB 1IN4A 1SAUA 2FU4A 3BR3A 2B7EA 2FEZA 2R7DA 2R7QA 4UNOA 5IP7J 3BP8A 2LOOA 4UB6C 1C0WA 2KLOA 4PUSA 4AD9A 3QYEA 4BJ5C 1F93A 2P5VA 1HW2A 5FLXK 1BA5A 1ACIA 1J6VA 3HOVK 2K27A 4XSZF 3CCUI 3DKYA 1TNTA 3HGYA 3OSGA 4KN4X 2OPTA 1T08B 1T0FC 3KLNA 4M9XA 1I27A 1RUNA 1AU7A 1DCHA 5CJ9A 5DUIA 2RGVA 2IW5A 1R6RA 3FM5A 2L4AA 2JSCA 1Z91A 4G6QA 2PFBA 4MHGA 4I2OA 1O25A 4A93C 4YFKA 2JA6A 3H9QA 1DGRM 3D1NI 3RKQA 5DD8A 3MEXA 2CW7A 5DS9A 2MD0A 3NWTA 2XC7A 3Q9VA 3CCLI 3H0GA 3GTOA 2M45A 3FZVA 3W6KB 2EZKA 2MABA 1Z0XA 2FNAA 4G7HA 4BEHB 4LLGA 3Q5FA 2Q2EB 2CUFA 3R0JA 2MC3A 4XM3A 1ETKA 2Z1DA 3HPHA 2R7WA 2R5YA 2EK5A 3F8BA 4XRSG 4FT8A 3HOUK 2JK3A 4HPQA 4IF4A 5CVJA 1MBFA 3GTLJ 2MSYA 3CC2I 4PFPA 4MFEA 3VYSB 1SVOA 1ZHFA 2E34A 3DKWA 1O7FA 2ZXWH 3BTLA 4RM2A 3V7SA 3QP5A 2M9HA 3CCEI 3S2DJ 3QPSA 3S93A 2GXAA 1RKTA 1K4SA 3BPVA 4IOCF 1SEUA 3OYLA 2FUG2 4I0AA 4LK0F 1SMTA 1YS7A 2DMUA 4GYIA 4E7SA 4XRMA 5E3OA 3MZ8A 2CS3A 2DT6A 2MLGA 1OYWA 4X6AC 2NOJB 3ZMDA 1FX7A 3DEWA 1GHCA 3OYNA 1LE8A 1R58A 2AXTC 3RYPA 1UHSA 2WBMA 3EETA 3KEYA 1BN5A 2VQCA 3I59B 3FBNB 3WU0A 4Q47A 1JHHA 2I5UA 3H5RA 4KIGA 5D4RA 5FLMJ 1HKSA 3KEOA 1SFOC 5M5YK 2ECBA 2LBFA 3CJQB 4XONA 5D4DA 2FOWA 1U6GA 2EIJH 2DA4A 3S17J 5IYBC 3IHUA 5J1YA 3ZR8X 4BQAA 2XCQA 4WK8F 1G3YA 5F08A 1XN7A 2E1MB 2WA0A 1R49A 3K4NA 3JRBA 4MQVA 2QGUA 5LRSA 5IP7K 3CJNA 2PMZA 1K78A 5DUKA 1A31A 4BY7C 3M8JA 2ACJA 3QQAA 3VYRB 2YUSA 2YS9A 5HDGA 3KIOA 4HX4A 4A3GK 2IXSA 2CFAB 3AG4H 4U87A 2JUCA 1FOYA 3BG5A 1OKRA 3HUGB 5DCMA 4EQQA 4XRSA 1ZG5A 2YU9C 5B66C 4LGWA 2XGEA 2OAZA 5GPCA 2IEKA 4V19K 1Y8RB 4LD5A 4ZH4F 2XF6A 1YCLA 4JK1X 2L7FP 2HYFA 3X2QH 2OA4A 2FBKA 3K69A 1JJ6C 2M34A 4BBSJ 1TWHA 2O5RA 3QPHA 4DDQA 3F9KA 5D4SA 1TQIA 5KNLA 2DODA 2V1UA 2DYRH 2Y0SN 2XIGA 4Z2YA 5J4VA 5JVTA 1X31C 1IV8A 4DYCA 2XPWA 3ZPLA 1YNNA 3RPUD 2X9DA 2KQRA 3BY6A 2PMUA 2C6YA 3BT9A 3S3MA 4E7LA 4C3JK 2PBIA 2YX7A 4CUGA 4ESBA 1WHUA 3S14J 2NOGA 5EZHA 2ME0A 3S1RK 3W2WA 2NVYC 3HOWJ 5IYDK 1LUJB 2K9MA 3K2ZA 1JOEA 2X85A 1D1CA 1XD7A 4L9TA 1JI8A 1UG2A 2W4SA 3TOAA 2LKSA 2EILH 3RYRA 2DFHA 5FJ8K 4ITVA 3EDPA 4N9HA 3IP4B 2XPUA 1U3EM 3ULQB 2L0KA 3H3ZA 3K1NA 3SDBA 3EYYA 1BIBA 1YTYA 1Y1VC 3JRFA 5HDNA 3QYBA 1V4RA 1Z05A 3LQRA 1ETOA 4UVBA 1R00A 3S15J 1DU6A 2L01A 1WRJA 3FWEA 2XV4S 4PDKA 4QLCU 2PPBA 2JQ7A 1GLNA 4CZZA 4EV0A 2LP0A 2NVXJ 1XS9A 3DQVC 5EDNA 4A3BK 3IPJA 4C30A 4UY8I 1FOXA 3IWFA 2O8KA 2QCOA 3B02A 4M6YA 1ZXOA 2LY1A 3BLYA 1KQ9A 3CUOA 3KEQA 2EFWA 4IKFA 4W97A 4P9SA 1KYZA 1E2XA 2W25A 2XAJA 1WPKA 3DTEA 2GA2A 5HS9A 5HLGA 1MMSA 1GE9A 2L9RA 1I6HK 3T0YA 1R1TA 1HSJA 1W4MA 3OYBA 3JSOA 4HOBA 4IZZA 2ME6A 3GLLA 3REOA 1X3ZB 2Y69H 1O28A 3ZMTA 1ZLJA 3VB2A 2LBFB 4RLQA 3M3YJ 5H20A 5EG0B 3CF2A 4B8XA 3OYGA 4OIOA 4A3GC 3DWLE 3V7RA 2K4BA 2R7OA 1WSVA 1X2NA 4P1WA 1HI9A 2QBYA 4WJ3M 3RZDC 3EYIA 2HS5A 1WORA 2R92A 1XSVA 2FMLA 3TW7A 1LNWA 3QX3A 4AYBN 3F72A 1TWFA 2VUMC 1RESA 1FOKA 4GTBA 2X6XA 1AKHA 2EV0A 2M0MA 1W7PD 5E1WA 1BC8C 1G3WA 2UXXA 1DQUA 2M3AA 2JA6J 4XCHA 4J00A 1EH7A 2JVHA 1PVEA 4UV9A 3WTWC 2PI0A 4IEJA 1V54H 3TFJA 1BW6A 4LIVA 1IS1A 4M3FA 2DFEA 2PJRA 4AYBD 2R93A 1K6YA 3J81K 5M3FJ 3S1QK 4YELA 1YIOA 2ZSIB 3TL4X 3ADAC 3HIFA 4ZC3A 3TFHA 1IL2A 4U0YA 4FTHA 3GTLA 3O2PE 1CQTA 2EH3A 3K70C 3GTGK 1R9TC 4O6JA 5HS8A 3G73A 2PEXA 2RC4A 4QJVA 1SD4A 4KA4A 2VOPA 3S16K 1Y1WA 2O6GE 1FP1D 5C4JJ 4IHWA 1E0EA 3FOFA 3DXJA 2O0YA 1P7JA 1O29A 2ZJRF 5FKOA 1UCRA 2YU3A 4FX0A 1D0XA 4F93B 3VWBA 1G51A 2VJ4A 2DFFA 2EIMH 3OYKA 2O61A 3TP0A 1J98A 4MGRA 3HOWC 4WCGA 1MH4A 4B48A 5ILUA 5GAEJ 2CV2A 2GSUA 1WJDA 3CCYA 3HSRA 2A07F 1BOAA 2HYGD 5DCFA 2WY7Q 3EPZA 5L3FA 1JKOC 1T2KA 2HQAA 3KP6A 3S2DC 3VODA 3K4MA 4LB6B 2WAFA 3ABKH 5ICCA 4JBAA 1LEBA 1S6LA 2J5OA 1ETYA 5D5XB 4BE2A 2RAEA 4XORA 3JAMK 3CCMI 1VRQC 3AFHA 3AD9C 2O8XA 1U5TA 5D5WB 3AAFA 2Z3YA 1APLC 4A3CK 3IKVA 3MMYB 1G4DA 3PO3K 2DLLA 3TDUC 4UHTA 3OYMA 1YJNI 1MW7A 3RPUA 4LITA 1IAWA 2QSFX 4BHPA 4Y13A 1WSRA 4FM9A 2FD5A 2QQ8A 5ICFA 1VQLI 3MFKA 5GAHJ 2OCEA 4JX5A 1MBJA 4B47A 3S16C 2M8EA 2ZJ2A 1Z6RA 2P8TA 3VYUB 4MTDA 2X0LA 1JKRC 4NUBA 2VB6A 3BG9A 2HTJA 1J5YA 2WV1A 1LFBA 4EEFG 3CUQC 3W2AA 3OYHA 2MH9A 2RKHA 3D5LA 1XCBA 2ZO4A 4JK1A 3S2HK 5FLMC 1FMVA 5JLXA 2PN6A 3GEZA 2ESNA 3D5SC 3ZMSA 5IT3A 2F2EA 4WXHA 1UZCA 2VPLA 2MYSA 5IYBJ 3MMLB 1KONA 2V1XA 1JKPC 4LJZA 3TO9A 9ANTA 4MTEA 1QQIA 3CTAA 4GO1A 3S3OA 5IP6A 1N78A 2A6HA 1VF9A 3GW2A 2V9VA 5HNHA 3KPHA 1UHWA 4YFXF 5FFZA 2P6SA 2KZVA 1GT0C 4JX4A 2GAUA 4J3NA 4YRVA 3TTGA 4BBSC 1BJZA 2OUMA 4MNUA 4BY7J 1RR7A 1YI2I 2E36A 1STZA 2K9LA 1I6XA 3ZMZA 3M07A 1RR8C 1RRJA 1X2MA 3FXMA 3Q0UA 4GCVA 4BHCA 3HOXC 4KMUX 2IA0A 2YU9J 4DOZA 1A5JA 1UG0A 4HSRA 3BR6A 2L7MP 2E2HA 3KP7A 4HSTA 1OCPA 5ICGA 2DMQA 2P5MA 2PA8L 1R22A 2QENA 3LAPA 5IOYA 4J19A 4NQWA 1SMYA 2DMPA 5F0HA 1QO0D 5C44K 1BR1A 1LJ9A 2X6OA 5KAIC 4KFCA 2FE3A 4CSWA 2BVMA 4R8HA 2M30A 4EJWA 2TCTA 1MJBA
chains in the Genus database with same CATH topology
5IOQA 4G6DA 2DO7A 2LNBA 1GXQA 4BH9A 1O2AA 3IL2A 3GUDA 3N97A 1ZLKA 4HW0A 4LG0B 1ZH5A 3NRVA 3S2WA 1XGNA 1TWGA 2R7ZA 3T1BA 3KZZA 1J2XA 5ERIA 4Y15A 2EV5A 3WTZA 4EVIA 3ABTA 1QPMA 1D3YA 4A0XA 1Z7UA 1KQ4A 1J75A 4XBFA 2GWRA 2H6CA 1U5TB 1ZRDA 3VOEA 2E7XA 4P5OA 3LA3A 4LFUA 1L3LA 2O03A 4HX8A 4EJOA 1AB4A 4IRIA 3CO6C 1TLHB 1ZARA 4O3MA 3T8TA 2VC1A 2IP2A 3FF5A 3TGNA 6PAXA 3WG9A 3KE2A 2VBWA 1U2WA 4A0YA 2RNJA 4BHBA 5LEJA 3E5XA 2IRFG 2GXGA 3ABUA 4KMFA 3K9TA 3KP5A 1EV7A 3QU3A 1TQMA 2HQNA 2PQ8A 1XMKA 4AVPA 4HYEA 1ZN2A 3HHGA 5IORA 1FWZA 4P5BA 3GTGA 3SHFA 4M1XA 1OYYA 3BROA 3ROUA 1DD5A 3FHZA 2HKXA 1PP8F 1W7PA 3I59A 4GXOA 4N9IA 3VEPA 1W7PB 2F5CA 1SFXA 2CQKA 3IWZA 4GTDA 1YLFA 2HR3A 4L5IA 1B6AA 1NHAA 2O3FA 3P9KA 4TV7A 3GTKA 4BKWA 3DXJF 1FP2A 2EFOA 2OZUA 4G7OF 3KP3A 2AXLA 3L7WA 4LJZF 3V8LA 1TNSA 3I0TA 3DF8A 4IXAA 3E5QA 3L9FA 3GFLA 5CLSA 3RKYA 2G7UA 4UVAA 3H92A 1YO5C 2NS0A 3F21A 4PGHA 3BJ6A 1U5TC 2L4MA 5K5RA 3G4AA 2STTA 1SMYF 5F64A 4YFKF 4KIBA 2XAGA 3PQJA 2D1HA 5ED4A 1DDNA 1U8RA 4RS8A 3SQNA 4GTFA 1QBJA 1HXDA 5LHGA 3JAMZ 4I98B 5AONA 5E8IA 5K5QA 4ZZLA 3TO6A 3E6DA 5TJ3A 3LAJA 1FZPB 4BXUA 3OEPA 5FFXA 4BYYA 2HEOA 4A5MA 4G9YA 3GXOA 3HUGA 1AWCA 2KIMA 4RGXA 1ZG3A 3QOPA 3LPXA 1RI7A 3BPXA 5FO5A 3V4GA 2XHKA 2RN7A 2P5KA 2RDPA 1B4BA 3KLOA 1CF7A 2HWVA 4HZFA 1ZRFA 2QWWA 2Q0OA 3ECOA 3ERED 3M8EA 2FRHA 1R1UA 2F5FA 3I53A 2ZFWA 4GTAA 2PG4A 3E97A 3L2CA 3GFIA 4KB2A 1H9TA 1I1GA 4PCQA 1S3JA 2Z9OA 2GIVA 2Q8KA 2FBHA 3L00A 3QRFF 3G4CA 4BNCA 2K4JA 2NNYA 3WTTC 1F1ZA 1Y0UA 3KFWX 5J8FA 5LGUA 4Q48A 4ASNA 1IRFA 3JW4A 4P5AA 2B63A 1E17A 3GZ5A 1FC3A 5E17F 3NQOA 1KU2A 4LK1F 2NNNA 3F6VA 4AIHA 2A3SA 4KICA 4S04A 4CGZA 2HDCA 5JR3A 5BQTA 3GLXA 5LBQA 1HKQA 1JHFA 2HKOA 2JZYA 5L3EA 1CGPA 4L0ZB 3CQZA 1O3RA 2M30A 3S0XA 1VTNC 5LHHA 4A0ZA 1O57A 2Y75A 4XRFA 2IA2A 4UXNA 4EMSA 1R5HA 2VUMA 4EM1A 3SFZA 2VBYA 4YIFA 2XGXA 3GTMA 1H9GA 3F3XA 4KM9A 1IN7A 3U9GA 1OPCA 1G6NA 3TKYA 2ZCWA 3Q3QA 1UB9A 3GFJA 5ILSA 1LQ1A 3N4MA 2EB7A 5KK1A 1P2FA 2ZKZA 5JVOA 3J80Z 4G94A 2RVCA 2DQLA 4NHJA 2FNPA 4KAWX 1XB4A 2FOKA 5IT9K 2AS5F 3GX4X 3GZ6A 4RGSA 3R6SA 3LQQA 3P9CA 1ZREA 3VA7A 2M1BA 3HYIA 4HQMA 1LB2A 4WXCA 4CDGA 4F7ZA 2BE5F 4Y17A 2EA2A 3ZN1A 1K6OA 4I7HA 5A2QK 4HDVA 1YW7A 3FXQA 4ENMA 2OU2A 5EEGA 1WKMA 3G3ZA 1RNLA 1YQAA 1RZ4A 2JRTA 1S29A 4U7BA 2QYOA 4KDPA 3WE2A 2MD5A 1XXCA 2DW4A 2FMYA 3WE3A 1EH8A 1DPRA 3RTRA 3GYHX 3IRQA 4EJTA 5JHUA 1Z1DA 1BM9A 5D8LB 2A68F 2V6CA 1W5SA 1FYKA 1SFUA 2ZMEB 2CGPA 2DK5A 2OBPA 1XSDA 4P55A 4HQEA 2EV6A 4WWCA 4M73A 4OMYA 1D5VA 1R5GA 1DUXC 5EGHA 2K86A 4IHSA 4A5NA 4RB1A 5D6FA 1BC7C 3C7JA 4EJVA 1ZGAA 2XAQA 1J59A 4ZYDA 4KASA 1LDKB 1MDMB 4CHUA 3FOEA 2WTEA 1DP7P 1MJ9A 5CVIA 4B09A 1YW9A 3VFZA 4HLXA 3MWMA 3FKIA 2H27A 3HHHA 3C18A 3T8RA 1BI0A 4RB3C 4YFNF 1FNNA 1ZBSA 2K7LA 2CFAA 3TOBA 2Z99A 1G3TA 2XROA 3TO7A 4LQYA 3N0CA 4KMAA 2IT0A 5FD6A 3ECHA 3FX3A 1FPQA 1OMIA 1XCVA 1IF1A 2RQPA 4LB5A 3WTUC 4A6EA 3J7AO 3AQPA 1P6RA 1PP7U 3F23A 3RPQA 1B9MA 2DPDA 4GT9A 3IC7A 1TTYA 1QZZA 4I09A 1MGTA 3JSPA 1IUYA 3BJAA 3E3VA 1B4AA 1GVJA 4OIOF 1R9TA 4KN7X 2BV6A 5BPDA 5DV5A 3OOPA 1O27A 5K5OA 3SZTA 3BOQA 2ESHA 1T98A 4OIPF 3E6BA 3N0BA 5CHPA 3CDHA 3N3YA 4M9SA 4I01A 5TRDA 3F8NA 1P92A 1HQCA 4E70A 2DTRA 3CO7C 2OQGA 5F6FA 2KJCA 2STWA 4L5JA 5K1YA 1B59A 1Q1HA 2DU9A 4KM8A 3I4PA 2ZXJA 5LGTA 1LDDA 5CYVA 1FY7A 1ZG1A 4HLYA 4FHTA 4BAYA 2XKPA 1SAXA 5CVRA 3V7CA 4P96A 2GXBA 2NRAC 1IW7F 1SD6A 1KU9A 2RV8A 4KT5C 4A12A 3JTGA 1O2BA 1FSEA 1XDSA 2HFHA 2KRFA 4L9VA 1TWCA 3DEUA 3SZPA 1I5ZA 1TBXA 2COMA 1HBXG 4GTLA 3C1DA 3KZYA 2VODA 4LLLA 2QQAA 1XSXA 5H6RA 4EGYA 3WODF 4XLPF 5D5VB 3ZQ7A 1O3QA 1IXRC 2KKOA 1XXBA 2A5YB 1J9IA 3WGHA 5J6XA 2YR2A 5H6QA 4HDUA 4ON0A 1USSA 3WTYC 1JE8A 4KYWA 5DYMA 3I58A 1ON1A 4M9ZA 1WQGA 3BWGA 1R23A 3GF2A 2D2WA 4IHTA 4JQFA 1R36A 2IJLA 2J5PA 4HA8A 4L9NA 2M5WA 4G0UA 2QBYB 1KU3A 2FQ3A 1PDNC 2MLKA 1S7OA 4G7ZF 2H09A 3DP7A 5A2QZ 2MH2A 1D8KA 3TQNA 3E5UA 2PJPA 1HW5A 2BYVE 3I54A 4KDDA 4EM2A 1ZAOA 2NVYA 3LA2A 3L4JA 1ULYA 2YSRA 1IN5A 1RIOH 4KNYA 2QQ9A 3HOTA 4S05A 1BI2A 4UV8A 1W5TA 1LVAA 3QAHA 3PFIA 1KYWA 5AIPA 1AOYA 1WQHA 2LDUA 2XCOA 1WCMA 4ESJA 1B9NA 5ILVA 3JTHA 2GZWA 5E1XA 3HRUA 2XAHA 4FZBA 2A61A 2UWMA 5BPIA 5HS7A 1HSTA 4M6XA 2ETHA 3AH5A 1KA8A 1MKMA 1IRGA 3V8KA 1R7JA 5JI6A 1S7AA 3DPLC 1ON2A 2TDXA 3HSEA 4MQ9F 3WGIA 2DFIA 4HF2A 2FBIA 2VT3A 3NEUA 4LR2A 1FYMA 2F5EA 4ENKA 1FT9A 1QNTA 3RKXA 5FLXZ 2UXNA 2HGCA 4HF1A 2KIUA 2P7VB 3Q9SA 5AIQA 4CXFA 3MZYA 5CVUA 4ENJA 2Y0MA 1Z6TA 1WQFA 1BIAA 1R1VA 4HBLA 4QWQA 1XGMA 1REPC 5BOXA 2CWEA 5IOSA 2XASA 2OZ6A 5EGEA 4H0EA 2QVOA 1Z9CA 4WF2A 3I64A 1FBSA 1P4AA 4RGRA 1BBYA 1MDMA 3KP4A 3WTSC 4ZYGA 4K2EA 1USTA 4C2MC 5E1ZB 3MQ0A 4EJUA 3FMSA 1J0RA 1O26A 3FMQA 3O3KA 2L3DA 1IZ1A 3LSTA 1T39A 3P9IA 2CW0F 4ZYHA 4M72A 3MAJA 3CLOA 2B0LA 2VOOA 4N0BA 2Z33A 5HDKA 2XUBA 5EEHA 3OREA 5ICEA 2EFPA 2OD5A 1ZVUA 1WSUA 3CAGA 2FA5A 1OYIA 2VE9A 4AWXB 2VBXA 1P4WA 1ONVA 4RB0A 5LGNA 1MD0A 3FXUA 3QPTA 3U2RA 5E20A 2ISYA 4OU0A 3MCZA 2EA4A 1K78B 3TDZC 5DEQA 1BI3A 5HLHA 3FMRA 1D8JA 4A2UA 1FBQA 4OOIA 1PUEE 2DPUA 4OMZA 2BEOA 2QZ8A 2W57A 5TJJA 1GXPA 4P9FA 1ISEA 2Y3PA 2JA7A 1YW8A 4LMYA 3R61A 1P4XA 1SFOA 2PLYA 1XDUA 1TQPA 4L9JA 1XXAA 2E2IA 3EQLF 4G7HF 4O5VA 2NYXA 4G0WA 1WQ2A 1YS6A 5LLQA 4XSXF 2R3SA 4M71A 4IPAA 3R4KA 3HRTA 3FXRA 3V8JA 2H6BA 2LF7A 1K79A 1O24A 2GQQA 1MZBA 1U78A 1YFHA 3WU1B 1B1BA 3BUEA 1T38A 4CYDA 2DBBA 2P5LC 1O7LA 4RB2C 3HTSB 4C3HC 2VC0A 4WXDA 3M9AA 1XGOA 2JA5A 5E18F 5F1RA 1RUOA 2L02A 3SXYA 4HV6A 2VT2A 2KWAA 1ODDA 3ZMVA 3DPTA 4OIQF 2UZKA 2G9WA 4D0PA 3W6JB 4UUVA 2JPBA 1T6SA 2P4WA 2Y48A 3MZHA 1ZRCA 4KATA 4HV5A 1F5TA 1EH1A 4ESFA 3QU6A 1HW1A 5HLIA 2VBZA 1UFMA 2CYYA 4XLNF 3K1PA 3OPFA 1JXSA 2CG4A 4I02A 1A04A 2MBFA 1F9NA 1IN6A 5E8GA 2RH6A 4ETSA 4IJAA 2QLZA 2XAFA 3DV8A 2HQRA 2LF8A 1LEAA 1SFEA 3I71A 4KUMA 5LRRA 1HKTA 3WGGA 4BLAA 4YG2F 2EJRA 3J81Z 5DCMB 4RAYA 1L0OC 2QQBA 3GVAA 3GTJA 4KB4A 1IXSB 4YIIA 1EH6A 2NAZA 2E1CA 3WTXC 2OQRA 1BJAA 3F22A 5LHIA 1KU7A 2V79A 2E1NA 2HZTA 4EGZA 1CF7B 2EWNA 3BDDA 1DPUA 3ML6A 2ADUA 3M8FA 4HF0A 1T0FA 4G8XA 4OINF 5IOTA 1Y1VA 2XRNA 3CUQA 4MEXF 5L3GA 3K0LA 5LEKA 5DDGA 2D1VA 1I1SA 5D5UB 3T5XA 2YPRA 3H3UA 3HTUA 4AIKA 2G7HA 3AQOA 2Q2EA 2JH3A 2WWYA 3O6BB 3M1EA 4GTCA 2ZFZA 1LDJA 4BLBA 2YU9A 4U88A 1FYLA 2JPCA 3COAC 2FXAA 1BI1A 1J7KA 2ISZA 1IXCA 2JT1A 5BMZA 1YYVA 4LLGF 5JFEA 3R0AA 4UVCA 2ZBKA 4IVNA 3GTQA 1ZYRF 4RGUA 4ENNA 1ZGJA 3ZP5A 4GFQA 2VE8A 3NUHA 2V1DA 2BGCA 2FF4A 3RI4A 2ELHA 4GYGA 1TW2A 2XCRB 2WC2A 4KARA 5JFRA 2DI3A 5HOOA 2ZMEA 3F6OA 2HTSA 3LFKA 1OR7A 5HVQC 1EK8A 1XMAA 4R1HA 3GTPA 2P7CB 2W84A 4IRGA 1BJTA 2BBYA 1S8NA 3PQKA 2GA1A 4C3IC 4HX7A 2QUFA 4Q4ZF 1X3UA 2HOEA 2W24A 2ZNYA 1WIHA 4DQ2A 4IRHA 2A69F 3L09A 4L18B 4L0YB 3K1MA 2A6EF 3RIRA 1QGPA 2A6HF 3J80K 2DT5A 4ILDA 1SD5A 4GGGA 4DNCA 2ZNZA 3KCCA 2NVXA 2RGRA 2GSNA 3LWFA 3ZMUA 5L3BA 3L4KA 3DFGA 5IT9Z 2JTVA 3HRSA 4C3JC 2QM3A 5BS6A 2KJBA 4KMDA 3LA7A 5L3CA 2W85A 1FSHA 4R79A 3C3WA 3ISPA 3F8FA 3BJOA 2K02A 2X4HA 2EFQA 3ZN0A 2D45A 1KQ0A 3E6MA 3WTVC 2IVMA 4U0VA 2DQRA 2Z5UA 1QZYA 5FD5A 4PZJA 1O3SA 4Q5SF 4KIFA 2DAOA 1FLIA 4P9UA 4OIRF 2MA3A 4CICA 4RAZA 1WWXA 3R60A 2IPQX 3F8CA 3HSFA 3F8MA 3GFMA 5DD4A 5L3DA 2FSWA 1K7AA 4MEYF 5J8CA 1UHMA 3M7GA 1WI9A 2PMHA 4KMHA 5KVRA 1F4KA 4LLNA 1MJAA 1SD7A 2IA1A 2CO5A 2M87A 3I5UA 1TW3A 4KC6A 1G3SA 2CFXA 4ZZDA 1IN8A 4G0VA 3U1DA 3KP2A 2VN2A 4LG0A 3CUQB 1JGSA 4NB5A 2DK8A 2F5DA 3OV8A 4HAMA 4AIJA 4M74A 5FB2A 2LSOA 2LKPA 5D6EA 2H94A 1FBUA 2EFNA 2P6TA 3ELKA 1BGWA 3B73A 3BZ6A 1KGSA 4CO8A 3GO5A 3D0SA 4EM0B 3QP6A 2XKOA 2E7WA 2XVCA 3E6CC 2R7FA 2KIFA 3IKTA 4I0BA 2VONA 2VXZA 2GSOA 1I3QA 4ZYEA 3EUHA 1H0MA 2CSOA 4FX4A 1KQ8A 4GTEA 5D8KB 4U0WA 1V3FA 3KETA 3P7NA 1YG2A 2WV0A 4WX9A 4U7DA 3FM3A 1O3TA 3IRRA 5FGMA 3RJPA 1K83A 3RDIA 3GWZA 5CVVA 4A6DA 2YX4A 3HOSA 1TWAA 1I50A 3HRMA 4PGGA 3RKWA 2PHCB 1XGSA 1IN4A 2FU4A 2FEZA 2R7DA 4UNOA 3BP8A 1C0WA 4AD9A 2P5VA 1HW2A 5FLXK 2K27A 4XSZF 1TNTA 4KN4X 3KLNA 4M9XA 1I27A 1RUNA 5CJ9A 5DUIA 2IW5A 2L4AA 2RGVA 3FM5A 2JSCA 1Z91A 4G6QA 2PFBA 4MHGA 4I2OA 1O25A 2JA6A 5DD8A 3MEXA 3Q9VA 3H0GA 3GTOA 2M45A 3FZVA 3W6KB 2FNAA 3Q5FA 3R0JA 2MC3A 2EK5A 3F8BA 4FT8A 4IF4A 5CVJA 1ZHFA 3DKWA 1O7FA 3V7SA 3QP5A 3BPVA 4I0AA 4LK0F 1SMTA 1YS7A 4GYIA 2MLGA 1OYWA 3ZMDA 1FX7A 1GHCA 1R58A 3RYPA 3EETA 1BN5A 3I59B 3WU0A 4Q47A 1JHHA 4KIGA 5D4RA 1HKSA 3KEOA 1U6GA 3IHUA 4BQAA