1F9NA

Crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
KGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE REPRESSOR/ACTIVATOR PROTEIN
publication title The structure of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f9nA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1f9nA02
2VC1A 2V6CA 2FSWA 1FT9A 4KUMA 3TO7A 1YQAA 5HLHA 1R5HA 3M8FA 2A5YB 2P7CB 3F3XA 1HW5A 1O7LA 4NQWA 1XCVA 4NB5A 5HS8A 4Y15A 1H9TA 1REPC 2EJRA 4M71A 4PGHA 2XIGA 4IJAA 3I5UA 3KP3A 3E6MA 1EH8A 4ASNA 2LF7A 3GF2A 2QYOA 5JVTA 1U8RA 3HTUA 2NNYA 1YLFA 1AOYA 2FBIA 4PDKA 3ZQ7A 5KK1A 5ICEA 3Q9VA 3WTSC 3I64A 4FX0A 3RKYA 2BV6A 3GO5A 4ZZDA 5BOXA 4WCGA 2DK5A 1YIOA 3K9TA 2CG4A 4LFUA 2FE3A 3E3VA 4L9VA 5BQTA 1O3TA 5E1ZB 1XGOA 1DD5A 3BJAA 4I01A 2E7WA 4U7DA 2R7DA 3ELKA 1YYVA 2FMLA 4U7BA 1LEAA 1PDNC 1D8KA 4M74A 3VFZA 4ESBA 5D6FA 1P4AA 1IN5A 1JHFA 1LDKB 5LHIA 2PBIA 4EJUA 4ENNA 4LMYA 3R6SA 3HIFA 3LSTA 2W85A 3V8KA 1OMIA 4EJTA 4RAYA 3ZMSA 1BM9A 3R60A 1BI1A 5D5XB 2Y48A 4ESFA 1YO5C 3DF8A 4KICA 3K1PA 3F23A 3WTWC 2D2WA 3M9AA 3QP6A 3F8CA 2XKOA 4FM9A 5J8CA 2Z3YA 4P55A 3JTHA 4YFNF 2DW4A 5HDGA 5E17F 3LAPA 1ON2A 2VOOA 2WTEA 1J5YA 4MQVA 4AIKA 4BHBA 3WE3A 2ZFWA 4M6YA 4F7ZA 2PQ8A 4TV7A 1QGPA 2HOEA 2A3SA 3M8EA 1TQMA 4RAZA 2GA2A 1USSA 2XKPA 2YX4A 2KIMA 5L3BA 2NRAC 2L02A 3GZ6A 2IA2A 1LB2A 3O2PE 4KC6A 1FPQA 1WQ2A 5L3CA 1XGMA 1R36A 5FD6A 4A6DA 1F9NA 1YFHA 4RB3C 2DBBA 3F6OA 3BY6A 1HSTA 3LFKA 5CVRA 1P4XA 5F1RA 3WE2A 2V79A 1FSEA 2CWEA 2FA5A 2PMUA 2K4JA 4JK1X 1G6NA 1U2WA 2NNNA 4AVPA 1ZN2A 2ETHA 2O03A 5CVIA 1IW7F 5FLXZ 1IRGA 2IVMA 4UV8A 3NRVA 1USTA 3JAMZ 3MQ0A 2FOKA 3RIRA 3E6CC 2QVOA 1MD0A 4EGYA 4PZJA 3LA3A 3ZN0A 3RPUA 4OMZA 1W5TA 1W7PD 1S7OA 1BN5A 1S29A 4GYGA 3VB2A 2XHKA 2DQLA 3OREA 3FOEA 1MGTA 3JTGA 4HLXA 1GHCA 1ZARA 3FWEA 5FB2A 1QBJA 4OINF 3G3ZA 4MTDA 5JI6A 1IN7A 3ABUA 1K78A 2KRFA 3AAFA 3VOEA 3F8FA 3WGIA 1S7AA 1XSVA 4AIJA 1FP2A 1FSHA 3MFKA 2HTSA 2RVCA 3ISPA 3N4MA 5ILSA 4LLLA 3V7CA 1HBXG 4IRIA 2P5VA 1BGWA 4WXDA 2F5DA 2PHCB 1PP8F 4L0ZB 2MD5A 4MTEA 5JFRA 1E17A 2MBFA 2QWWA 2KJBA 2Q2EA 3T0YA 1ISEA 5HOOA 1TQPA 5K5OA 2VXZA 4A2UA 1W4MA 4EM2A 1S6LA 2DO7A 1S8NA 4M73A 3TDUC 1BIAA 4G7OF 1OYYA 1CF7B 1TW3A 3GYHX 3FM5A 3LA2A 5H6QA 5K5QA 2XCQA 3SXYA 4RGXA 2STTA 3L00A 2FMYA 2P4WA 1MDMB 1P92A 4I0AA 3TOBA 2FF4A 2M45A 2WC2A 2XAFA 3ZMUA 3CUQC 2MH9A 1EV7A 3GUDA 2Z9OA 4HX8A 1OPCA 3HRMA 1DP7P 4IXAA 2HKXA 4KIGA 3VA7A 2JTVA 3V7RA 2Z99A 3WTVC 3M1EA 4GCVA 5H20A 3SQNA 5ED4A 2OQRA 4LG0A 3P9KA 1TTYA 1V3FA 1P2FA 2RDPA 3KCCA 2QBYB 1B4AA 3LWFA 5D8LB 3K2ZA 2RGVA 1ODDA 3BPVA 4FHTA 2K7LA 5ICGA 3E6BA 5K5RA 1WRJA 1LDDA 1SMTA 2D45A 1ON1A 1QQIA 2FBHA 5FD5A 2TDXA 3F6VA 1QPMA 1K7AA 4BNCA 3TQNA 3W6JB 1TNTA 2XCOA 1MKMA 2RN7A 4J3NA 4HZFA 4YIIA 2YR2A 2DT5A 4RB2C 2QQBA 2HYGD 1IN6A 3QPHA 1H0MA 1PP7U 1BI2A 1XXCA 3BJ6A 1H9GA 1FOKA 4ZYGA 1O57A 2P5LC 3CTAA 2GQQA 3BROA 5LBQA 2A61A 1BC8C 2OA4A 4RGRA 2M1BA 3FXQA 2VE9A 1ZREA 4I09A 2IA1A 1IN4A 3I71A 2FEZA 2Q8KA 2DU9A 4ZYEA 1HW2A 1RZ4A 4G7HF 1YW7A 2M30A 1U78A 3ZMTA 1BI0A 3BZ6A 2W24A 4I2OA 1DDNA 1XSXA 3ZP5A 1R23A 4G0UA 3QOPA 4L0YB 4P96A 4MEXF 1J75A 3L9FA 3HHGA 2DPUA 2QENA 3JSOA 2ZMEB 2VT3A 3VEPA 5HDNA 3DKWA 2QZ8A 2L4AA 4DDQA 2ZBKA 1JXSA 2CYYA 4JBAA 4WK8F 4XLNF 4A12A 4MQ9F 4EJOA 1XDSA 1V4RA 4EMSA 5LGTA 3J81K 2LNBA 1Z6TA 4EV0A 3E5QA 1VTNC 3U1DA 3IL2A 3RKXA 1X3UA 5FFXA 2DK8A 4P9FA 4EGZA 1G3TA 4BH9A 2Q0OA 2MH2A 4Y13A 4UNOA 2RGRA 2VBXA 3DV8A 1JHHA 4CGZA 3U2RA 5J6XA 3F8NA 1SFUA 1BBYA 5CVJA 1FYKA 3D0SA 3DEUA 1ZGJA 2HGCA 3I59B 1T98A 1FBSA 2G7HA 5FFZA 4G94A 2QM3A 2QQAA 3TKYA 3ECOA 1IRFA 5DD8A 1BOAA 1Z91A 4I7HA 1Z7UA 2LKPA 3ZN1A 3IWFA 4A0YA 3KE2A 4UVBA 5HLIA 1BJAA 5E1XA 2XROA 4KB2A 3WGHA 4O6JA 2O61A 1R7JA 1EH1A 2QUFA 3EYIA 1KU2A 3FOFA 5CJ9A 5CVUA 3CUOA 3T8RA 4ETSA 1CGPA 3MZYA 2R7FA 1Y0UA 2VC0A 3T8TA 4RS8A 3CUQB 4UVAA 4BXUA 3HOSA 2JPBA 5LHGA 2EA4A 1OYIA 1STZA 3BDDA 1IXSB 1EH7A 4HW0A 1FC3A 4U0YA 1J59A 5IT9Z 2V1UA 5HS9A 3I53A 3L7WA 3J7AO 4HX7A 2P5KA 4R79A 2HS5A 3EETA 4CHUA 1KU9A 3WG9A 1U3EM 3KLOA 3J80K 1FBUA 1J2XA 2L54A 3QPTA 2EV0A 2CW0F 3IRQA 3COAC 1IAWA 2XASA 2H09A 5D5WB 1EK8A 4OMYA 2BYVE 2EFNA 2L01A 5A2QZ 2YX7A 3HRTA 1ZG1A 2DPDA 4H0EA 3BWGA 4EJVA 2DI3A 3ROUA 1T6SA 4U0WA 2EFWA 3BUEA 5EEHA 2ACJA 4YFXF 2DTRA 2EV6A 3ZMZA 3P9IA 2PEXA 3PQJA 3KFWX 3HRSA 4KDPA 4Z2YA 2G9WA 2PG4A 3PQKA 4D0PA 5D6EA 1Z1DA 1ZGAA 4L18B 3OPFA 2X0LA 4I02A 1T39A 3CDHA 3GVAA 5DCFA 4L5JA 4Q47A 2EFOA 1XD7A 4M6XA 4YIFA 3HYIA 2UWMA 2HQRA 2Z33A 3L4KA 1W7PA 3FMSA 5HVQC 4G6DA 3RJPA 1AWCA 3HOTA 1LEBA 4S04A 3R61A 5D5VB 4BHPA 4NHJA 3K1NA 4I0BA 1KQ9A 5BMZA 1ZRDA 1FYLA 2V1DA 4AIHA 1L3LA 4YG2F 1R00A 2A6HF 1ZH5A 4S05A 3HSEA 1B4BA 5DEQA 1FNNA 5LHHA 4P9UA 1ZHFA 3QAHA 2KKOA 4HYEA 1TBXA 1XGSA 5L3FA 2XAHA 5DCMB 4HBLA 3IHUA 2OU2A 1WQGA 3DQVC 1BJTA 3FM3A 2H94A 2IP2A 3I54A 2ESHA 1QNTA 4LK0F 3MCZA 2D1HA 3MZHA 5E18F 2ZJ2A 5DV5A 2VOPA 3KZZA 1F1ZA 1G3YA 5DD4A 5JR3A 1QZYA 1WQFA 4XBFA 1R58A 1XGNA 3GW2A 3BOQA 2VN2A 2E1CA 2V9VA 4KB4A 2G7UA 3GEZA 4JQFA 3GFMA 3K69A 3ULQB 2OQGA 1ONVA 3ML6A 3NUHA 2HFHA 1U5TA 2UXNA 2BE5F 1PUEE 4GXOA 1SFEA 1HXDA 1D8JA 1O3SA 3KP5A 1LNWA 3FX3A 3NQOA 4BQAA 1GVJA 2JZYA 2KIUA 2ESNA 3LPXA 2IW5A 5KVRA 6PAXA 2XGXA 1O7FA 2NAZA 3C3WA 1RUOA 2WV0A 2Y0MA 3LQRA 4UV9A 4XSZF 2RV8A 1T2KA 4G6QA 1Z6RA 3JSPA 3T1BA 1QO0D 5H6RA 3BPXA 2J5PA 3FXRA 3KP4A 4FX4A 4KFCA 4OIPF 2VONA 4QLCU 1LJ9A 3KLNA 4OIOF 4KAWX 4PCQA 4M9ZA 2MA3A 4QWQA 1GE9A 1F5TA 4EQQA 4Y17A 1XCBA 4CICA 1E2XA 4N9IA 5E20A 3V7SA 3KP7A 1W5SA 2J5OA 2GIVA 5TJJA 2EB7A 2IT0A 1FZPB 4AWXB 4OOIA 3WU0A 2UXXA 4UVCA 5HDKA 1HSJA 4HV5A 5ICCA 3M7GA 3QX3A 2W57A 4P5OA 1XDUA 3DXJF 4KIBA 2P6SA 2MLKA 2RC4A 4XRFA 1RIOH 2VBWA 4GO1A 3ZMDA 3V8JA 4HA8A 2M87A 3SHFA 3F8BA 1BI3A 4ZZLA 5IT3A 3P7NA 2DAOA 2XAGA 1I1GA 3R4KA 4G9YA 2EV5A 5BPIA 1ZLKA 1ZAOA 2K27A 3R0JA 2F2EA 4G7ZF 1KYZA 2HWVA 5FO5A 4CDGA 2ADUA 4LLGF 3ABTA 2VT2A 2F5FA 5BS6A 4ENKA 1R1UA 5DUIA 2K02A 1KYWA 4LB6B 2EFPA 1S3JA 1SD5A 3RI4A 2XV4S 1HQCA 4RGUA 1R1VA 2GWRA 2P6TA 4EJWA 1FBQA 4ON0A 3D5LA 1FWZA 1YW9A 2KIFA 4WXCA 2XVCA 2R3SA 3EDPA 2KJCA 4A0ZA 3ZPLA 4GYIA 1XMKA 3B02A 3V4GA 1T38A 4Q48A 5E8IA 2EK5A 4HAMA 1I6XA 2K86A 4ZYDA 4KIFA 2E7XA 3VODA 1KA8A 5LGUA 2A69F 5HLGA 1HKTA 5FLXK 4HLYA 1TQIA 1O3QA 3SFZA 4HF1A 5K1YA 4HV6A 1TNSA 1UFMA 2PI0A 3JAMK 5CYVA 3H3ZA 3KZYA 2ZFZA 3GXOA 1G3SA 5LEJA 5DDGA 3TDZC 3N97A 1FX7A 3CLOA 3ECHA 3I0TA 2PMHA 4IVNA 1MZBA 2UZKA 1P4WA 2EWNA 3GFJA 5LGNA 2CGPA 3R0AA 1SAXA 1FY7A 3OOPA 4HDUA 2GZWA 3FF5A 3KEOA 4PGGA 2L3DA 2RQPA 1U6GA 3QRFF 1A04A 4XLPF 3FXUA 3E6DA 4M9SA 3WGGA 2VBZA 3QU3A 1IS1A 4WWCA 5L3EA 2GA1A 3DPTA 2A68F 1GXQA 3SZTA 1TLHB 2PJPA 4KN4X 3I4PA 3C7JA 2X4HA 1R1TA 2O8XA 2MC3A 1ZG3A 3L4JA 3FMQA 4XSXF 1IN8A 3DPLC 5D4RA 2HQNA 2HYFA 4ZH4F 4K2EA 3TGNA 4A5MA 2HDCA 2JSCA 1R22A 2FU4A 3V8LA 2OD5A 3RKWA 1MJAA 3F21A 3K0LA 1LQ1A 5JHUA 1DUXC 3RTRA 3EUHA 1XN7A 3HHHA 4RGSA 3KEQA 2AXLA 1T0FA 3RYRA 1MJ9A 2NYXA 1JE8A 1HKQA 1J9IA 4ENMA 4FT8A 2GAUA 3RDIA 2LDUA 3GLXA 3GFLA 4U88A 4EVIA 4R8HA 2C6YA 5LRRA 4MEYF 2IRFG 1UB9A 2MLGA 2ZNZA 3ERED 1XXBA 5D8KB 4RB1A 1K79A 1SMYF 2BBYA 2F5EA 2O6GE 4N0BA 3CJNA 3FZVA 4LGWA 2A07F 3MEXA 2EFQA 1RNLA 3C1DA 5AIQA 2ZO4A 2DLLA 2BEOA 1G4DA 3NEUA 3TO6A 2HKOA 2IA0A 1WI9A 1QZZA 4GFQA 4WX9A 5F64A 2XUBA 2V1XA 1D3YA 3Q9SA 4MHGA 1J7KA 4E70A 2FBKA 4HX4A 1YTYA 5DCMA 2NS0A 3MMLB 3W6KB 4IHTA 1Z05A 1SD4A 2CO5A 5J8FA 5EEGA 3GX4X 2Z5UA 1B59A 2ZKZA 2M8EA 2B0LA 2HR3A 2JRTA 2VODA 2RNJA 1YS6A 1BIBA 2M5WA 1B9NA 4O3MA 1R5GA 3F8MA 4N9HA 1I1SA 1XSDA 1IZ1A 4AD9A 1KQ8A 1NHAA 1U5TC 1SD7A 4HDVA 4BAYA 1D5VA 5D4SA 3REOA 5ILVA 1WWXA 2XCRB 3GZ5A 3HUGA 4Q5SF 1FP1D 4EM0B 2LF8A 2KWAA 1IXRC 3HTSB 3CO7C 1I5ZA 3E5UA 2STWA 4I98B 1RUNA 1CF7A 1ZLJA 5BPDA 3DP7A 2YSRA 4Q4ZF 2P5MA 5LRSA 5L3GA 2F5CA 2H6CA 1ZRFA 1AB4A 1FLIA 4OIRF 3MWMA 1MDMA 4L9NA 2FQ3A 2RKHA 3HSRA 1Z9CA 3WODF 3FHZA 4A5NA 2PFBA 3IC7A 2OZUA 3IKVA 2HTJA 5ERIA 1BC7C 4BYYA 2HEOA 1OYWA 1HKSA 2W25A 4DNCA 2GXBA 1SD6A 3OEPA 3GWZA 2P7VB 3WTTC 1WKMA 4KNYA 3I58A 4M72A 3BP8A 2LSOA 3B73A 3HSFA 2K4BA 3RPQA 3C18A 2PN6A 5FGMA 3GFIA 2H6BA 2JPCA 1IUYA 2DFIA 4O5VA 2QBYA 1P6RA 2XAQA 3SZPA 1O3RA 5TRDA 4LB5A 1XMAA 4G0WA 5JVOA 1RI7A 4KT5C 2ISZA 4MGRA 2IJLA 1ULYA 3T5XA 3WU1B 1SFXA 5E8GA 3Q5FA 1KU7A 3J81Z 1C0WA 1UHMA 3E5XA 2ZNYA 1B6AA 1XXAA 2VBYA 3KP6A 4CYDA 4YFKF 3TO9A 2GXGA 3LA7A 1GXPA 1EH6A 3IRRA 2D1VA 1UHWA 4BHCA 4L9JA 1B9MA 1ZVUA 5ILUA 2W84A 4G0VA 2FNAA 2O3FA 2HZTA 2OZ6A 5D5UB 1OR7A 5LEKA 1XB4A 3H3UA 3TOAA 2CQKA 4R1HA 3IKTA 4CO8A 4WF2A 3PFIA 2L4MA 1WSUA 2Y75A 2WWYA 4EM1A 3O6BB 2ZCWA 2IPQX 2O0YA 4KN7X 3FMRA 2XRNA 4MNUA 5CLSA 2P8TA 1W7PB 3F22A 4ENJA 3P9CA 2ELHA 1K6OA 3CO6C 5LLQA 1Q1HA 3EYYA 4G8XA 4IPAA 5ICFA 1F4KA 2ZMEA 4CZZA 1J0RA 3QP5A 5IT9K 1UCRA 4CXFA 2YPRA 4WXHA 2H27A 3L2CA 5AONA 5HS7A 3HRUA 2QLZA 3J80Z 3O3KA 2AS5F 1IXCA 3S2WA 1DPUA 1I27A 1L0OC 1G3WA 3G73A 2FRHA 3WTXC 4L9TA 4DQ2A 4IRGA 4OIQF 1KU3A 4HF2A 1K78B 4B09A 4LJZF 5A2QK 3JW4A 1YG2A 2XAJA 4IF4A 4KA4A 2JT1A 2A6EF 2E1NA 3QU6A 1MJBA 1IF1A 2EA2A 3E97A 3I59A 4UUVA 3LQQA 3CAGA 1ZYRF 5CVVA 1U5TB 4ZYHA 2OBPA 4HOBA 5L3DA 2BGCA 3IWZA 4IHSA 1KGSA 5F6FA 2PLYA 4L5IA 3F72A 3ZMVA 4KMUX 1YW8A 2FNPA 4UHTA 1OKRA 4RB0A 4KMFA 2FXAA 4LLNA 1LVAA 4KDDA 4A6EA 3K1MA 3BJOA 4B8XA 1FYMA 4KYWA 2ISYA 3DFGA 3WTYC 1YS7A 3L09A 3U9GA 4A0XA 1B1BA 1KQ0A 5DYMA 4HQMA 1HW1A 3RYPA 1WQHA 1JGSA 5E1WA 3LAJA 4OU0A 4M9XA 2CFXA 1TW2A 1DPRA 3CUQA 3WTZA 4IRHA 1ZRCA 2DQRA 5AIPA 1LDJA 3OV8A 4LK1F 4LD5A 4ESJA 2YU3A 3WTUC 2VE8A 3KP2A 2COMA 2CSOA 5DUKA 4HF0A 2Y3PA 4LG0B 1WIHA 4U0VA 4UXNA 4GGGA 3MAJA 4HQEA 2OAZA 2ZXJA 3H92A 3EQLF 2QQ9A 3KETA 1ZG5A
chains in the Genus database with same CATH superfamily
2VC1A 2V6CA 1PUFA 3AG2H 3K4NA 1Y1WJ 1JJ6C 2FSWA 3H9JA 1VQPI 1TWGC 3BTJA 1FT9A 4XKWA 2FX0A 4KUMA 4XNFA 2IGMA 4D1QA 3TO7A 1YQAA 5HLHA 4BKWA 3RQIA 4KN4A 2EPFA 2E19A 3GCMA 5EG0A 5H2FC 3G4AA 3HOZC 4NC6A 1R5HA 3M8FA 1TWGJ 1ERDA 2A5YB 2P7CB 2CW0A 4YFNA 4MO7A 3RZOK 1S9HA 1IL2A 3F3XA 3HOZJ 4DBQA 1Y1VK 3S16K 1VQ8I 1O28A 3EUAA 1HW5A 1O7LA 4NQWA 1XCVA 4MFDA 2VUMK 4ZTJA 1YOVB 3S1RC 4NB5A 3CJQB 1NK3P 1VZ0A 5M5XJ 5HS8A 4G12A 4Y15A 1GDTA 1JKOC 4PJ0C 1H9TA 4HSTA 1REPC 2EJRA 4M71A 5EDNA 4PGHA 2D5VA 2XIGA 4IJAA 3I5UA 1N25A 1NG7A 3ZQIA 3KP3A 3E6MA 3AG1H 1EH8A 3DTEA 4ASNA 4P5AA 2LF7A 3IUOA 3GF2A 1JI8A 3GTOK 1IG7A 2QYOA 5JVTA 4KISA 1U8RA 3HTUA 4IEJA 5J1YA 2NNYA 3CC2I 1YLFA 5B1BH 1AOYA 2E2IA 2FBIA 1A6IA 1VQ5I 3CC7I 4PDKA 3ZQ7A 1VLOA 5KK1A 3LSJA 4BBRC 5F1JA 5ICEA 3Q9VA 3HB9A 3WTSC 3I64A 2ZB9A 4FX0A 4CYCA 3RKYA 3CESA 3S1QC 5KAIC 2BV6A 3HXAA 3OYKA 4QJVA 5D4DA 4A3DC 3GO5A 4ZZDA 2GLOA 2W00A 4PK4A 2KMUA 3JRIA 4BBRJ 5BOXA 3T01A 2LRDA 4WCGA 4FQGA 1JT0A 3E1SA 4IO9F 1EFWA 4Y7NC 1HQMA 2DK5A 1YIOA 2RAEA 2DYSH 2R5ZB 1LE8A 3K9TA 3S1QJ 2CG4A 4LFUA 5IYCC 4BUPA 2FE3A 3E3VA 4A3DJ 4L9VA 4XK4A 2EZLA 5BQTA 1O3TA 3PSIA 5E1ZB 2X85A 1XGOA 4IOAF 1DD5A 3BJAA 2KT0A 4I01A 2E7WA 4U7DA 2R7DA 5FLMC 3ELKA 2P81A 1SAUA 1IW7A 4Y7NJ 1EF4A 1YYVA 2FMLA 4U7BA 1LEAA 1PDNC 1RR8C 1D8KA 5IYCJ 3BP8C 2O7OA 3VDXA 3DU5A 4M74A 3VFZA 4ESBA 1R9TC 2HZDA 5D6FA 1P4AA 3T02A 4C3IC 1V55H 3PO3K 5FLMJ 4DZJA 1APLC 1IN5A 1JHFA 1LDKB 5TJ3A 3U21A 4C3JK 5LHIA 2PBIA 4EJUA 1UAAA 2ZXWH 4ENNA 4LMYA 3R6SA 1R9TJ 3HIFA 2E2IK 1Z3XA 3LSTA 2A6HA 1MBJA 2X1CA 4C3IJ 2W85A 3V8KA 1TL8A 2DODA 1OMIA 1RKWA 3BZKA 4EJTA 4RAYA 1WCMA 1O29A 5E79C 3ZMSA 3BCAA 1BM9A 4AC0A 3GTKK 3R60A 3BLYA 5M5YK 1PJRA 1BI1A 4A3BC 5D5XB 2CQNA 3HOUC 2Y48A 5TMCA 2ICWG 4ESFA 2W7NA 1YO5C 1GUUA 3N05A 1MSFC 1L0WA 3OSGA 3OYLA 1GLNA 3G71I 3DF8A 4KICA 2DA7A 2PPBA 2O5IA 3K1PA 3F23A 4A3BJ 3AQOA 4ABZA 1XZPA 3WTWC 2D2WA 3M9AA 3QP6A 3CCLI 3HOUJ 2IXSA 3F8CA 2DMQA 2XKOA 4FM9A 4A3JK 2JUCA 2Y9ZA 5J8CA 2Z16A 2Z3YA 4P55A 3JTHA 4YFNF 1YCLA 4KMDA 3PNYA 2DW4A 3K4KA 5HDGA 5E17F 2VJIA 3LAPA 1G51A 1ON2A 2GIZA 2CQ7A 2VOOA 2OTJI 4WJ3M 3CMYA 1O27A 2WTEA 2NOGA 3JRDA 1J5YA 4MQVA 4JP0A 4AIKA 4BHBA 3WE3A 2DA6A 2KRCA 2ZFWA 4M6YA 2W7VA 2NVYA 1UELB 3FKIA 2RQQA 4EEFG 2LY2A 4F7ZA 2PQ8A 4TV7A 3OYIA 3F0CA 1QGPA 5CHPA 2HOEA 2A3SA 3M8EA 1TQMA 4RAZA 2GA2A 1USSA 5DTDA 2XKPA 4C2MC 2YX4A 2KIMA 3SDBA 5L3BA 5EF6A 2NRAC 1WCMK 3PM1A 1FOWA 2L02A 3GZ6A 2IA2A 1LB2A 3OYFA 3H35A 3O2PE 1OR7C 4M3FA 4KC6A 1Z77A 1FPQA 1WQ2A 5CQGA 5L3CA 1XGMA 1R36A 3H1CA 5FD6A 1TWAC 4C2MJ 1WPKA 4A6DA 4CCJA 1F9NA 1LVKA 1YFHA 4RB3C 3JRHA 3M07A 3HGYA 2WAQL 2AO9A 1WSRA 4PAAA 1FOYA 2DBBA 3F6OA 5K7FA 2VPLA 3QOEA 3W2WA 3BY6A 2R7RA 1HSTA 3OR1C 5EEAA 1TWAJ 3LFKA 4YRVA 5C4JK 1BA5A 5CVRA 4XN0A 1ZBSA 3S14C 2CQXA 1P4XA 3WHBA 4J00A 4GTBA 5F1RA 1XPXA 1MSEC 4D5FA 3OIOA 3OYCA 1FOXA 3WE2A 3MKLA 2V79A 4XSZA 2VL8A 2XPWA 4M3EA 1FSEA 2CWEA 2FA5A 1USMA 2PMUA 4BDZA 2K4JA 4JK1X 4A93K 1G6NA 1U2WA 2NNNA 3S14J 4AVPA 1ZN2A 2CMPA 2ETHA 2O03A 1Y39A 4L5EA 2MFZA 3FKIK 5CVIA 4BJ6C 2WBMA 3GTQK 2KISA 2Y31A 1IW7F 5F0HA 5FLXZ 1XZQA 4OIPA 1VNDA 1IRGA 1I6HC 2IVMA 1BJZA 4UV8A 2H8RA 2OF7A 2I10A 3NRVA 2HVQA 2R0QC 4A3GK 1USTA 3JAMZ 1WH5A 4OIOA 3MQ0A 2FOKA 1VQLI 3RIRA 3E6CC 2ZMEC 3OIPA 2QVOA 1MD0A 2MC4A 1HCRA 3LSRA 1I6HJ 1SVLA 1OJLA 5FKKA 4XRMA 4EGYA 3HOWC 4PZJA 3LA3A 2QSFX 3ZN0A 2CFAA 2JA5C 1ZELA 3K2AA 3RPUA 1QHGA 2W48A 3M1CA 4OMZA 1W5TA 1W7PD 1S7OA 1BN5A 2IEKA 2CW8A 5IOQA 1S29A 4GYGA 4J19A 3VB2A 1N77A 2XHKA 2DQLA 5IPAA 2BY0A 4B4CA 3OREA 3FOEA 2JA5J 1MW7A 1MGTA 2Y0SA 5HNHA 2IBDA 1O4XA 1D0ZA 3JTGA 1P7JA 1VQ9I 3VYSB 2RREA 4NDLA 4HLXA 1X31C 2R7SA 3GTJC 1FEXA 3DXJA 2LBFA 3FK6A 1GHCA 3I4NC 2IGOA 1ZARA 3FWEA 3DEWA 2L7MP 3X2QH 5FB2A 4XR6A 1A31A 1BS2A 2HOSA 1V54H 1QBJA 2M7BA 1GV2A 4OINF 2KDZA 3G3ZA 3GTJJ 2LLKA 4XONA 3L2UA 2LFBA 2WADA 1WGXA 4MTDA 5FJ8K 5JI6A 3I4NJ 1IN7A 3ABUA 1K78A 4A3LK 3MD2A 4BY7K 2KRFA 3AAFA 3VOEA 4BXXK 1R71A 2X9DA 4RA2A 4RAGA 3F8FA 3WGIA 1M1EB 2Y0SD 1S7AA 1XSVA 4AIJA 4A3CJ 1FP2A 2R7QA 1O2BA 1X19A 1FSHA 3MFKA 2HTSA 2RVCA 3ISPA 1GVDA 3N4MA 5ILSA 5TGTA 4LLLA 2HNHA 3V7CA 1HBXG 4IRIA 2P5VA 3KPHA 4EATA 2JUGA 5IYDJ 1TWFA 1BGWA 4BEHA 4XICA 4WXDA 2F5DA 3H9GA 3GTGA 2PHCB 1PP8F 4L0ZB 2MD5A 4MTEA 5JFRA 4G7ZA 1E17A 3H36A 2AQFA 2MBFA 3CP2A 1TC3C 2GSUA 3H0GC 2QWWA 3WU2C 2KJBA 2Q2EA 3CCMI 3T0YA 1ISEA 2JA6C 5HOOA 3AQPA 4UB8C 4B3AA 3S15J 4AU7A 4GTAA 1TQPA 5K5OA 4M3DA 2VXZA 4A2UA 4BQNA 2NVXA 1W4MA 4EM2A 3GLLA 4A3EK 1VQ6I 1J6WA 1S6LA 2DO7A 5EGOB 1F93A 1S8NA 4M73A 4KARA 3A02A 1F7VA 2NS8A 3TDUC 3PIPF 2IGNA 1BIAA 2JA6J 4G7OF 2R7ZK 1U0JA 3GTPK 1TWHK 1OYYA 2L7FP 1HC8A 2LH9A 1CF7B 1XTAA 1OCCH 2Y0SN 4E7SA 1TW3A 2ZJQF 2E5ZA 4P9SA 1F43A 3GYHX 3DBHB 5F08A 3FM5A 3LA2A 5H6QA 5K5QA 2E36A 1N78A 2XCQA 4OAZA 1ZTRA 1E3OC 4KN7A 3SXYA 4E7HA 3DCFA 4LITA 2P0WA 4RGXA 2STTA 2BHZA 2FMYA 2P4WA 3L00A 1MDMB 2EIKH 3JSTA 2LC2A 1P92A 3RSNA 4I0AA 3TOBA 2FF4A 4KJZA 3CC4I 2LYCA 3E7LA 1JJ8C 2M45A 2WC2A 2XAFA 3OYJA 3ZMUA 2DT7B 5IYBK 4G7HA 1TWFK 3ASOH 4AYBA 1H89C 3CUQC 1JKQC 3A01A 2H1KA 2QA4I 2MH9A 1JUMA 3GTGK 3M4OC 1EV7A 1B72B 3GUDA 2Z9OA 3HKZA 4HX8A 1B8IA 1OPCA 3HRMA 3G1LA 5CKTA 1Y1VC 3S16C 4PJLA 1S72I 4M6VA 3S1MJ 4IQJA 4C3HC 3S17C 1DP7P 4IXAA 2HKXA 4KIGA 3VA7A 2VUMC 2JTVA 2QF7A 4W1UA 2CUFA 4RBOA 3CJTB 3I4MK 2ELJA 3OYEA 3M4OJ 3V7RA 4RLQA 2QKMB 2Z99A 1Z7LA 3WTVC 3M1EA 5E3NA 4GCVA 4BXFA 3CCJI 1Y1VJ 3S16J 2GM4A 5H20A 3SQNA 2PA8L 4C3HJ 3S17J 3NWTA 2R93C 2VUMJ 5ED4A 2WB1A 2OQRA 4LG0A 9ANTA 3P9KA 4AYBD 2LG4A 1TTYA 4NOIA 2H1LA 1V3FA 1P2FA 4QPOA 3VSKA 2RDPA 3KCCA 2CH0A 2QBYB 1QVTA 2WAQD 2V6SA 5KAFC 3GTOC 4Z6YA 2R93J 1B4AA 3LWFA 4XMYA 5D8LB 4C2TA 4ZTFA 1YX3A 3K2ZA 2RGVA 1ODDA 3BPVA 4Y52K 4FHTA 2BVMA 2K7LA 4RLFA 5ICGA 3PIOF 1ETXA 3E6BA 3WHCA 4XLPA 3PNVA 1SEUA 1DU6A 5K5RA 1WRJA 1WI3A 3ESWB 1LDDA 4AUXA 4ZDOA 2WB1D 1SMTA 5IOYA 2D45A 1ON1A 1QQIA 5E3MA 5B66C 2FBHA 4BLBA 5FD5A 1PJ5A 5E3LA 2TDXA 3F6VA 1QPMA 2HXOA 3VYUB 1K7AA 4BNCA 1P9QC 3TQNA 1TNTA 3W6JB 2XCOA 1MKMA 2MW8A 2RN7A 4AYBN 2BHYA 3MN2A 4HZFA 4J3NA 5C3EK 4YIIA 1X4PA 3FHNA 1I3QA 1QHHD 2YR2A 3MKZA 2DT5A 4RB2C 3HKZN 2QQBA 1JVIA 3PO2C 2HYGD 5DS9A 1IDZA 1IN6A 3QPHA 1H0MA 3EUHC 4XLEA 2FQ4A 3HEFA 1PP7U 3GTLA 4ZH4A 2H8WA 1BI2A 1SFOC 4FASD 4O2DA 2AHQA 3GTMA 3PO3C 3PO2J 1BDFA 3ZOBA 1XXCA 3BJ6A 2ECBA 1H9GA 2R92A 1FOKA 3CCUI 4ZYGA 2XF6A 2E2HA 3ZQLA 1O57A 2P5LC 4KMUA 4QIWL 3CTAA 2WB1N 2E2IC 2GQQA 1SFOJ 2M4KA 3BROA 3JCUC 1MH4A 3MVPA 4KMAA 3PO3J 5LBQA 2A61A 1BC8C 2OA4A 4RGRA 2M1BA 3AD9C 1V5VA 3FXQA 1W36C 2VE9A 1ZREA 3SZZA 1OCRH 1JKPC 1DCPA 3S93A 4I09A 2IA1A 4CCMA 3J7YJ 1WJCA 2Y69H 4FCYA 1IN4A 3I71A 3GIRA 2MG4A 3A0HC 2FEZA 2Q8KA 3KEYA 4WJ4A 2DU9A 2IS2A 1VH2A 4ZYEA 2HPMA 1HW2A 3H5NA 4MEYA 4C30A 4GZYA 1RZ4A 4PFOA 4G7HF 4A3JC 2R5ZA 1I3QK 4LOCA 1VQKI 2EH3A 1SMYA 4I99C 1YW7A 2M30A 5LFAA 1MH3A 3NAUA 1U78A 3ZMTA 1BI0A 3GTLK 3BZ6A 4A3JJ 5C4XK 3TBIA 2W24A 4I2OA 3DU6A 4A3KC 2NVTC 1X1CA 4B48A 1DDNA 1DCOA 1XSXA 4PSWA 3GTMK 3O8GA 4XKVA 1POGA 2R7UA 3ZP5A 2R92K 1R23A 4G0UA 2UV1A 1IBAA 3H0DA 3QOPA 5C44K 2E2HK 2DTZA 4L0YB 3AG4H 2NVTJ 4P96A 4A3KJ 4MEXF 1J75A 3L9FA 4LIUA 3HHGA 2DPUA 5M3MK 2QENA 3VSLA 3JSOA 3HOVJ 2ZMEB 3LL7A 4E7ZA 2VT3A 3VEPA 1OCPA 3TFIA 5HDNA 3LSMA 3DKWA 4YIRX 1LKXA 2QZ8A 2CV2A 2ZSIB 1ITYA 3H3VL 2L4AA 4DDQA 2ZBKA 1JXSA 2V26A 3FK7A 4E7LA 2CYYA 4JBAA 3S2DK 4WK8F 4XLNF 4A12A 3CQZA 5L46A 4MQ9F 3HPGA 4EJOA 3EPZA 1Q1VA 1XDSA 1HDPA 1V4RA 4EMSA 5LGTA 4XKBA 4RMNA 3J81K 2LNBA 1Z6TA 2PMZA 2A5WA 3RZDK 2E2JK 4QTRA 2K40A 1BR1A 4EV0A 3E5QA 1VTNC 3U1DA 2ZSHB 4DOZA 3BTLA 3IL2A 3RKXA 2WAEA 1X3UA 5FFXA 2DK8A 2EILH 3DWLE 1FTTA 4P9FA 1K83A 4EGZA 1G3TA 1K4TA 4BH9A 2Q0OA 2NVYC 2BOLA 2MH2A 3QPSA 1T56A 4Y13A 4UUSB 4PJJA 4UNOA 2RGRA 2VBXA 4DBRA 2DJNA 3CJRB 3DV8A 1JHHA 2GOXB 4CGZA 1C0AA 3U2RA 5J6XA 3F8NA 2K9QA 1BBYA 1SFUA 2GXAA 3ZCOA 4FETA 1AKHA 5CVJA 2KFDA 2PMZD 5M5WK 3S1RJ 1FYKA 3TP3A 3D0SA 3HOYK 3DEUA 2NVYJ 1ZGJA 4FZBA 4YFXA 2L9SA 4D9JA 1CQTA 2HGCA 3I59B 4XLCA 2PA8D 1T98A 2DMTA 3SDGA 3CF5F 1X3WB 1X4OA 1WHUA 3GBGA 2R7XA 4Q5SA 3G1OA 4Y33A 4PJMA 1FBSA 2G7HA 5FFZA 4G94A 2QM3A 2QQAA 3TKYA 4XKCA 3CQZK 3ECOA 1IRFA 5DD8A 3LNQA 3MKYB 4M3BA 3HC7A 4Y3OA 1BOAA 2A6TA 3W2VA 2I8DA 3GTKA 1Y6IA 1BR4A 4BDYA 3JRGA 3BG6A 5JHFA 1MMSA 1WJBA 1Z91A 4I7HA 1Z7UA 2LKPA 1TT0A 2BW3A 3ZN1A 3C2BA 4LQYA 2M0MA 3IWFA 4A0YA 3KE2A 4UVBA 3DLLF 5HLIA 1BJAA 3L2QA 5E1XA 2G0EA 4Q4ZA 5GAEJ 2XROA 2VXDA 3AFHA 4KB2A 3WGHA 2PMZN 1K83K 3BTIA 3S0XA 4O6JA 2O61A 4BJTA 2XF5A 1R7JA 1EH1A 3S32A 2QUFA 3EYIA 4OIRA 2V6UA 1KU2A 4KITB 4BY7C 1ORKA 3FOFA 4NBQA 5CJ9A 5CVUA 2R7VA 1DCHA 4BXXC 3CUOA 4XL9A 3WODA 3T8RA 4ETSA 5KHDA 3MZYA 1CGPA 2R7FA 1Y0UA 2VC0A 1VQ7I 1EQRA 2VQCA 4C9YA 3T8TA 4RS8A 3CUQB 4UVAA 4BXUA 1PVEA 2RNGA 3HOSA 2JPBA 5LHGA 2EA4A 1RKTA 2JA2A 1OYIA 4BXXJ 2JMWA 2W82A 1WSVA 3H5AA 4YG2A 2K9NA 1STZA 3HDDA 4JX5A 1RPWA 4BE1A 5IOTA 3BDDA 1IXSB 1XG1A 3ONQA 5F0FA 1HF0A 1EH7A 4HW0A 1FC3A 3TW7A 4U0YA 1J59A 1YE9A 5IT9Z 3OIQA 4M1XA 3S3MA 2DMPA 3BT9A 5HS9A 2V1UA 1TWCA 3I53A 4A3EC 5E3OA 3A8IA 3L7WA 3J7AO 2LVSA 4HX7A 2P5KA 4R79A 2HS5A 3EETA 4CHUA 1KU9A 2K3FA 3DKYA 3WG9A 1U3EM 2HPIA 3KLOA 3LFUA 3J80K 2CUJA 1FBUA 2R4GA 1J2XA 2L54A 1ACIA 1G2HA 3QPTA 4A3EJ 2E35A 2EV0A 4LK0A 2X48A 2CW0F 3IRQA 3COAC 1IAWA 1K6YA 4PSXA 3S8PA 1MBKA 2M7AA 2XASA 3BP3A 4GT9A 2H09A 5D5WB 1OQYA 4UUTA 1EK8A 3K7AK 5J1RA 4OMYA 2BYVE 2DOFA 2EFNA 1YRNA 2L01A 2YS9A 4CCOA 1H8AC 2VJ5A 3HBLA 4B43A 5EG0B 5A2QZ 1R4NB 5TMFA 3CZ6A 2YX7A 3MZ8A 2K9MA 4BU2A 2EZHA 3HRTA 1ZG1A 2DPDA 1V5EA 4H0EA 2EINH 5FKLA 3BWGA 2XPUA 1RETA 1YNNA 4EJVA 3GTQA 1X2NA 1K4SA 4H4KC 1TWFC 5FROA 1WJ5A 2DI3A 3ROUA 1T6SA 3GTGC 2DFFA 4U0WA 4IZZA 2EFWA 3BUEA 5EEHA 5J40A 4NQWB 4YFXF 2ACJA 4YFKA 2DTRA 2EV6A 3A8KA 3ZMZA 3P9IA 1TWFJ 2PEXA 3PQJA 3KFWX 1TWCK 2BE5A 2NVXC 3HRSA 3GTGJ 1ZK8A 2L9VA 4DYRA 4KDPA 4Z2YA 2KHMA 2G9WA 2BVLA 1BL0A 1UZCA 4D7NA 2PG4A 3K70C 3PQKA 5EGOA 3ZRGA 4D0PA 5D6EA 1Z1DA 1ZGAA 3DTKA 2NVXJ 3BQZA 4L18B 1Y1WK 3OPFA 2X0LA 3H3VD 4I02A 5FRNA 1T39A 4BBSC 3BG9A 3CDHA 1XMXA 3GVAA 5DCFA 4DYQA 2DCEA 1HI9A 4L5JA 4Q47A 3OYGA 1TWGK 1WVRA 4A3FK 2EFOA 2DOEA 4PUSA 1XD7A 5J1UA 1F7UA 3Q0VA 4M6XA 1QPIA 1T08B 4YIFA 1ETYA 3HYIA 4Y52C 4CYCB 1ZKGA 2QCOA 4BBSJ 2UWMA 2HQRA 2Z33A 4JK1A 3L4KA 2IS6A 1X1BA 1W7PA 4QJVB 3FMSA 5HVQC 4G6DA 3RJPA 1AWCA 2E5NA 3HOTA 2B63C 1D1BA 1LEBA 4S04A 5IORA 3GSIA 2E71A 5M5XK 1FIAA 2LOOA 4Y52J 2JVHA 3R61A 2JH3A 5D5VB 1LE8B 4BHPA 5JLWA 4NHJA 3W2AA 3K1NA 1MIJA 4I0BA 3OYHA 1KQ9A 2B63J 5BMZA 4V2FA 1ZRDA 3K4CA 1YI2I 2W1OA 1FYLA 5C3EC 2V1DA 3OS0A 4AIHA 1L3LA 4YG2F 1R00A 2A6HF 4P5BA 1ZH5A 2QSHX 2YU9C 4S05A 3HSEA 1B4BA 3CLQA 5DEQA 1FNNA 5LHHA 1ZQ3P 4P9UA 4F93B 1ZHFA 3QAHA 5KCMA 2KKOA 4ITVA 5C3EJ 1HLVA 4HYEA 3HOWJ 1TBXA 1XGSA 4E4HA 1SFKA 1D0XA 2L0KA 2YU9J 5L3FA 2AQEA 3DBLB 3PL8A 2XSDC 2XAHA 5DCMB 2QSGX 1PJ7A 2I5UA 1RESA 3IHUA 2WY8Q 4HBLA 4GTCA 2OU2A 2N8GA 4A3MC 2JA8K 1WQGA 1BR2A 3DQVC 1BJTA 3FM3A 2H94A 3GTPA 2IP2A 3I54A 2R7ZA 1TWHA 4OAYA 1VQOI 2ESHA 2HQAA 4D7MA 2X6YA 4BS9A 1QNTA 3S3OA 1Y8QB 3MCZA 4LK0F 2D1HA 3MZHA 2HOTA 5E18F 1W1WE 2ZJ2A 5DV5A 2VOPA 4A3MJ 4GDFA 3KZZA 1IGNA 1F1ZA 1Y56A 2FOWA 2O5JA 1G3YA 1QU3A 3CCVI 5DD4A 2NXNB 2OJED 5JR3A 1QZYA 1WORA 1WQFA 4X1EA 1XZPB 3L2WA 3OSFA 1ZR2A 4XBFA 1R58A 2JJ7A 1XGNA 5IYCK 3GW2A 1HA8A 3BOQA 2VN2A 4ZYAA 2E1CA 4IKFA 2NVQC 2V9VA 4KB4A 2G7UA 4JYKA 3GEZA 4JQFA 3GFMA 3K69A 1DQUA 3ULQB 4LOWA 3TTGA 2OQGA 1ONVA 3ML6A 4XOTA 1DU0A 1QA6A 2DA3A 1VRQC 3GEEA 3NUHA 2X51A 2A05A 1AA7A 2NVUB 2NVQJ 2HFHA 1U5TA 2A6EA 2UXNA 5C4XC 4C3IK 2BE5F 3HUGB 1PUEE 4LLGA 4GXOA 3GTMC 1SFEA 1HXDA 4AVZA 1LFPA 1MMDA 1D8JA 5F04A 3TW6A 2R92C 5J4VA 1X1AA 3ERMA 1O3SA 4BLAA 2E2HC 3KP5A 1YIJI 1I50A 1LNWA 2F4OB 3FX3A 3H0GJ 3NQOA 4BQAA 1EKEA 5C4XJ 1GVJA 2JZYA 3GTMJ 2KIUA 2ESNA 3LPXA 1W5CC 4A3IC 2IW5A 5KVRA 6PAXA 1F36A 3ZQHA 2E2HJ 4A3BK 2XGXA 4II3A 1GT0C 1O7FA 3FISA 2B9SA 1MBHA 4WILA 1YJWI 2NAZA 3C3WA 1RUOA 2WV0A 1WJFA 2Y0MA 2L9NA 3LQRA 4UV9A 4XSZF 2CQQA 5M3MJ 2RV8A 4A3IJ 1T2KA 3LSGA 4G6QA 3LSPA 1YJNI 2XGDA 1Z6RA 3JSPA 2KIQA 3T1BA 3A8JA 2PJRA 2BZTA 1QO0D 4ZC3A 4RAFA 5H6RA 3BPXA 2J5PA 3FXRA 3KP4A 4FX4A 4KFCA 4OIPF 2VONA 1VFCA 3RZDC 2E2JC 4PABA 3IH4A 5J3LA 1T95A 4B47A 3KIOA 4QLCU 3RZOC 5IP6A 2LKSA 1BW6A 3ZXSA 5LD2C 1LJ9A 2WAQA 3S2HK 3CMEI 5FKMA 3J7AY 3JRFA 3KLNA 4OIOF 2A69A 4KAWX 2FD5A 2R7OA 3RZDJ 4PCQA 2E2JJ 4XCHA 1X58A 1ETKA 3GDZA 3RZOJ 5KNLA 4NNJA 4M9ZA 1VI0A 2MA3A 3KYCB 4QWQA 4A69C 1GE9A 1F5TA 4EQQA 1I50K 4Y17A 2Y30A 2Y2ZA 2FQTA 1XCBA 4CICA 1E2XA 2JWTA 4N9IA 3IH2A 3S1NK 5E20A 3SEZA 2HU9A 3KP7A 3V7SA 3AD8C 1W5SA 2J5OA 2KZGA 3BZCA 2GIVA 5TJJA 2EB7A 2IT0A 1FZPB 4AWXB 4BY1K 3HOYC 4OOIA 1IC8A 3BR1A 3WU0A 1WFXA 4LK1A 2UXXA 4UVCA 2LY9A 3RQ4A 5HDKA 1XPPA 1HSJA 4HV5A 5ICCA 2CFAB 3M7GA 3B6CA 3QX3A 2W57A 4P5OA 2V6EA 1OCTC 1XDUA 3DXJF 4KIBA 2EIMH 2P6SA 1E3PA 4BQQA 3DPUA 5HNFA 2MLKA 2VI6A 1FMWA 2LP0A 4GRIA 3CQZC 2RC4A 3BR6A 3KYLA 4XRFA 1V5FA 3L1PA 1RIOH 1H88C 3C2HA 3HZJA 5IP9K 2VBWA 4GO1A 3ZMDA 3QYEA 3G2BA 3GTOJ 1I3AA 3V8JA 2O5RA 4CZCA 4HA8A 2M87A 2JVGA 3SHFA 3I9V2 3QYFA 3CQZJ 3F8BA 1BI3A 4ZZLA 5IT3A 2HVSA 3A1YA 1VQ4I 1J98A 3EQLA 3CCSI 3P7NA 2LBFB 3HM5A 2DAOA 2XAGA 1I1GA 2A68A 3R4KA 1K83C 4HPQA 4G9YA 2EV5A 5BPIA 5DM6F 3BQYA 3TFJA 1ZLKA 2M4GA 1ZAOA 1USOA 2K27A 3UNGC 2IGKA 2Z1DA 3R0JA 1G8XA 2HI3A 2WAQN 4XSXA 2COBA 1WJAA 2F2EA 4UUSA 4G7ZF 1I6HK 1K83J 3P5JA 2L7ZA 1KYZA 3JRAA 2HWVA 3K4MA 3N3YA 5FO5A 4CDGA 2ADUA 4DYCA 4F55A 1SC7A 2R5YB 4LLGF 2JRMA 3HGGA 2CU7A 4HRIA 3ABTA 5EJCA 3HL2A 2ZUEA 4AM3A 1FTZA 2VT2A 4BGDA 2F5FA 4UY8I 5BS6A 4ENKA 3FXOA 1R1UA 3QWLA 4C3JC 4BEHB 5DUIA 2K02A 1KYWA 5EZHA 4LB6B 2EFPA 3JRBA 1S3JA 5M3FK 1SD5A 3ASNH 2DDAA 2OUMA 2XDVA 3RI4A 1J09A 2XV4S 2JA5K 1HQCA 4RGUA 3DLAA 1R1VA 2ZXIA 2LK2A 2GWRA 4ANJA 2Q2EB 1K61A 2YUSA 1VGXA 2P6TA 4EJWA 1FBQA 4C3JJ 4ON0A 3D5LA 3W3CA 2JA6A 3GTKC 1FWZA 1YW9A 2LREA 2KIFA 4WXCA 2KDOA 3F9KA 2XVCA 3D5SC 2E2IJ 2R3SA 3EDPA 3SFIA 2KJCA 1W0TA 3TL4X 4A0ZA 1VJEA 3ZPLA 1XX5A 2ZXHA 4IHYA 3GTKJ 1ETWA 2CJJA 3MKWB 4C2UA 4AH6A 4GYIA 5M5YJ 1RRJA 1XMKA 1GV5A 2XB5A 1SVMA 4QPQA 3B02A 3V4GA 2VASA 4Q48A 1T38A 2DFHA 2KQRA 5E8IA 3RKQA 2EK5A 4HAMA 1I6XA 4A3CK 2K86A 2UUZA 4ZYDA 4KIFA 2E7XA 3HPHA 3VODA 1KA8A 5LGUA 4BE0A 2A69F 4DZPA 5HLGA 3K7AC 5IYDK 4N4OB 3ZQQA 1HKTA 5GADJ 5FLXK 4HLYA 1TQIA 2DA2A 1O3QA 1MBEA 2CUZA 3M3YK 5IY5H 2L2OA 2V9KA 3SFZA 1VQMI 4HF1A 5EGHA 5K1YA 4HV6A 1TNSA 1UFMA 2E34A 3A01B 1QZEA 2PI0A 3OYDA 3JAMK 3S15K 4U87A 2DT6A 1NK2P 4PFPA 5CYVA 3IAM2 3AH5A 3ABKH 3H3ZA 1D5YA 1PJ6A 3CDLA 3KZYA 4E7KA 2ZFZA 3GXOA 1B8IB 1G3SA 5LEJA 5DDGA 5FKOA 3TDZC 3N97A 1FX7A 4LG3A 1WCMC 2ZFUA 3CLOA 2DA4A 3ECHA 2JA6K 3I0TA 2JA7A 2PMHA 3GEIA 4IVNA 1MZBA 1UHSA 2UZKA 1P4WA 2EWNA 3GFJA 5LGNA 1HDDC 5GAHJ 3R0AA 2CGPA 3AL0C 1TWCC 3O8HA 2QQ8A 4Y4RA 1SAXA 1FY7A 3OOPA 3CCRI 4HDUA 4XORA 2GZWA 1WCMJ 3FF5A 2ID3A 3KEOA 4PGGA 2L3DA 2RQPA 5HL8A 5GP9A 1HOMA 1TWCJ 1U6GA 5BNGA 2VB6A 3QRFF 1A04A 2FJ1A 4XLPF 3FXUA 3E6DA 5C4JC 1YITI 4M9SA 1TP4A 2K3PA 2VBZA 3WGGA 2XAUA 4HNVA 3QU3A 1IS1A 3NWSA 4WWCA 3OY9A 5L3EA 2GA1A 3BG7A 1PYVA 4CUGA 5FRMA 3DPTA 2A68F 2M0CA 3GZNB 1WJEA 3FXKA 1GXQA 3SZTA 1TLHB 1T8IA 1RR7A 2PJPA 2JSPA 1ETOA 4A3FC 4HSRA 4XLAA 3SZGA 4KN4X 2MABA 5C4JJ 2DA5A 3I4PA 3C7JA 4A93C 4MFEA 2X4HA 1R1TA 3TMOA 2O8XA 2MC3A 1ZG3A 3FKIC 3L4JA 3FMQA 4XSXF 3GTQC 3S1MK 1IN8A 2CV0A 5B1AH 2DMNA 3UKGA 3DPLC 5D4RA 2HQNA 1UG2A 4A3FJ 4XLHA 3M4OK 4A93J 2HYFA 4ZH4F 4IOCF 4K2EA 2TRTA 1UMQA 3TGNA 4A5MA 3FKIJ 4A3GC 1IQ0A 3ZQFA 2ELKA 2JA7K 2HDCA 3GTQJ 4C3HK 3S17K 2JSCA 3OYAA 2F6CA 5FKNA 2GSNA 4YELA 2LY1A 1R22A 4BQOA 2FU4A 3LSHA 3PSFA 3V8LA 2OD5A 3RKWA 1MJAA 3CCEI 4RDUA 4E7JA 3F21A 1R4MB 4OWRB 3K0LA 4QSHA 1LQ1A 1R5ID 1NH3A 4A3GJ 1E0EA 3E0JB 4B3XA 5JHUA 3KZIC 1DUXC 3RTRA 3EUHA 3I55I 1RU0A 1XN7A 3G4CA 2R93K 3H9QA 1ZR4A 3HHHA 4RGSA 2OC6A 4F3QA 1TT5B 2OCCH 3KEQA 2AXLA 2ZJPF 1J6XA 1SFOA 1T0FA 3RYRA 1MJ9A 4X0GA 2NYXA 1JE8A 1HKQA 3PUFA 1J9IA 3BG5A 2Y9YA 4ENMA 4FT8A 2GAUA 2M34A 3LSKA 4CA0A 3RDIA 2LDUA 1WOSA 3GLXA 3GFLA 1JOEA 4U88A 4EVIA 1JT6A 4R8HA 4FTHA 2JA8C 3PFYA 1MMNA 2C6YA 1LFBA 5LRRA 3K4LA 5IP7K 4MEYF 1SANA 4GTEA 2IRFG 1UB9A 3CCQI 3QPLA 2MLGA 2ZNZA 3HG9A 3ERED 1WJDA 2V6TA 1XXBA 4GFBA 5D8KB 2K5CA 2D6FC 4RB1A 1K79A 1SMYF 2BBYA 2F5EA 2X1EA 2AXTC 4N0BA 2O6GE 2JA8J 3A2KA 2V7FA 4FE7A 4XRSG 4MIMA 4HNTA 3CJNA 3G1MA 4I6ZA 3FZVA 4LGWA 2A07F 4A3LC 1U9OA 3MEXA 2EFQA 1RNLA 3C1DA 2XGEA 3M8JA 1KQ4A 3QODA 3K6GA 1IV6A 5AIQA 2ZO4A 3JR9A 1IE0A 2DLLA 2BEOA 1G4DA 2JQ7A 5FJ8J 1A35A 2MGQA 3NEUA 3TO6A 2O9LA 3OS1A 4BY7J 4A3LJ 2Y0SL 1MBGA 1KZHA 2MD0A 2HKOA 2IA0A 3FXMA 3PO2K 2TCTA 3OR2C 2F4IA 1WI9A 3OL4A 1QZZA 4GFQA 4WX9A 1I39A 1W36D 5F64A 2IS4A 1AU7A 2GOMA 1SFOK 2XUBA 3B6AA 4QIWD 2V1XA 3GMEA 2KLOA 2PX9A 2W4SA 2E1OA 2VKHA 1D3YA 1JUSA 3FXLA 3OOUA 2HQ5A 2VJ4A 3Q9SA 4N4NB 1J7KA 4XM3A 4MHGA 4NUBA 4E70A 1IRXA 2FBKA 2Z2SB 4HX4A 4XIDA 4ILDA 1YTYA 3FXJA 5DCMA 3TFHA 2R7ZC 2ZJRF 4CSWA 2NS0A 3GTPC 1TWHC 3MMLB 2K9SA 1O24A 1EA3A 3IPJA 1O25A 1Y1WA 4RM3A 3V42A 2VQLA 2CS3A 2LTPA 4XQFA 1OFCX 3W6KB 4IHTA 1Z05A 1PUFB 1SD4A 2CO5A 5J8FA 5EEGA 2R7ZJ 3GTPJ 1ZQ1C 3GX4X 1JTXA 1TWHJ 2Z5UA 4GTDA 1B59A 3PUBA 2ZKZA 1TWGA 2EBBA 1X3ZB 1MNMC 2VJJA 2M8EA 2B0LA 1MNEA 3BCBA 2HR3A 4C45A 3ZQCA 2JRTA 2VODA 2KZVA 2DN0A 4BE2A 1I6VA 2RNJA 1YS6A 1BIBA 2WA0A 1X2MA 2BXYA 1B9NA 2M5WA 2X1DA 4QIWN 4O3MA 1A5JA 5IYBC 3HOXK 4OINA 3IH3A 3K4BA 1D1AA 2VQGA 2BY1A 1R5GA 3F8MA 4IQ4A 3OS2A 1FMVA 2XRLA 4N9HA 1I1SA 3TEDA 1XSDA 5E68A 3Q3QA 1IZ1A 3S2HC 1VQNI 1V5GA 4AD9A 4B44A 4KASA 4BJ5C 1KQ8A 1NHAA 1U5TC 5IOZA 1FJLA 4A3KK 2NVTK 2VLAA 5IYBJ 1SD7A 3OWTA 4HDVA 4JX6A 1AHDP 4IHVA 4BAYA 1D5VA 4E6KG 5D4SA 2XF7A 3REOA 5ILVA 1WWXA 3HOVK 2XCRB 3I4MC 1ENHA 3GZ5A 3HUGA 4Q5SF 1FP1D 1S7EA 4EM0B 5J47A 2LF8A 3VWBA 2KWAA 3CP8A 1IXRC 3HTSB 4IHXA 3RCOA 3S2HJ 3CO7C 1I50C 1AKHB 3LMMA 5EYRA 3BTCA 4ZDPA 2XC7A 3S1NC 2VPRA 3UR3C 4X6AK 2JK3A 5K7HA 2QEXI 4F52A 1I5ZA 3E5UA 5GTIC 2STWA 3I4MJ 2DOAA 1OCOH 4I98B 4BY1C 1EJ9A 1RUNA 1CF7A 4GTFA 1I50J 1ZLJA 5BPDA 3DP7A 1Y8RB 5B5EC 3N0CA 3S1NJ 4AYBL 2M8GX 2YSRA 4CCNA 4Q4ZF 1WZ2A 1IV8A 2P5MA 4BY1J 5LRSA 5L3GA 2F5CA 3HKZL 1OISA 3BR3A 4LIVA 3LSIA 1ETVA 4G7OA 2H6CA 1ZRFA 1AB4A 4FISA 2M9HA 2V1NA 5IP9C 5K7ZA 3CDIA 3HOZK 1FLIA 4OIRF 3MWMA 1MDMA 1Z3YA 3I56I 3D1NI 2LMDA 2BW3B 2IS1A 4CH7A 3H3VK 4L9NA 2FQ3A 2OPTA 2QKLB 3SEQA 3DTIA 2E1MC 2RKHA 3ABMH 3HSRA 4FE4A 3WODF 3FHZA 1Z9CA 3W6VA 2EZIA 4A5NA 1YNJA 5EGEA 2PFBA 5IP9J 3G4SI 3IC7A 1B72A 2L7KA 2OZUA 3IKVA 3GEHA 4MLOA 2X6WA 2WB1L 2HTJA 5ERIA 3S1RK 3OL3A 1BC7C 2NVYK 4G6TB 2F48A 4KMHA 4BYYA 1T33A 2HEOA 2X6OA 1OYWA 2VQHA 1HKSA 2W25A 4DNCA 2GXBA 1SD6A 3OEPA 3GWZA 2P7VB 2LD5A 3WTTC 1WKMA 4KNYA 1A6QA 3FKJA 3I58A 4RMFA 4M72A 3BP8A 2DFEA 1Z67A 4CCLA 2K9LA 2LSOA 3B73A 1R9TA 3HSFA 2K4BA 3BR2A 3RPQA 2KL4A 3C18A 3ABLH 1MNDA 2PN6A 5FGMA 2KPMA 5HODA 3GFIA 3OMYA 2H6BA 2JPCA 1IUYA 2DFIA 4O5VA 2QBYA 4II2A 1P6RA 2XAQA 3SZPA 2K85A 1O3RA 1NG6A 3NARA 5TRDA 4LB5A 1UV7A 4E7IA 1XMAA 1FIPA 4BBRK 4G0WA 5CQEA 3FDYA 5JVOA 3AL0B 1RI7A 1A36A 4KT5C 1YX2A 4S0HB 1D0YA 5M3FJ 2ISZA 3S1QK 4MGRA 2IJLA 4J01A 2OV7A 4A3DK 4V2GA 1ULYA 3T5XA 3WU1B 2GAGC 4NC8A 1SFXA 5E8GA 3Q5FA 1INNA 1KU7A 3J81Z 1C0WA 4Y7NK 1XS9A 3DEEA 2ZUFA 2HYJA 1UHMA 5EZGA 2EBIA 1BOBA 3E5XA 4KM9A 1MMGA 2ZNYA 1B6AA 3RPUD 1I3QC 1XXAA 4A3CC 3L2RA 5FLMK 2VBYA 2HDWA 3KP6A 4OIQA 1ZXOA 1OCZH 2RH6A 1YRNB 4LJZA 3G6EI 4CCKA 2IAIA 3QYBA 4CYDA 4YFKF 2ME6A 5DM7F 5B3SH 5IYDC 2XSJC 3TO9A 2GXGA 1R9TK 3DKXA 3LA7A 3GTLC 2V9PA 2EIJH 1GXPA 1I3QJ 3IP4B 5TISC 2R5YA 3M3YC 3N0BA 1EH6A 3D5RC 5GPCA 3BR0A 2DYRH 1JGGA 1J6VA 3T00A 2ZC2A 2HVRA 3IRRA 5C44C 2D1VA 1UHWA 2EQRA 4XLFA 4BHCA 4L9JA 4NC7A 3S15C 1B9MA 3GTLJ 1ZVUA 5ILUA 5F27A 2W84A 3I3LA 4G0VA 4F91B 2FNAA 4KATA 2O3FA 3M3YJ 1ZYRA 2HZTA 1MMAA 2OZ6A 2R92J 3AKZA 3BR5A 2E60A 5D5UB 4DJAA 1OR7A 5C44J 4M3GA 4HG2A 3OYBA 5LEKA 1YX5A 3IAS2 4BKXA 1S5LC 1XB4A 3HOUK 2GSOA 3H3UA 3TOAA 2CQKA 5IOSA 4R1HA 3IKTA 3DBRB 1TWAA 4CO8A 2FQOA 1X1PA 4WF2A 1U8BA 3S2DC 1XC5A 3PFIA 3TP0A 1EI6A 2F5VA 2FUG2 2L4MA 1WSUA 2Y75A 2WWYA 4EM1A 1IDYA 1SVOA 3O6BB 2ZCWA 3C2GA 1UG0A 3S2DJ 4HNUA 2IPQX 2DJIA 3OYMA 1RC9A 2O0YA 3IV5A 4KN7X 2LR8A 2MSYA 3ZQGA 4JOMA 3U1KA 1R6RA 3FMRA 2XRNA 4XOPA 2CFOA 4MNUA 1NTCA 3HJEA 5CLSA 2P8TA 1W7PB 1LPQA 3QQAA 4I76A 4DGWB 3F22A 3CD6I 1XZQB 2KP6A 3K70D 4ENJA 3BC8A 1WOPA 5GTHC 3P9CA 3S1MC 2VKDA 2R7WA 2ELHA 1Z21A 2B63A 3K10A 1K6OA 3LOCA 4AIDA 3CO6C 4ZJZA 3VPRA 2DXIA 2V4JC 3A0BC 4C2MK 1IUFA 5LLQA 1Q1HA 2OTLI 3EYYA 4G8XA 3SYTA 1R49A 4IPAA 1VF9A 5ICFA 2JA7C 5HLTA 1YJ9I 1F4KA 4BL0B 2ZMEA 2O8KA 1O2FB 2PMZL 2NVXK 4CZZA 2BXZA 4UB6C 4DIQA 5J4YA 2ECCA 1J0RA 1TWAK 2VKEA 1E3HA 2CUEA 5M5WJ 3QP5A 5IT9K 2JA5A 3HOYJ 1UCRA 5F0CA 2YU9A 4CXFA 2YPRA 3S3NA 2JA7J 2KRHA 4WXHA 2H27A 4JX4A 3ZR8X 3L2CA 1LFUP 4MEXA 1W0UA 5AONA 4IHWA 5HS7A 4DW6A 3HRUA 1O26A 3MMYB 3ZGKA 3L2VA 3S14K 4V19K 1DGRM 4BBSK 2QLZA 3HKZD 1MBFA 1WH7A 3J80Z 3O3KA 3OYNA 1IXCA 2AS5F 3S2WA 1DPUA 1I27A 3EUKL 1KONA 3CF2A 3GTJA 1L0OC 1JTYA 1N75A 1G3WA 4XLNA 5IP7C 3G73A 2FRHA 4MQ9A 3WTXC 2VKVA 1U9NA 3KYDB 3AD7C 1IO2A 2LKXA 4L9TA 4DQ2A 4IRGA 2CW7A 1KU3A 4OIQF 4HF2A 3FIWA 2BY3A 1K78B 2B63K 3Q3SA 4LJZF 4B09A 1X1DA 2EZKA 3JW4A 1YG2A 5A2QK 5CPRB 2XAJA 3HXLA 3FBNB 4IF4A 2JT1A 1Z0XA 5IP7J 4KA4A 1DGWY 4XN3A 2A6EF 1JKRC 2L9RA 1JQWA 4LR2A 1O2AA 1IJWC 2HDDA 2E1NA 2Q1ZB 3AG3H 3J7ZI 3CMMA 1MJBA 3QU6A 4IX7A 1IF1A 3VYRB 2EA2A 3HOWK 3E97A 3I59A 4UUVA 2GBYA 2XGCA 3LQQA 4B1RA 1D1CA 3CAGA 2YU9K 4YEJA 3Q0WA 5JLXA 1ZYRF 5CVVA 2B7EA 1U5TB 4ZYHA 1YHQI 2HOAA 2OBPA 4HOBA 2NS7A 3BG3A 3H0GA 5L3DA 2BGCA 3IWZA 2XB0X 4IHSA 1KGSA 3CCYA 2GAHC 1T0FC 3CMAI 1G59A 5F6FA 2JN6A 2PLYA 1QVUA 4L5IA 3F72A 3PJRA 2ME0A 5JFEA 3ZMVA 3PNTA 1YW8A 4KMUX 4ZDLA 5GPAA 2FNPA 1BW5A 4UHTA 1OKRA 4KT6A 4A3MK 3GTJK 2CV1A 4HEA2 2XPVA 1ZGWA 3SZYA 2WV1A 1P7IA 4RB0A 4KMFA 3I4NK 1UJ8A 2FXAA 4LLNA 1LVAA 4KDDA 3WG7H 4A6EA 3A4CA 3K1MA 3ADAC 2DA1A 3BJOA 4F92B 4B8XA 2NOJB 1FYMA 2WY7Q 4KYWA 2ISYA 3DFGA 3WTYC 1YS7A 3L09A 3U9GA 4A0XA 1B1BA 4P1WA 2M3AA 1KQ0A 1IRZA 2PJRB 5DYMA 2VIXA 1JUPA 4HQMA 3A03A 1HW1A 2OCEA 3RYPA 2NVQK 1WQHA 1JGSA 5E1WA 3VYTB 3LAJA 2WAFA 3K7AJ 4OU0A 2DDBA 4M9XA 2QGUA 2E1MB 2CFXA 1QRYA 1TW2A 2HXIA 1DPRA 3HOXC 3CUQA 3WTZA 4IRHA 3Q0UA 1ZRCA 2DQRA 5AIPA 4W97A 4GTLA 2X6XA 1LDJA 3OV8A 5FLVA 5GAGJ 3KX2A 4LK1F 3H0GK 1Y1VA 4D5CA 4LD5A 4KM8A 3FBIB 1LUJB 2YU3A 3HOXJ 3WTUC 4ESJA 2CRGA 2VUMA 3H5RA 2F4MB 4PJNA 4RM2A 2VE8A 3HOVC 1OLTA 3KP2A 1DP3A 2COMA 2DMUA 1Y0NA 2MYSA 3JRCA 2CSOA 1TZLA 5DUKA 4HF0A 3K4JA 2R7TA 5JVGF 3SJMA 4X6AC 2M2EA 4LG0B 2Y3PA 1WIHA 3JREA 4U0VA 2R93A 4BACA 4UXNA 2BY2A 4GGGA 2L5QA 1Y1WC 1WOOA 4A3IK 3MAJA 4XRSA 2ID6A 4HQEA 2OAZA 1ETQA 2ZXJA 3H92A 3EQLF 2QQ9A 4IL6C 3KETA 4X6AJ 1ZG5A 3GTOA
chains in the Genus database with same CATH topology
2VC1A 2V6CA 2FSWA 1FT9A 4KUMA 4BKWA 3TO7A 1YQAA 5HLHA 3G4AA 1R5HA 3M8FA 2A5YB 2P7CB 3F3XA 1O28A 1HW5A 1O7LA 4NQWA 1XCVA 4NB5A 5HS8A 4Y15A 1H9TA 1REPC 2EJRA 4M71A 4PGHA 2XIGA 4IJAA 3I5UA 3KP3A 3E6MA 1EH8A 4ASNA 4P5AA 2LF7A 3GF2A 2QYOA 5JVTA 1U8RA 3HTUA 2NNYA 1YLFA 1AOYA 2E2IA 2FBIA 4PDKA 3ZQ7A 5KK1A 5ICEA 3Q9VA 3WTSC 3I64A 4FX0A 3RKYA 2BV6A 3GO5A 4ZZDA 5BOXA 4WCGA 2DK5A 1YIOA 3K9TA 2CG4A 4LFUA 2FE3A 3E3VA 4L9VA 5BQTA 1O3TA 5E1ZB 1XGOA 1DD5A 3BJAA 4I01A 2E7WA 4U7DA 2R7DA 3ELKA 1YYVA 2FMLA 4U7BA 1LEAA 1PDNC 1D8KA 4M74A 3VFZA 4ESBA 5D6FA 1P4AA 4C3IC 1IN5A 1JHFA 1LDKB 5TJ3A 5LHIA 2PBIA 4EJUA 4ENNA 4LMYA 3R6SA 3HIFA 3LSTA 2W85A 3V8KA 1OMIA 4EJTA 1WCMA 4RAYA 1O29A 3ZMSA 1BM9A 3R60A 1BI1A 5D5XB 2Y48A 4ESFA 1YO5C 3DF8A 4KICA 3K1PA 3F23A 3AQOA 3WTWC 2D2WA 3M9AA 3QP6A 3F8CA 2XKOA 4FM9A 5J8CA 2Z3YA 4P55A 3JTHA 4YFNF 4KMDA 2DW4A 5HDGA 5E17F 3LAPA 1ON2A 2VOOA 1O27A 2WTEA 1J5YA 4MQVA 4AIKA 4BHBA 3WE3A 2NVYA 2ZFWA 4M6YA 3FKIA 4F7ZA 2PQ8A 4TV7A 5CHPA 1QGPA 2HOEA 2A3SA 3M8EA 1TQMA 4RAZA 2GA2A 1USSA 2XKPA 4C2MC 2YX4A 2KIMA 5L3BA 2NRAC 2L02A 3GZ6A 2IA2A 1LB2A 3O2PE 4KC6A 1FPQA 1WQ2A 5L3CA 1XGMA 1R36A 5FD6A 4A6DA 1F9NA 1YFHA 4RB3C 2DBBA 3F6OA 3BY6A 1HSTA 3LFKA 5CVRA 1ZBSA 1P4XA 4GTBA 5F1RA 3WE2A 2V79A 1FSEA 2CWEA 2FA5A 2PMUA 2K4JA 4JK1X 1G6NA 1U2WA 2NNNA 4AVPA 1ZN2A 2ETHA 2O03A 5CVIA 1IW7F 5FLXZ 1IRGA 2IVMA 4UV8A 3NRVA 1USTA 3JAMZ 3MQ0A 2FOKA 3RIRA 3E6CC 2QVOA 1MD0A 4EGYA 4PZJA 3LA3A 3ZN0A 2CFAA 3RPUA 4OMZA 1W5TA 1W7PD 1S7OA 1BN5A 5IOQA 1S29A 4GYGA 3VB2A 2XHKA 2DQLA 3OREA 3FOEA 1MGTA 3JTGA 4HLXA 1GHCA 1ZARA 3FWEA 5FB2A 1QBJA 4OINF 3G3ZA 4MTDA 5JI6A 1IN7A 3ABUA 1K78A 2KRFA 3AAFA 3VOEA 3F8FA 3WGIA 1S7AA 1XSVA 4AIJA 1FP2A 1O2BA 1FSHA 3MFKA 2HTSA 2RVCA 3ISPA 3N4MA 5ILSA 4LLLA 3V7CA 1HBXG 4IRIA 2P5VA 1TWFA 1BGWA 4WXDA 2F5DA 3GTGA 2PHCB 1PP8F 4L0ZB 2MD5A 4MTEA 5JFRA 1E17A 2GSUA 2MBFA 2QWWA 2KJBA 2Q2EA 3T0YA 1ISEA 5HOOA 3AQPA 4GTAA 1TQPA 5K5OA 2VXZA 4A2UA 2NVXA 1W4MA 4EM2A 1S6LA 2DO7A 1S8NA 4M73A 4KARA 3TDUC 1BIAA 4G7OF 1OYYA 1CF7B 1TW3A 3GYHX 3FM5A 3LA2A 5H6QA 5K5QA 2XCQA 3SXYA 4RGXA 2STTA 3L00A 2FMYA 2P4WA 1MDMB 1P92A 4I0AA 3TOBA 2FF4A 2M45A 2WC2A 2XAFA 3ZMUA 3CUQC 2MH9A 1EV7A 3GUDA 2Z9OA 4HX8A 1OPCA 3HRMA 4C3HC 1DP7P 4IXAA 2HKXA 4KIGA 3VA7A 2JTVA 3V7RA 2Z99A 3WTVC 3M1EA 4GCVA 5H20A 3SQNA 5ED4A 2OQRA 4LG0A 3P9KA 1TTYA 1V3FA 1P2FA 2RDPA 3KCCA 2QBYB 1B4AA 3LWFA 5D8LB 3K2ZA 2RGVA 1ODDA 3BPVA 4FHTA 2K7LA 5ICGA 3E6BA 5K5RA 1WRJA 1LDDA 1SMTA 2D45A 1ON1A 1QQIA 2FBHA 4BLBA 5FD5A 2TDXA 3F6VA 1QPMA 1K7AA 4BNCA 3TQNA 3W6JB 1TNTA 2XCOA 1MKMA 2RN7A 4J3NA 4HZFA 4YIIA 1I3QA 2YR2A 2DT5A 4RB2C 2QQBA 2HYGD 1IN6A 3QPHA 1H0MA 1PP7U 3GTLA 1BI2A 3GTMA 1XXCA 3BJ6A 1H9GA 2R92A 1FOKA 4ZYGA 2E2HA 1O57A 2P5LC 3CTAA 2GQQA 3BROA 4KMAA 5LBQA 2A61A 1BC8C 2OA4A 4RGRA 2M1BA 3FXQA 2VE9A 1ZREA 4I09A 2IA1A 1IN4A 3I71A 2FEZA 2Q8KA 2DU9A 4ZYEA 1HW2A 1RZ4A 4G7HF 1YW7A 2M30A 1U78A 3ZMTA 1BI0A 3BZ6A 2W24A 4I2OA 1DDNA 1XSXA 3ZP5A 1R23A 4G0UA 3QOPA 4L0YB 4P96A 4MEXF 1J75A 3L9FA 3HHGA 2DPUA 2QENA 3JSOA 2ZMEB 2VT3A 3VEPA 5HDNA 3DKWA 2QZ8A 2L4AA 4DDQA 2ZBKA 1JXSA 2CYYA 4JBAA 4WK8F 4XLNF 4A12A 3CQZA 4MQ9F 4EJOA 1XDSA 1V4RA 4EMSA 5LGTA 3J81K 2LNBA 1Z6TA 4EV0A 3E5QA 1VTNC 3U1DA 3IL2A 3RKXA 1X3UA 5FFXA 2DK8A 4P9FA 1K83A 4EGZA 1G3TA 4BH9A 2Q0OA 2MH2A 4Y13A 4UNOA 2RGRA 2VBXA 3DV8A 1JHHA 4CGZA 3U2RA 5J6XA 3F8NA 1SFUA 1BBYA 5CVJA 1FYKA 3D0SA 3DEUA 1ZGJA 4FZBA 2HGCA 3I59B 1T98A 1FBSA 2G7HA 5FFZA 4G94A 2QM3A 2QQAA 3TKYA 3ECOA 1IRFA 5DD8A 1BOAA 3GTKA 1Z91A 4I7HA 1Z7UA 2LKPA 3ZN1A 4LQYA 3IWFA 4A0YA 3KE2A 4UVBA 5HLIA 1BJAA 5E1XA 2XROA 4KB2A 3WGHA 3S0XA 4O6JA 2O61A 1R7JA 1EH1A 2QUFA 3EYIA 1KU2A 3FOFA 5CJ9A 5CVUA 3CUOA 3T8RA 4ETSA 1CGPA 3MZYA 2R7FA 1Y0UA 2VC0A 3T8TA 4RS8A 3CUQB 4UVAA 4BXUA 3HOSA 2JPBA 5LHGA 2EA4A 1OYIA 1STZA 5IOTA 3BDDA 1IXSB 1EH7A 4HW0A 1FC3A 4U0YA 1J59A 5IT9Z 4M1XA 2V1UA 5HS9A 1TWCA 3I53A 3L7WA 3J7AO 4HX7A 2P5KA 4R79A 2HS5A 3EETA 4CHUA 1KU9A 3WG9A 1U3EM 3KLOA 3J80K 1FBUA 1J2XA 2L54A 3QPTA 2EV0A 2CW0F 3IRQA 3COAC 1IAWA 2XASA 4GT9A 2H09A 5D5WB 1EK8A 4OMYA 2BYVE 2EFNA 2L01A 5A2QZ 2YX7A 3HRTA 1ZG1A 2DPDA 4H0EA 3GTQA 3BWGA 4EJVA 2DI3A 3ROUA 1T6SA 4U0WA 2EFWA 3BUEA 5EEHA 2ACJA 4YFXF 2DTRA 2EV6A 3ZMZA 3P9IA 2PEXA 3PQJA 3KFWX 3HRSA 4KDPA 4Z2YA 2G9WA 2PG4A 3PQKA 4D0PA 5D6EA 1Z1DA 1ZGAA 4L18B 3OPFA 2X0LA 4I02A 1T39A 3CDHA 3GVAA 5DCFA 4L5JA 4Q47A 2EFOA 1XD7A 4M6XA 4YIFA 3HYIA 2UWMA 2HQRA 2Z33A 3L4KA 1W7PA 3FMSA 5HVQC 4G6DA 3RJPA 1AWCA 3HOTA 1LEBA 4S04A 5IORA 3R61A 2JH3A 5D5VB 4BHPA 4NHJA 3K1NA 4I0BA 1KQ9A 5BMZA 1ZRDA 1FYLA 2V1DA 4AIHA 1L3LA 4YG2F 1R00A 2A6HF 4P5BA 1ZH5A 4S05A 3HSEA 1B4BA 5DEQA 1FNNA 5LHHA 4P9UA 1ZHFA 3QAHA 2KKOA 4HYEA 1TBXA 1XGSA 5L3FA 2XAHA 5DCMB 4GTCA 4HBLA 3IHUA 2OU2A 1WQGA 3DQVC 1BJTA 3FM3A 2H94A 3GTPA 2IP2A 3I54A 2R7ZA 1TWHA 2ESHA 1QNTA 4LK0F 3MCZA 2D1HA 3MZHA 5E18F 2ZJ2A 5DV5A 2VOPA 3KZZA 1F1ZA 1G3YA 5DD4A 5JR3A 1QZYA 1WQFA 4XBFA 1R58A 1XGNA 3GW2A 3BOQA 2VN2A 2E1CA 2V9VA 4KB4A 2G7UA 3GEZA 4JQFA 3GFMA 3K69A 3ULQB 2OQGA 1ONVA 3ML6A 3NUHA 2HFHA 1U5TA 2UXNA 2BE5F 1PUEE 4GXOA 1SFEA 1HXDA 1D8JA 1O3SA 4BLAA 3KP5A 1I50A 1LNWA 3FX3A 3NQOA 4BQAA 1GVJA 2JZYA 2KIUA 2ESNA 3LPXA 2IW5A 5KVRA 6PAXA 2XGXA 1O7FA 2NAZA 3C3WA 1RUOA 2WV0A 2Y0MA 3LQRA 4UV9A 4XSZF 2RV8A 1T2KA 4G6QA 1Z6RA 3JSPA 3T1BA 1QO0D 5H6RA 3BPXA 2J5PA 3FXRA 3KP4A 4FX4A 4KFCA 4OIPF 2VONA 4QLCU 1LJ9A 3KLNA 4OIOF 4KAWX 4PCQA 4M9ZA 2MA3A 4QWQA 1GE9A 1F5TA 4EQQA 4Y17A 1XCBA 4CICA 1E2XA 4N9IA 5E20A 3V7SA 3KP7A 1W5SA 2J5OA 2GIVA 5TJJA 2EB7A 2IT0A 1FZPB 4AWXB 4OOIA 3WU0A 2UXXA 4UVCA 5HDKA 1HSJA 4HV5A 5ICCA 2CFAB 3M7GA 3QX3A 2W57A 4P5OA 1XDUA 3DXJF 4KIBA 2P6SA 2MLKA 2RC4A 4XRFA 1RIOH 2VBWA 4GO1A 3ZMDA 3V8JA 4HA8A 2M87A 3SHFA 3F8BA 1BI3A 4ZZLA 5IT3A 3P7NA 2DAOA 2XAGA 1I1GA 3R4KA 4G9YA 2EV5A 5BPIA 1ZLKA 1ZAOA 2K27A 3R0JA 2F2EA 4G7ZF 1KYZA 2HWVA 3N3YA 5FO5A 4CDGA 2ADUA 4LLGF 3ABTA 2VT2A 2F5FA 5BS6A 4ENKA 1R1UA 4C3JC 5DUIA 2K02A 1KYWA 4LB6B 2EFPA 1S3JA 1SD5A 3RI4A 2XV4S 1HQCA 4RGUA 1R1VA 2GWRA 2P6TA 4EJWA 1FBQA 4ON0A 3D5LA 2JA6A 1FWZA 1YW9A 2KIFA 4WXCA 2XVCA 2R3SA 3EDPA 2KJCA 4A0ZA 3ZPLA 4GYIA 1XMKA 3B02A 3V4GA 1T38A 4Q48A 5E8IA 2EK5A 4HAMA 1I6XA 2K86A 4ZYDA 4KIFA 2E7XA 3VODA 1KA8A 5LGUA 2A69F 5HLGA 1HKTA 5FLXK 4HLYA 1TQIA 1O3QA 3SFZA 4HF1A 5EGHA 5K1YA 4HV6A 1TNSA 1UFMA 2PI0A 3JAMK 5CYVA 3AH5A 3H3ZA 3KZYA 2ZFZA 3GXOA 1G3SA 5LEJA 5DDGA 3TDZC 3N97A 1FX7A 3CLOA 3ECHA 2JA7A 3I0TA 2PMHA 4IVNA 1MZBA 2UZKA 1P4WA 2EWNA 3GFJA 5LGNA 2CGPA 3R0AA 1SAXA 1FY7A 3OOPA 4HDUA 2GZWA 3FF5A 3KEOA 4PGGA 2L3DA 2RQPA 1U6GA 3QRFF 1A04A 4XLPF 3FXUA 3E6DA 4M9SA 3WGGA 2VBZA 3QU3A 1IS1A 4WWCA 5L3EA 2GA1A 3DPTA 2A68F 1GXQA 3SZTA 1TLHB 2PJPA 4KN4X 3I4PA 3C7JA 2X4HA 1R1TA 2O8XA 2MC3A 1ZG3A 3L4JA 3FMQA 4XSXF 1IN8A 3DPLC 5D4RA 2HQNA 2HYFA 4ZH4F 4K2EA 3TGNA 4A5MA 2HDCA 2JSCA 2GSNA 1R22A 2FU4A 3V8LA 2OD5A 3RKWA 1MJAA 3F21A 3K0LA 1LQ1A 5JHUA 1DUXC 3RTRA 3EUHA 3G4CA 1XN7A 3HHHA 4RGSA 3KEQA 2AXLA 1SFOA 1T0FA 3RYRA 1MJ9A 2NYXA 1JE8A 1HKQA 1J9IA 4ENMA 4FT8A 2GAUA 3RDIA 2LDUA 3GLXA 3GFLA 4U88A 4EVIA 4R8HA 2C6YA 5LRRA 4MEYF 4GTEA 2IRFG 1UB9A 2MLGA 2ZNZA 3ERED 1XXBA 5D8KB 4RB1A 1K79A 1SMYF 2BBYA 2F5EA 2O6GE 4N0BA 3CJNA 3FZVA 4LGWA 2A07F 3MEXA 2EFQA 1RNLA 3C1DA 1KQ4A 5AIQA 2ZO4A 2DLLA 2BEOA 1G4DA 3NEUA 3TO6A 2HKOA 2IA0A 1WI9A 1QZZA 4GFQA 4WX9A 5F64A 2XUBA 2V1XA 1D3YA 3Q9SA 4MHGA 1J7KA 4E70A 2FBKA 4HX4A 4ILDA 1YTYA 5DCMA 2NS0A 3MMLB 1O24A 1O25A 1Y1WA 3W6KB 4IHTA 1Z05A 1SD4A 2CO5A 5J8FA 5EEGA 3GX4X 2Z5UA 4GTDA 1B59A 2ZKZA 1TWGA 2M8EA 2B0LA 2HR3A 2JRTA 2VODA 2RNJA 1YS6A 1BIBA 2M5WA 1B9NA 4O3MA 1R5GA 3F8MA 4N9HA 1I1SA 1XSDA 3Q3QA 1IZ1A 4KASA 4AD9A 1KQ8A 1NHAA 1U5TC 1SD7A 4HDVA 4BAYA 1D5VA 5D4SA 3REOA 5ILVA 1WWXA 2XCRB 3GZ5A 3HUGA 4Q5SF 1FP1D 4EM0B 2LF8A 2KWAA 1IXRC 3HTSB 3CO7C 1I5ZA 3E5UA 2STWA 4I98B 1RUNA 1CF7A 4GTFA 1ZLJA 5BPDA 3DP7A 3N0CA 2YSRA 4Q4ZF 2P5MA 5LRSA 5L3GA 2F5CA 2H6CA 1ZRFA 1AB4A 1FLIA 4OIRF 3MWMA 1MDMA 4L9NA 2FQ3A 2RKHA 3HSRA 1Z9CA 3WODF 3FHZA 4A5NA 5EGEA 2PFBA 3IC7A 2OZUA 3IKVA 2HTJA 5ERIA 1BC7C 4KMHA 4BYYA 2HEOA 1OYWA 1HKSA 2W25A 4DNCA 2GXBA 1SD6A 3OEPA 3GWZA 2P7VB 3WTTC 1WKMA 4KNYA 3I58A 4M72A 3BP8A 2LSOA 3B73A 1R9TA 3HSFA 2K4BA 3RPQA 3C18A 2PN6A 5FGMA 3GFIA 2H6BA 2JPCA 1IUYA 2DFIA 4O5VA 2QBYA 1P6RA 2XAQA 3SZPA 1O3RA 5TRDA 4LB5A 1XMAA 4G0WA 5JVOA 1RI7A