1F9NA

Crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
KGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE REPRESSOR/ACTIVATOR PROTEIN
publication title The structure of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f9nA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1f9nA02
2ZMEB 1JHHA 2IT0A 1BI0A 3DXJF 2Y0MA 2JZYA 3JTGA 4KUMA 2XHKA 2E7WA 3I54A 2W24A 3RJPA 1XCBA 3GZ6A 1W5TA 1T98A 1XSXA 3NUHA 3F6OA 5LEKA 3GXOA 4CGZA 5LEJA 1TQMA 4RB0A 2L02A 5E1ZB 1S7AA 2GZWA 4BHPA 3LQRA 2K4JA 4CZZA 2EK5A 1KU2A 2A6HF 2M5WA 1J7KA 4J3NA 4G6DA 2MA3A 4B09A 1SMYF 4Q47A 1A04A 2DW4A 3J80K 3VB2A 1J5YA 3B73A 4OOIA 1HSJA 1TQIA 2RNJA 4G0WA 2LSOA 3L7WA 1BJTA 4RB3C 1BC7C 3ZPLA 2MLGA 2PN6A 1YTYA 2IP2A 3EYIA 4N0BA 2Z99A 1YFHA 2FU4A 1T0FA 3E5QA 1MJAA 4P55A 3GF2A 3IKTA 5K5QA 3EUHA 3V8KA 1DD5A 5JR3A 2LDUA 1YLFA 2GXBA 2LF8A 2V1UA 5HDGA 3J80Z 4AD9A 2FBIA 3KFWX 3KZZA 3ZQ7A 1W7PD 3E5XA 4G0VA 1G6NA 3SZTA 1NHAA 3AAFA 2XKPA 4DNCA 2P6SA 4MGRA 4KICA 1UB9A 2OZUA 3V7RA 3TDUC 2P4WA 1ZARA 4ENNA 4Z2YA 1QZZA 2YX7A 4KDPA 2EFNA 4P5OA 3F22A 1ULYA 2PMHA 3HOTA 3H3UA 4Q5SF 4M74A 2HR3A 4IXAA 5A2QZ 4LK1F 1XGSA 2STTA 3P9CA 4YFNF 4A6EA 3RKWA 1YQAA 3R0AA 3TO6A 2RGRA 1B4BA 1CF7A 3WTTC 2HWVA 5HOOA 2XASA 3U9GA 3KLOA 5LHGA 5FD6A 4YFKF 3QX3A 3CO7C 1R22A 1HBXG 4IHTA 1G3TA 3R61A 5LLQA 2ADUA 3TO9A 2Z5UA 4LB5A 2PQ8A 1MKMA 1WI9A 2Y3PA 2FQ3A 2V1XA 1GXQA 2F5FA 2ZNZA 1YG2A 3BJOA 2ZCWA 1T39A 3ISPA 3EETA 4XLPF 2XCRB 1XDSA 2D45A 2ELHA 2P7VB 6PAXA 2ZXJA 2BBYA 4KC6A 2QQ9A 3FOFA 5K5OA 1ZRDA 2FMLA 2O61A 2E7XA 3M7GA 1WWXA 2HKXA 3ERED 1EK8A 1Z1DA 2OA4A 4AVPA 5KK1A 2XUBA 3GFJA 5J6XA 4LGWA 1U3EM 4B8XA 1HW5A 4XSXF 4RGRA 3JTHA 5CVJA 1SAXA 4CHUA 4FM9A 4ENKA 2OZ6A 1P6RA 2KIUA 4BYYA 3MWMA 4UV9A 2A3SA 3RPQA 2YSRA 1LDDA 1XMKA 5DEQA 5LGUA 3DKWA 4ZYDA 2F2EA 2ZBKA 2Q2EA 4O6JA 3WTUC 3TO7A 1ZN2A 3QPHA 3KP3A 4U88A 5FGMA 3ZP5A 1FYMA 4CICA 4G7OF 3F6VA 4E70A 3BPXA 1S8NA 1XDUA 4M9SA 1TNSA 1YIOA 4EM2A 1BI2A 4LLNA 1XSDA 3R0JA 4LG0B 3ECHA 2W84A 1ODDA 4MTDA 2OD5A 5ICFA 3N97A 4HX8A 1U6GA 3KE2A 2J5PA 3TOBA 1B1BA 3F21A 3V7SA 5D6EA 4N9HA 3FMRA 4I0BA 3WTWC 1XN7A 5L3BA 5FFXA 1RNLA 2MBFA 2JRTA 4HW0A 3ABUA 3FXUA 3FMSA 4ZZLA 2HS5A 4IF4A 5AONA 4GFQA 1R1TA 1BM9A 1GVJA 4KB2A 2ZFWA 2W85A 2EV6A 2HTSA 2MLKA 2HYGD 3ECOA 2HEOA 4P96A 5CVRA 2PI0A 4MEXF 4KAWX 2VC1A 2QUFA 3HUGA 2HGCA 4KNYA 2AS5F 3RKYA 4MNUA 3HRUA 2YU3A 2DLLA 2JT1A 3KZYA 1F9NA 4KIFA 5JI6A 4Y17A 3LSTA 5F1RA 3CAGA 2L4MA 2GA1A 4LMYA 3WTZA 1B9MA 3ZMTA 5AIPA 1O3QA 1QPMA 3DF8A 2GA2A 3NEUA 1B4AA 2COMA 2P8TA 1BIAA 4AIHA 2IA0A 1QGPA 5EEGA 2BGCA 5LBQA 2DQRA 1MJBA 2CW0F 1P2FA 4ZH4F 2O3FA 1WQ2A 1STZA 3OPFA 1FP2A 2R3SA 3HSRA 1K79A 1EH8A 4OIRF 2WV0A 3WU1B 3LQQA 5DCMB 1DDNA 1S6LA 2EA4A 1FC3A 4YFXF 1FYKA 1LNWA 3CJNA 4GGGA 1J0RA 4ESFA 2E1CA 2ISZA 4G7ZF 3FMQA 1Q1HA 3V4GA 5J8CA 4LG0A 1Z6TA 1P4XA 3CTAA 2VBXA 3WGIA 4TV7A 2FBKA 1IN8A 4EMSA 2D1HA 4GCVA 4QLCU 2H27A 2HFHA 3BDDA 5HVQC 2PJPA 3O3KA 2YR2A 2H09A 3Q5FA 1F4KA 2ETHA 1OYYA 1ZG1A 3HTSB 3QOPA 5ILUA 3GFIA 3E6CC 4FHTA 2CGPA 1PDNC 3E6BA 5LRSA 3RDIA 2V79A 3FXQA 2Z3YA 4OU0A 2A07F 2O0YA 3FF5A 3FZVA 1XB4A 2PFBA 3QRFF 1HW1A 2BYVE 5D5WB 1FLIA 4HF2A 2GWRA 3H3ZA 4L9VA 2IA2A 3BROA 2FF4A 1YO5C 1OR7A 1CGPA 4F7ZA 3OEPA 1JHFA 1GE9A 2X4HA 5BMZA 2VBYA 4UV8A 2VBWA 4HOBA 4HZFA 1BC8C 3WTXC 3V8LA 2DPUA 1LEAA 4NB5A 2NS0A 4G6QA 4HLXA 3BWGA 4UVCA 2L54A 3FX3A 4BXUA 3ZMDA 1WKMA 1BI3A 5DCMA 2Z33A 4HBLA 5JHUA 4BAYA 3CDHA 1USTA 5D4RA 2H94A 3WGGA 4UUVA 3C18A 1FOKA 2F5CA 5H6QA 3DEUA 5H6RA 2J5OA 3QP5A 3FWEA 3K2ZA 3BPVA 2FOKA 3HYIA 3C7JA 3KEQA 1KQ8A 2DFIA 3WE2A 5AIQA 2BV6A 3GFMA 1R1VA 1IRFA 4PDKA 2ESNA 2UZKA 1KQ0A 4O3MA 2IPQX 2DK8A 3M8EA 2NNYA 3EDPA 1JGSA 1BIBA 2HQNA 4OINF 3R4KA 3LAJA 1ZHFA 3T1BA 1Z7UA 4L5IA 4ZYGA 2P5MA 4M73A 2MC3A 3KEOA 2CFXA 1K78B 4GO1A 1G3YA 3TDZC 4I02A 2QYOA 3GWZA 1R00A 1WRJA 1TBXA 3BJAA 5CJ9A 3MFKA 3PFIA 1U5TB 3F8BA 4LD5A 4EJWA 1L3LA 3K1NA 1ON1A 1ZH5A 5D8KB 1O3RA 1S7OA 1YS7A 4I98B 2A61A 3CUQB 4LLGF 5FO5A 4A6DA 4U7DA 1YS6A 3MEXA 1IN4A 3G3ZA 5A2QK 4EJOA 3RKXA 1FT9A 1FBSA 5CYVA 1S29A 3FM3A 3F8CA 2QBYA 5F6FA 5TJJA 3IC7A 2QZ8A 1I27A 2M45A 3S2WA 3KP2A 2XAHA 3RIRA 1RUOA 4HDVA 2VXZA 3P9IA 3HRTA 4G9YA 3VFZA 3GW2A 2H6CA 4IVNA 3IRQA 4M6XA 3NRVA 4P9FA 1J59A 1FSHA 3WG9A 2RV8A 2Q8KA 2L01A 3DFGA 2ZMEA 3GYHX 2KRFA 5E8IA 3I59B 1R58A 4KDDA 2FNAA 1O7LA 3LWFA 3ELKA 2RC4A 2LKPA 2B0LA 3F8NA 2QQAA 3COAC 2DO7A 4N9IA 1K6OA 1J9IA 3RPUA 4KT5C 2D1VA 3IKVA 3KP5A 2DU9A 1FY7A 4ASNA 4HA8A 2K7LA 1TQPA 4KIGA 2KJBA 1DUXC 4NQWA 1ON2A 2VODA 2VBZA 4OMYA 5BPIA 2OQGA 1B9NA 5E17F 3V7CA 2TDXA 5CLSA 2CWEA 1K78A 3ZMZA 5E20A 2Q0OA 5L3FA 5CVUA 3LA7A 3GLXA 1D5VA 1XGMA 5ERIA 4IRIA 2OU2A 3L2CA 2OQRA 5J8FA 3L09A 3WTSC 1IW7F 3L00A 3WE3A 2IW5A 3M8FA 1DPUA 4PZJA 2UWMA 3TOAA 2FBHA 1UHWA 1IS1A 3IL2A 1FX7A 1KQ9A 2ISYA 1TW2A 2XCQA 3JAMZ 3L9FA 3F3XA 3VOEA 1P4WA 1SD5A 1OYWA 4CXFA 5LHIA 1HKSA 3I4PA 4CDGA 2EV5A 2FRHA 4GYGA 4Y13A 2R7FA 1BOAA 4EGYA 2W57A 1P92A 4K2EA 4KFCA 3MMLB 2HKOA 2LF7A 1TLHB 1MJ9A 4AIJA 2CQKA 4FX4A 4HV5A 1SMTA 2VT3A 4GYIA 1U78A 2XV4S 5LGTA 5E1WA 1KYWA 3GFLA 1FBQA 2QWWA 3T5XA 3I59A 1QO0D 2JSCA 1ZGAA 5BOXA 4KYWA 5ICGA 2QLZA 3HRMA 3E6MA 2P5VA 1W4MA 1Z9CA 4BHCA 1W7PB 2WTEA 4KA4A 1FYLA 4I2OA 4GXOA 3WTVC 2G7UA 2OAZA 3HTUA 3E97A 4FX0A 4LK0F 1GHCA 1OKRA 1HKQA 4LB6B 3QP6A 4D0PA 2VOOA 4I0AA 3ZMSA 5FFZA 1R7JA 5E18F 5L3EA 2VN2A 1WQHA 2HQRA 1XXAA 2PEXA 4I7HA 2CO5A 4Y15A 1BJAA 5FLXK 1OPCA 1SFEA 3ZN1A 1ZVUA 1U8RA 2RVCA 1ZLJA 2FNPA 4L0ZB 5HDKA 5JVOA 2HYFA 4CYDA 4WX9A 4ETSA 4KIBA 4CO8A 2G7HA 1AOYA 5HLHA 3QAHA 2ZFZA 3M1EA 2K27A 5D6FA 2NAZA 3GVAA 3L4JA 5K1YA 1R5HA 4L9NA 3SHFA 2VE8A 4HAMA 2EFOA 3O6BB 3EQLF 3KP6A 5FLXZ 3MZHA 2NYXA 3ML6A 1ZRFA 1W5SA 1C0WA 1HKTA 1O3TA 1HXDA 4LJZF 2EA2A 1KU9A 5D5XB 5ICEA 1G4DA 4BH9A 1FWZA 2P5KA 2EFPA 2A5YB 3I71A 1KA8A 1EH7A 4EQQA 2PG4A 5KVRA 3LFKA 5H20A 4RB1A 2PHCB 2A68F 1FNNA 5ILSA 1SD4A 2DI3A 3HRSA 4M71A 2IJLA 3U1DA 1IXSB 1LJ9A 1WQGA 4U0WA 3RI4A 2LNBA 3RYRA 2DAOA 2KIFA 4UXNA 5IT3A 2OBPA 2H6BA 2XAFA 2XCOA 1EV7A 3FM5A 1YW7A 1W7PA 2RKHA 3REOA 4MTEA 5L3CA 4Q4ZF 1ZRCA 2JTVA 4KB4A 4S05A 5FD5A 3FXRA 1EH6A 2UXXA 1V4RA 2V1DA 1D8JA 1T38A 2M1BA 1L0OC 3O2PE 3QU3A 4XBFA 5BS6A 3ABTA 1QQIA 1V3FA 4YIFA 2ZO4A 1RI7A 4U0YA 4IHSA 2DT5A 4UHTA 3EYYA 2FA5A 3PQJA 4M6YA 4YIIA 1HW2A 4WXCA 2A69F 4HF1A 3L4KA 2FMYA 4ZZDA 5TRDA 4EM1A 2AXLA 3D0SA 4ENMA 2XIGA 5D5UB 3MZYA 1F5TA 1E17A 1DPRA 4WXHA 4QWQA 4EVIA 2GIVA 4ESBA 5D5VB 2ZNYA 4OIOF 3CO6C 3KP4A 3DPTA 3B02A 4HF0A 4ZYHA 1REPC 4R8HA 3HIFA 2XGXA 4M9ZA 4IPAA 4MEYF 3KCCA 1USSA 4L18B 4G8XA 1G3WA 3BZ6A 2XRNA 3TQNA 4A2UA 1ISEA 1JE8A 3WODF 1O7FA 1FP1D 3F8MA 2L3DA 2ESHA 2QVOA 3OV8A 2VOPA 3HHGA 1S3JA 1KU7A 2HTJA 2KKOA 1IN7A 2ZJ2A 4DDQA 5DCFA 3TKYA 1OMIA 3SZPA 1ZG5A 5IT9K 3LPXA 1XSVA 3SQNA 5D4SA 3R6SA 2K4BA 2STWA 1IF1A 1CF7B 4OIQF 1IAWA 1F1ZA 4UVBA 2VE9A 3F23A 4ESJA 3DV8A 3IRRA 3CUOA 2QM3A 4R79A 4G0UA 1WSUA 2O6GE 1B59A 3FHZA 3N4MA 1T2KA 3V8JA 3C3WA 5HS7A 3LAPA 1E2XA 3GUDA 5IT9Z 5LHHA 2RQPA 4FT8A 4L0YB 3PQKA 1ONVA 5HLIA 4M72A 3WGHA 4RAYA 1RIOH 1KYZA 3BY6A 2YPRA 1GXPA 1IXCA 3R60A 1YW9A 5HS9A 4XRFA 3ZN0A 4YG2F 1I1SA 1XXBA 3MQ0A 1YYVA 3VEPA 5FB2A 4AIKA 2F5DA 1BI1A 3ZMUA 5BQTA 4ZYEA 2W25A 2L4AA 1MDMB 3JSOA 3TGNA 1I6XA 2DPDA 1UFMA 1G3SA 3DQVC 2GQQA 5ICCA 1ZLKA 4NHJA 5F64A 2Y75A 1P4AA 2V9VA 1OYIA 2UXNA 2JPBA 2C6YA 1XGOA 1TTYA 4UNOA 2P7CB 1HSTA 4A5NA 2IA1A 5DDGA 1XCVA 3SXYA 5K5RA 1PP8F 1PP7U 4I09A 3E6DA 1LEBA 3I53A 1FZPB 1IZ1A 1IRGA 2KJCA 4HYEA 3I0TA 5ED4A 2MH9A 3MAJA 3NQOA 5CVIA 2BEOA 3BJ6A 3HOSA 1FPQA 4EM0B 3F8FA 2RDPA 4PGGA 1O3SA 1IN5A 4AWXB 2O03A 3BP8A 4WF2A 1RUNA 1H0MA 1WQFA 4HQMA 3HSFA 4HX4A 4ENJA 2XROA 1ZGJA 2M30A 2IVMA 1QZYA 4IRGA 4JBAA 2DBBA 4A5MA 1TNTA 3ULQB 3JAMK 5L3DA 3RTRA 3RYPA 1U5TA 1LVAA 2HDCA 2BE5F 2IRFG 3VODA 2DTRA 4U7BA 1J2XA 2GXGA 4UVAA 1SFXA 1XD7A 2CYYA 4RGXA 1QNTA 5DV5A 4PCQA 2GAUA 5CVVA 3QU6A 1U5TC 3CUQA 4ON0A 5E8GA 3MCZA 1H9TA 4A0ZA 4PGHA 1UHMA 3DPLC 4P9UA 4I01A 1MDMA 4HV6A 2DK5A 1TW3A 1HQCA 1X3UA 3W6JB 3CUQC 4O5VA 1LDJA 3I58A 1AB4A 2VT2A 4KMFA 2M8EA 3IHUA 1XXCA 3QPTA 1BN5A 3K1MA 2KIMA 1MGTA 1H9GA 3F72A 1KU3A 3Q9SA 2FSWA 1R36A 2XKOA 4KMUX 4HLYA 1JXSA 1O57A 3C1DA 1MZBA 2XAJA 4WCGA 1KGSA 2PLYA 3OREA 2FXAA 4EJTA 4MQ9F 5LGNA 3LA3A 4IRHA 5L3GA 3BUEA 3W6KB 2PBIA 2NNNA 3E5UA 4L9TA 4A12A 3SFZA 4WK8F 2QENA 5HS8A 3T8RA 5JFRA 4JQFA 1SD6A 3KP7A 5E1XA 1Z6RA 3P7NA 3U2RA 2VC0A 1U2WA 2RGVA 2KWAA 3E3VA 2G9WA 4RAZA 5BPDA 4MQVA 2A6EF 4MHGA 4RGSA 2MD5A 3P9KA 5DD4A 1I5ZA 1ZYRF 5EEHA 2EFWA 3OOPA 3K69A 1YW8A 3VA7A 2K86A 1I1GA 4EGZA 3LA2A 4WWCA 2P5LC 4EJVA 4BQAA 5DD8A 2DQLA 3K9TA 2XVCA 2JPCA 2FE3A 4R1HA 3Q9VA 2WC2A 3I64A 2K02A 1BBYA 1LB2A 1PUEE 1DP7P 1BGWA 4HQEA 5DYMA 1UCRA 1FBUA 1IN6A 5ILVA 2PMUA 4G7HF 2CG4A 3HHHA 4L5JA 1ZREA 2MH2A 3IWZA 3J81K 3CLOA 4DQ2A 2V6CA 2Y48A 1LDKB 4HDUA 3K0LA 1Z05A 2EV0A 2RN7A 2FEZA 2CSOA 1R1UA 3K1PA 5DUKA 4Q48A 1AWCA 3H92A 2E1NA 4RS8A 3ZMVA 1QBJA 4IJAA 1R23A 3HSEA 3GO5A 2M87A 4XSZF 1ZG3A 1XGNA 2HOEA 3J81Z 1FSEA 5LRRA 5HLGA 1MD0A 3JW4A 4JK1X 2F5EA 3G73A 2X0LA 2EFQA 4BNCA 2YX4A 3J7AO 2O8XA 4OMZA 1IUYA 2R7DA 2D2WA 2P6TA 4LLLA 4M9XA 1LQ1A 3I5UA 4HX7A 2EWNA 1Z91A 4KN4X 2XAGA 5JVTA 4OIPF 1J75A 4A0XA 1D8KA 3KETA 3ROUA 1ZAOA 3KLNA 1EH1A 2NRAC 1WIHA 1XMAA 3WU0A 1R5GA 2QQBA 3JSPA 1D3YA 1VTNC 4RB2C 4RGUA 1Y0UA 1RZ4A 4BHBA 3GEZA 3M9AA 4XLNF 3BOQA 4L9JA 5HDNA 2ACJA 3T8TA 4H0EA 2ZKZA 3FOEA 4A0YA 4WXDA 3DP7A 2QBYB 2WWYA 1K7AA 3T0YA 3IWFA 3GZ5A 3D5LA 1B6AA 2EB7A 5DUIA 4EJUA 2XAQA 3GX4X 2EJRA 1SFUA 4KN7X 1T6SA 3WTYC 1IXRC 1SD7A 4EV0A 4G94A 4LFUA 5D8LB 4U0VA 2VONA 2Z9OA 4S04A 2HZTA
chains in the Genus database with same CATH superfamily
2ZMEB 1JHHA 2IT0A 1BI0A 3PIOF 3DXJF 1OCZH 1ERDA 2Y0MA 2JZYA 3MN2A 2CUJA 4HG2A 3JTGA 3H3VL 4A3GC 4B43A 1LE8B 4KUMA 4IHYA 4RMFA 2XHKA 3OIPA 3TMOA 1D1BA 2DA6A 2E7WA 3I54A 3TP3A 2LOOA 5JLXA 3M3YK 4IKFA 2W24A 3RJPA 1XCBA 3GZ6A 4KJZA 1W5TA 1T98A 1XSXA 4KT6A 3NUHA 3F6OA 5LEKA 3GXOA 1S9HA 1G59A 4CGZA 5M5XK 3ADAC 5LEJA 1TQMA 3Q0WA 4RB0A 1X4OA 2WY7Q 2L02A 2IS4A 5E1ZB 1S7AA 1F36A 2GZWA 4BHPA 2EIKH 3ASOH 4PAAA 1WCMA 3LQRA 1HCRA 2K4JA 1IC8A 2IEKA 4CZZA 2E2HK 2V4JC 3MZ8A 1JOEA 4NQWB 1PJ7A 2EK5A 1KU2A 2R7VA 2L9VA 3SZZA 1V5FA 2A6HF 3L2RA 1WFXA 2NVXJ 2WBMA 1W0UA 2M5WA 2L9SA 4XLAA 1J7KA 4J3NA 1IO2A 4G6DA 1MW7A 2CV1A 2MA3A 4B09A 1E0EA 3AD8C 1SMYF 4Q47A 2DA7A 4C2UA 4BBRK 4A3BK 2WAQA 1A04A 2LYCA 2DW4A 1KONA 3J80K 1WCMC 3VB2A 3GTMK 4CCJA 1J5YA 3B73A 4MEXA 4OOIA 1HSJA 1TQIA 2BY0A 4A3KC 2RNJA 4G0WA 1POGA 2LSOA 3L7WA 1BJTA 4RB3C 2W7NA 4XRSG 1JKQC 2JUGA 3S17K 1BC7C 3FKIJ 3DEEA 2YUSA 3ZPLA 2L7FP 1I50J 2MLGA 2PN6A 3BTIA 3L2VA 1YTYA 2NVTJ 2IP2A 5CPRB 3PL8A 4HSRA 4N0BA 4M3FA 4PK4A 3EYIA 2Z99A 1YFHA 2FU4A 1J6XA 1T0FA 3E5QA 1MJAA 1K61A 4P55A 3GF2A 4BEHA 3IKTA 5EEAA 5K5QA 3EUHA 5HNHA 1J09A 3V8KA 1DD5A 3ESWB 5JR3A 3N3YA 2LDUA 5EF6A 1BR1A 3HOZC 1YLFA 2BHZA 4PJLA 2GXBA 2LF8A 2W00A 1HDDC 2V1UA 5HDGA 1R49A 1Y6IA 3J80Z 4AD9A 2FBIA 5IP7K 1BR4A 3KFWX 3KZZA 3ZQ7A 4FCYA 1W7PD 2HVSA 3E5XA 4G0VA 4ZJZA 2E2JJ 3S15C 1G6NA 2E5ZA 3HOWC 3S8PA 1T0FC 3SZTA 1NHAA 4ZTJA 3AAFA 1X31C 1MH3A 3EUHC 1YIJI 1VJEA 2XKPA 4DNCA 2P6SA 4MGRA 5IYDJ 1E3HA 4KICA 2P81A 1R5ID 1UB9A 4ZH4A 2OZUA 3V7RA 3TDUC 2P4WA 1ZARA 3SDBA 4ENNA 1X3WB 4Z2YA 2LBFA 3S16J 2CS3A 1QZZA 2YX7A 3DPUA 1YRNA 4KDPA 4CCNA 1IE0A 3CCJI 2EFNA 4P5OA 4C3HJ 4OIRA 2CRGA 3F22A 1ULYA 3WU2C 2PMHA 3PNTA 4B1RA 2Y0SD 2K40A 2VKEA 3HOTA 5M5YJ 3H3UA 3VSKA 4Q5SF 4XOTA 2L7MP 4M74A 2HR3A 3K10A 4IXAA 5A2QZ 4LK1F 1XGSA 2DT7B 2STTA 2E2IJ 3A0BC 3P9CA 4YFNF 4A6EA 4D5CA 1ACIA 5C44C 3BCAA 3RKWA 4LIUA 4C9YA 1YQAA 3R0AA 2QEXI 4Y7NK 4XSZA 3TO6A 4DW6A 2RGRA 1B4BA 5GAHJ 1FIPA 1SC7A 4G7ZA 2JA7J 1SANA 2DOAA 1CF7A 3GTPA 3WTTC 2HWVA 5HOOA 2XASA 3U9GA 3TW6A 3S2HC 3KLOA 3L2UA 1LE8A 1GVDA 1WJBA 3QYEA 3H0GK 2RNGA 2I10A 3A03A 4E7LA 3S1MC 4BY7K 5IOZA 5LHGA 5FD6A 5F0FA 1A35A 5IP9C 3BLYA 2JWTA 4YFKF 3JRHA 3QX3A 3CO7C 1R22A 1HBXG 4A3DC 3MKLA 1H88C 4C2MK 4IHTA 1FIAA 3DTKA 4X1EA 1G3TA 4JYKA 3FK7A 3R61A 2XPVA 3GTPC 2IS6A 1R6RA 2CQQA 1X19A 5LLQA 1QVUA 2ADUA 4BJ6C 9ANTA 3TO9A 5FJ8K 2Z5UA 1XC5A 4E7IA 1ZGWA 5FRMA 1BL0A 4F91B 3S14K 1IUFA 4LB5A 2PQ8A 3RZDC 1JQWA 1INNA 1MKMA 3TFJA 1WI9A 3AH5A 2Y3PA 2FQ3A 1VQPI 2EIMH 2V1XA 1GXQA 2F5FA 2ZNZA 5JFEA 1YG2A 2M34A 3BJOA 2ZCWA 2DTZA 4W1UA 3ISPA 3EETA 5F0HA 1T39A 3DWLE 4OIPA 1WPKA 4XLPF 2ME6A 1JI8A 1GLNA 2XCRB 1XDSA 1X58A 1Z77A 2QCOA 2D45A 4BY1C 2BY3A 1Y1WA 2ELHA 2P7VB 3A4CA 1N78A 3ABMH 6PAXA 3H1CA 1A6IA 2ZXJA 2BBYA 4KC6A 2QQ9A 2VIXA 3FOFA 5K5OA 3H5AA 4MLOA 1YCLA 2K5CA 1ZRDA 2CV2A 4OAZA 4HSTA 3KX2A 1RETA 2FMLA 4A3LJ 3I9V2 3N0BA 1TWHJ 2O61A 1TWFJ 2E7XA 3M7GA 3PSFA 3SJMA 3I4NJ 1WWXA 2HKXA 3ERED 2JA6J 1EK8A 4M3BA 3JRDA 1F43A 2GSNA 2YU9A 1Z1DA 4AYBL 2OA4A 3ZQLA 4AVPA 1MSFC 4KM9A 5KK1A 4LOCA 1Y1WC 5FLMJ 2XUBA 3GFJA 4KATA 2FOWA 1AKHB 3GTLJ 5J6XA 4LGWA 2WA0A 1U3EM 4RLFA 4FISA 2F4IA 4B8XA 1WH5A 1I6HJ 1HW5A 4XSXF 4RGRA 3JTHA 5CVJA 1SAXA 4CHUA 4FM9A 3D5RC 4PJ0C 4ENKA 2OZ6A 4C3IC 1P6RA 2OCCH 3U21A 2KIUA 4BYYA 2JA8C 3MWMA 4UV9A 3HOUC 1JGGA 2A3SA 2YU9C 1JT6A 5M3FK 4AM3A 3RPQA 2YSRA 1LDDA 1XMKA 5DEQA 5B3SH 1DGWY 3PUBA 5K7FA 5LGUA 3OYAA 3DKWA 4FASD 4ZYDA 3H3VK 2F2EA 2ZBKA 2Q2EA 4B4CA 4CCOA 3OOUA 4O6JA 1R9TJ 5HNFA 3WTUC 1NG6A 3AD7C 3TO7A 1ZN2A 3QPHA 3KP3A 1Z21A 4U88A 5FGMA 3GBGA 3ZP5A 1FYMA 4CICA 4G7OF 3F6VA 2MGQA 4ZYAA 4F3QA 2NVQC 4QPOA 3IAS2 3HBLA 1G2HA 4Y52J 4E70A 3BPXA 1S8NA 1TWAJ 1XDUA 4M9SA 2DDAA 1TNSA 1YIOA 4D9JA 4EM2A 2WAQD 3S93A 3HKZL 1Y1VK 3V42A 1Y8QB 3O8HA 1BI2A 3GTGA 2E36A 2B7EA 4LLNA 4A3MC 1XSDA 4A3JJ 3MMYB 3R0JA 3DBLB 1YOVB 4LG0B 3ECHA 5M5WK 2EILH 2W84A 1ODDA 4MTDA 2OD5A 5ICFA 3N97A 4A3EJ 4HX8A 1U6GA 2L0KA 3L2QA 3S3NA 3KE2A 2J5PA 4ANJA 4A69C 3TOBA 1B1BA 3F21A 1JTXA 3V7SA 2B63K 5D6EA 5EGEA 1VNDA 1XZPB 5GPCA 5IYCJ 3DXJA 4N9HA 4MFDA 1VQMI 3FMRA 3GLLA 4I0BA 3GTGC 1Y56A 3WTWC 4BXXJ 2NVYJ 1XN7A 5L3BA 5FFXA 1RNLA 4M3GA 5F04A 1ZR4A 3WHCA 1IQ0A 2MBFA 2JRTA 4HW0A 4I76A 1TWCA 2A6TA 3IPJA 2HU9A 3ABUA 3FXUA 3FMSA 1Z3YA 3U1KA 4ZZLA 2E60A 2HS5A 4IF4A 5AONA 2GM4A 2COBA 2IGOA 1T56A 3KIOA 4GFQA 2HDWA 1YX2A 1XMXA 4E7HA 1R1TA 3VYRB 1BM9A 1GVJA 1WJFA 2Z1DA 4NOIA 4KB2A 2ZFWA 2W85A 2EV6A 2HTSA 2MLKA 4QTRA 2M7BA 2HYGD 3ECOA 2HEOA 2VXDA 4P96A 1TWCC 5IY5H 3GTOC 2YS9A 5CVRA 3KYLA 1X1PA 2PI0A 4MEXF 1OCOH 4N4OB 4KAWX 2DFHA 2VC1A 2CFOA 2QUFA 3K4CA 3HUGA 2HGCA 1W36D 1Y8RB 1BS2A 2NS7A 4KNYA 2JA2A 3AG4H 3TP0A 4A3FJ 2AS5F 2LH9A 4AU7A 2O8KA 2X6WA 1SMYA 2R7XA 3RKYA 4MNUA 3HRUA 2PJRB 5J47A 1YI2I 2YU3A 2DLLA 3VPRA 3AQPA 2ID3A 2JT1A 3JRFA 5B66C 4IO9F 3KZYA 4A3GJ 1F9NA 4KIFA 4FZBA 5JI6A 4Y17A 4DIQA 2JJ7A 3LSTA 5F1RA 3CAGA 2L4MA 3CCQI 1LPQA 2GA1A 4LMYA 3WTZA 1B9MA 5L46A 2R7ZA 1NTCA 1SFKA 3ZMTA 5AIPA 1O3QA 5HL8A 1QPMA 3DF8A 1WHUA 1PJRA 3NWSA 1P7IA 3OYIA 2JRMA 1UMQA 2GA2A 5D4DA 1L0WA 3GTJA 1WJCA 3NEUA 1B4AA 1WJ5A 2COMA 2P8TA 2JVGA 1AKHA 1BIAA 4AIHA 3VWBA 3MVPA 2V26A 3PO3C 2Z16A 2IA0A 2V6TA 1QGPA 3CF2A 5EEGA 2BGCA 2DOFA 5LBQA 2DQRA 1MJBA 5GTIC 2CW0F 1P2FA 3TBIA 4ZH4F 4UB8C 2UUZA 2R7ZC 3NWTA 3S1RC 4LLGA 1JKRC 2O3FA 1WQ2A 1STZA 3OPFA 1FP2A 2R3SA 3HSRA 3GTJC 1K79A 1EH8A 4OIRF 3UR3C 3CQZA 2RAEA 2WV0A 3WU1B 3K7AC 1BDFA 3LQQA 2V1NA 5DCMB 1DDNA 1S6LA 3HOXK 1QZEA 1WCMJ 2EA4A 1FC3A 2E5NA 4UUSB 1TWGA 4YFXF 1FJLA 2I5UA 4XN0A 3HB9A 4A3KJ 1FYKA 1LNWA 5CQEA 4GTLA 4DZJA 3CJNA 4DYRA 4XLEA 2AQEA 5EGOA 3H9QA 5DM6F 4GGGA 4HEA2 2KFDA 1J0RA 1M1EB 3CQZC 1Q1VA 4ESFA 4B48A 1ETWA 2E1CA 3HZJA 4G7ZF 2ISZA 3FHNA 4Q5SA 1DQUA 3DBRB 1QPIA 3F0CA 3ZQFA 3FMQA 1Q1HA 3V4GA 3A2KA 4A3CC 1U8BA 4RM2A 1TWGC 5TMFA 4KISA 1K83A 5J8CA 2Y31A 1VQ8I 4LG0A 4YFNA 1Z6TA 3QPSA 2HNHA 3HOZJ 1P4XA 2WB1N 3CTAA 4XOPA 1JUPA 2W48A 2VBXA 3OYGA 3DU5A 4KMDA 2WAEA 3WGIA 1USOA 4TV7A 2HVRA 1JUMA 2FBKA 1VQOI 2E1MB 1IN8A 1XZPA 4EMSA 2D1HA 1A6QA 4GCVA 2BY2A 4AYBD 3S15J 3HOWJ 3M8JA 1G8XA 1D1AA 2BVMA 1J6VA 1K83C 4BE0A 4QLCU 3G4CA 2NXNB 1DU0A 4NC8A 1XZQB 2H27A 3OYMA 2HFHA 3BDDA 5HVQC 3LNQA 3VSLA 2W7VA 3BZCA 2BXYA 2PJPA 3O3KA 4II3A 1QA6A 3K6GA 2YR2A 2H09A 3Q5FA 1KZHA 1LFBA 1F4KA 2ETHA 1OYYA 3RZOC 2JK3A 5F08A 1ZG1A 3CC2I 1ETQA 3HTSB 3QOPA 4JX5A 1MNEA 1X1AA 5ILUA 3GFIA 3UKGA 4CYCB 2G0EA 4G12A 4BDYA 3E6CC 4FHTA 2CQNA 2CGPA 2VQLA 5J40A 2R7QA 1OLTA 2IGMA 2ZB9A 1PDNC 2NVXK 3E6BA 1VRQC 5LRSA 3K2AA 3RDIA 4XIDA 3M4OC 2V79A 3ZXSA 2GAHC 3FXQA 2Z3YA 3NAUA 4OU0A 5C44J 2A07F 2O0YA 4ZDOA 3IH2A 3FF5A 3FZVA 2EIJH 2GOMA 1XB4A 2PFBA 1MNMC 2PJRA 3QRFF 1MSEC 3KYCB 1HW1A 3J7ZI 2BYVE 2A5WA 5D5WB 3HGYA 3SZGA 1FLIA 4HF2A 3JRBA 3S2HJ 4LQYA 2GWRA 4XNFA 3OS1A 3H3ZA 4L9VA 3FKIK 3G2BA 2IA2A 2XF7A 3BROA 2FF4A 3S1MJ 1YO5C 4KMUA 5IP9J 1O2BA 1I50K 2JN6A 1OR7A 1CGPA 2NVTK 2VJ4A 4F7ZA 3OEPA 4A3DJ 1EKEA 1JHFA 3BG6A 3SDGA 1GE9A 2Z2SB 1G51A 2X4HA 3DU6A 3LOCA 5BMZA 2VBYA 2WB1L 3GTPJ 4UV8A 2LG4A 2VBWA 2DXIA 4HOBA 4HZFA 3ZOBA 4XSXA 1BC8C 3WTXC 4HRIA 3C2GA 3V8LA 3Q0UA 5DM7F 3W3CA 1LEAA 2DPUA 4KMHA 1OR7C 3RZDJ 2BXZA 2HZDA 2NS0A 4NB5A 2GXAA 2R92A 2VQCA 2E2JK 3H0DA 1XG1A 2MG4A 2QSHX 4G6QA 4HLXA 2KISA 2DMTA 3BWGA 4UVCA 1PVEA 2L54A 3FIWA 2LC2A 3FX3A 4BXUA 3ZMDA 1WKMA 2LTPA 1BI3A 3DTIA 5IYBC 5IYDK 4BY1J 4XICA 1VQ9I 5DCMA 2Z33A 4HBLA 3LSHA 5JHUA 4BAYA 3IH4A 3CDHA 1USTA 3JCUC 5D4RA 1WH7A 2R0QC 2H94A 3WGGA 4UUVA 2R92C 3S16K 3C18A 5B1BH 1FOKA 2ECCA 2F5CA 5H6QA 4NBQA 3C2BA 3DEUA 4C3HK 2MABA 3G1LA 2J5OA 3QP5A 5H6RA 1SVLA 1WJAA 1VQ7I 3FWEA 5M5YK 4B47A 3ONQA 2KIQA 3BTJA 2GLOA 3K2ZA 3OYDA 2LFBA 3FISA 3BPVA 2EZHA 3JRCA 1Y1WJ 4A93J 5C3EC 2EZLA 2FOKA 1FEXA 3HYIA 2XGDA 3C7JA 3KEQA 1KQ8A 2E2IK 2OPTA 4M3EA 2DFIA 3WE2A 1AHDP 5AIQA 2BV6A 3SYTA 3GFMA 1R1VA 3OYBA 1TC3C 1YJNI 1IRFA 4IHXA 3CJQB 4FQGA 4PDKA 2ESNA 2UZKA 1KQ0A 4C3IJ 4E6KG 4O3MA 3HOYC 2IPQX 4C3JJ 3OS0A 2X51A 2JA8J 3HOUJ 2JA7K 2DK8A 3M8EA 2NNYA 2AXTC 2YU9J 4X0GA 2CW8A 3EDPA 3J7AY 4C2TA 1JGSA 1IJWC 2L9NA 1BIBA 2HQNA 4OINF 3HGGA 3R4KA 4YIRX 5EZHA 1Z7LA 1XZQA 2M9HA 1OCCH 4ZTFA 3LSGA 2IS1A 3KYDB 3LAJA 2R93A 3OS2A 2O5JA 4NUBA 1ZHFA 3W2VA 3T1BA 3OSGA 1Z7UA 4L5IA 4PFOA 4ZYGA 2P5MA 4M73A 2MC3A 3KEOA 2CFXA 2NVQJ 3NARA 1K78B 4GO1A 2WAQL 4LK0A 1G3YA 5GPAA 3CLQA 1YX3A 2DMNA 1R71A 3TDZC 3A01B 1WJEA 2QYOA 2HVQA 3GWZA 4I02A 2DFEA 4BQNA 1R00A 5EG0A 1WRJA 1TBXA 3BJAA 2OJED 2R93C 4A3MJ 4XRMA 2VUMA 2X1EA 5CJ9A 3MFKA 3ZQHA 3PFIA 1U5TB 1D0YA 3F8BA 4LD5A 5EJCA 4EJWA 5K7ZA 1L3LA 3K1NA 1ON1A 3A8IA 2DYSH 1ZH5A 5CQGA 4HNUA 4NDLA 2XB0X 1HOMA 3Q0VA 5D8KB 3W6VA 3GTGJ 1ZR2A 1ITYA 2VUMC 5GP9A 1O3RA 2DMUA 2GSOA 1S7OA 1YS7A 4I98B 4A3LK 1TWHK 1TWFK 4YEJA 2A61A 4BU2A 3CMAI 3CUQB 3I4NK 4LLGF 5FO5A 2JA6K 3CJTB 1XPXA 4A6DA 4U7DA 1YS6A 4F93B 3MEXA 1IN4A 3G3ZA 5A2QK 4EJOA 2CQXA 5FLMK 3RKXA 3A8JA 1FT9A 3GTLK 1FBSA 1T95A 5CYVA 4L5EA 1S29A 1TP4A 3FM3A 2HPMA 3A02A 4BJTA 3F8CA 1I6HK 1TWCJ 2KLOA 2QBYA 3GTOJ 5F6FA 2CW0A 1H8AC 1ZKGA 5TJJA 3IC7A 1IV8A 2LR8A 3BR1A 2QZ8A 1JJ6C 1I27A 2M45A 4BDZA 4JK1A 3S2WA 3KP2A 3H5RA 4XM3A 2CU7A 2XAHA 3RIRA 2KL4A 3LL7A 3AFHA 3L1PA 1RUOA 1IDZA 1O29A 5IORA 3OL4A 4IZZA 1X1BA 2VXZA 4HDVA 1R9TK 2BHYA 3P9IA 3HRTA 4G9YA 4E7KA 3VFZA 3GW2A 1K6YA 4C30A 2H6CA 4BQOA 3JREA 4IVNA 4YFXA 1I3QA 3IRQA 4BLBA 2RH6A 4M6XA 4BBSC 3NRVA 4LJZA 4P9FA 1J59A 1FSHA 3WG9A 4Y52K 2RV8A 5C4JC 3BR6A 2Q8KA 1TWAK 3H9JA 3RQIA 1MBKA 2GSUA 3PNVA 2L01A 3DFGA 2ZMEA 3GYHX 2KRFA 5E8IA 3I59B 1R58A 4KDDA 2FNAA 1O7LA 3LWFA 3LSMA 3MD2A 3ELKA 4A3JK 2RC4A 1I3QC 2LKPA 2B0LA 2JA5A 3F8NA 1VQ5I 2QQAA 3H36A 3COAC 2DO7A 4N9IA 3OYHA 1K6OA 3PO3J 1J9IA 4A3EK 1OCPA 5J1YA 3RPUA 4KT5C 2D1VA 1Z3XA 2M8GX 3IKVA 3KP5A 1X2NA 2ZMEC 4CUGA 2DU9A 1FY7A 3S1RJ 1XS9A 4B44A 4ASNA 2R7ZJ 5IYCK 2AQFA 3IP4B 4HA8A 3GTJJ 2LLKA 3PO2C 2K7LA 4BXXK 1RC9A 2L2OA 2NVYK 4PJNA 4I6ZA 2WB1D 2Y69H 1SFOA 1RPWA 1TQPA 3LSKA 2JA5C 3K7AJ 4KIGA 2KJBA 5TISC 1O26A 1DUXC 4NQWA 1ON2A 2VODA 2VBZA 1D0ZA 4OMYA 4XCHA 3JRAA 2K9LA 5BPIA 4S0HB 2OQGA 2XPUA 1B9NA 3CZ6A 4E7SA 5E17F 3V7CA 2TDXA 5CLSA 2CWEA 1K78A 2ZJRF 3GTQA 3ZMZA 5E20A 2Q0OA 5L3FA 3IV5A 3ASNH 3CQZJ 5CVUA 3LA7A 1SFOC 3I4MC 3GLXA 3LSPA 1P9QC 5GTHC 1YJ9I 2OF7A 2Y30A 3BG9A 3BG7A 3A01A 1D5VA 4AVZA 4CCKA 1XGMA 3OYNA 5ERIA 4IRIA 2OU2A 3L2CA 2OQRA 4A3CJ 1TWGJ 3CDIA 3E0JB 5J8FA 3MKYB 3L09A 1K4TA 1HQMA 2ICWG 4A3FK 4CZCA 2PA8L 2GBYA 3WTSC 1IW7F 3GTQC 3L00A 1O28A 1N25A 3WE3A 3HG9A 1YJWI 4F52A 1W5CC 4XK4A 5FKLA 2IW5A 4IHVA 1MMAA 4A93C 3M8FA 4IQ4A 1DPUA 4PZJA 2UWMA 5C4XC 4A3GK 3B6CA 5JLWA 5CKTA 4J00A 1VGXA 2XB5A 4BKXA 3TOAA 2FBHA 1K83J 3S1QC 3OWTA 2A69A 3GTKA 1UHWA 1IS1A 3IL2A 4C3JC 1FX7A 2JQ7A 1KQ9A 2ISYA 1TW2A 2XCQA 2LY2A 4V19K 2QQ8A 3JAMZ 3L9FA 3F3XA 3VOEA 1W1WE 4XLHA 3RZOJ 1P4WA 1SD5A 2VQGA 2E71A 3K4KA 4BS9A 1OYWA 1WI3A 4CXFA 5LHIA 1HKSA 3I4PA 3OYKA 4CDGA 3GTKC 4LIVA 2EV5A 5F1JA 2FRHA 4GYGA 3OIOA 3Q3QA 3QOEA 4Y13A 1BW6A 2R7FA 2CUZA 1BOAA 3EUKL 2ZJPF 2TCTA 4EGYA 3M4OJ 2W57A 2M0MA 5FROA 1P92A 4K2EA 2DA4A 4MIMA 1LKXA 4KFCA 2XSDC 3MMLB 4LITA 2HKOA 1NG7A 1TLHB 2LF7A 3TW7A 1MJ9A 5IPAA 4BACA 1UAAA 1WCMK 4AIJA 2CQKA 4FX4A 1FOXA 1ETVA 2CMPA 2KPMA 1SMTA 2VT3A 4GYIA 4HV5A 4B3AA 4A3KK 1U78A 1SEUA 2XV4S 2ID6A 2KRHA 2F48A 4ITVA 5LGTA 5E1WA 2LY1A 1KYWA 4GTCA 2FUG2 2VASA 1FBQA 2QWWA 3GFLA 1GUUA 2V6EA 1HI9A 3BP3A 3CCUI 3QPLA 4W97A 3CJRB 3T5XA 5KNLA 3I59A 4QJVB 1QO0D 2JSCA 1ZGAA 5EZGA 5BOXA 1I39A 3BC8A 2LVSA 1UV7A 3PUFA 4KYWA 5ICGA 2QLZA 3QYBA 1QHGA 3HRMA 3PFYA 3E6MA 3ERMA 3PSIA 3CF5F 2X85A 4AH6A 1EQRA 2P5VA 1R4MB 1W4MA 1Z9CA 5TMCA 3HOVC 1JVIA 1F7VA 4BHCA 4LR2A 3HOZK 4PSWA 1VF9A 2L5QA 1W7PB 2WTEA 3G4SI 2V6SA 2ZSIB 4XL9A 2K3PA 4KA4A 1FYLA 4I2OA 3K4JA 4Y33A 4GXOA 2FD5A 1YE9A 3WTVC 2K9NA 4OIQA 2G7UA 3S15K 3HOWK 2KDOA 2OAZA 3HTUA 1B8IB 3E97A 1APLC 2W1OA 2LY9A 4FX0A 4LK0F 1GHCA 4OINA 1OKRA 5HODA 1HKQA 2XSJC 2QSGX 1EI6A 2OC6A 3LFUA 5F27A 4LB6B 3QP6A 5IYBJ 4D0PA 3S2DC 2VOOA 1SVMA 4X6AC 4I0AA 2X6OA 3ZMSA 5FFZA 1UHSA 1R7JA 5E18F 4YELA 2R5YB 5L3EA 2VN2A 2R92J 1WQHA 2HQRA 4A3IC 1XXAA 5FLVA 2H8RA 2PEXA 4I7HA 4F92B 2OTJI 2TRTA 3TTGA 3O8GA 3AG2H 2EPFA 2QGUA 2CO5A 5C3EJ 4Y15A 1U0JA 1BJAA 5FLXK 1OPCA 1A5JA 1SFEA 3ZN1A 1TT5B 3FXJA 1WORA 1ZVUA 3QQAA 1U8RA 5C44K 2RVCA 5TJ3A 3AG3H 1DU6A 1AA7A 3ZQGA 1ZLJA 2FNPA 3JSTA 4L0ZB 2R7SA 2EINH 4NNJA 1O25A 4YG2A 2E2HA 5HDKA 5JVOA 2HYFA 3E7LA 4CYDA 4WX9A 3S2HK 4ETSA 3M3YC 4KIBA 4CO8A 2G7HA 3S1MK 1AOYA 5K7HA 2LD5A 1H89C 3W2AA 1OCRH 2W82A 5IP9K 2KHMA 3BG3A 1IL2A 5HLHA 2JVHA 2V7FA 1E3OC 4A3DK 4UUTA 3QAHA 2ZFZA 3M1EA 2K27A 5D6FA 2NAZA 3GVAA 2EBBA 3L4JA 5K1YA 1R5HA 4L9NA 3SHFA 2VE8A 1U9OA 2EFOA 3O6BB 4HAMA 3EQLF 3KP6A 5FLXZ 3MZHA 5KAIC 3GTPK 2NYXA 3ML6A 2E2HC 2I8DA 3GTMA 4AUXA 1ZRFA 1W5SA 2VPRA 1C0WA 1HKTA 5DTDA 2MYSA 4J01A 1O4XA 3RZDK 2R4GA 3OMYA 1LUJB 2R93J 3CCRI 1O3TA 1HXDA 4LJZF 1UELB 2EA2A 1KU9A 4MO7A 5D5XB 3GIRA 5ICEA 4BBRC 1G4DA 3DLLF 2NS8A 2VJJA 4BH9A 1FWZA 3BTLA 4A3BC 2P5KA 3G6EI 2EFPA 2A5YB 3I71A 1KA8A 1EH7A 4EQQA 2PG4A 5KVRA 3GTMC 2VL8A 3LFKA 3SZYA 2M4KA 2ELJA 5H20A 3DLAA 4BY1K 5E3NA 1MH4A 3BG5A 3SFIA 3FBIB 4RB1A 2PHCB 2A68F 1FNNA 5ILSA 3DEWA 1SD4A 2EQRA 3S17C 2DI3A 3HRSA 1EJ9A 4M71A 1ETKA 2V6UA 1WOSA 2F5VA 2VUMJ 3G1MA 3K4BA 1VQ6I 2IJLA 3U1DA 1NK3P 1IXSB 4H4KC 4EATA 2CW7A 2B9SA 2PA8D 1LJ9A 1WQGA 1QVTA 4U0WA 1USMA 3LSRA 3RI4A 2HOTA 2HI3A 4QJVA 3E1SA 1Z67A 4Y4RA 1RR8C 3UNGC 4M1XA 2LNBA 1Y1WK 3RYRA 4A93K 2DAOA 2KIFA 4UXNA 5IT3A 2R7UA 4NC7A 2OBPA 2H6BA 1O2FB 2XAFA 2XCOA 1EV7A 5IP7C 3FM5A 1S5LC 1YW7A 2W4SA 4XONA 1W7PA 5GAGJ 2RKHA 3REOA 4MTEA 4C3IK 5L3CA 4Q4ZF 1ZRCA 4C3JK 2JTVA 2JA8K 4XLCA 3HOUK 5IOYA 3S3OA 4BJ5C 4KARA 4CSWA 2YU9K 3I55I 1FOWA 4HNTA 3LSJA 4KB4A 2M4GA 5LFAA 4S05A 5FD5A 3FXRA 1EH6A 2UXXA 3ZQCA 2X9DA 3H9GA 2ELKA 3PIPF 1IRZA 1V4RA 2V1DA 1QU3A 1D8JA 1C0AA 1T38A 2EZIA 1L0OC 2M1BA 3O2PE 3QU3A 2D5VA 1DCOA 4PUSA 4XKCA 3CP2A 2Q1ZB 4XKBA 2JSPA 4XBFA 5M3MJ 3VYTB 2R7WA 1UG2A 2DMQA 1HLVA 5BS6A 1TT0A 3ABTA 3H35A 4D7MA 2R5YA 3PJRA 4I99C 1QQIA 1V3FA 4BBSJ 2R7TA 2NVQK 4YIFA 2QKLB 2CFAB 4EEFG 2CH0A 2F4MB 1TZLA 2K3FA 2ZO4A 5C4JJ 1RI7A 1I6VA 2Y0SA 1BR2A 4U0YA 4IHSA 2DT5A 3H0GA 4UHTA 1EA3A 2HXIA 3EYYA 2LK2A 2FA5A 3PQJA 2VKDA 4A3MK 2FJ1A 5IOTA 4M6YA 4YIIA 1HW2A 1I3AA 1I3QJ 3BQZA 3DKYA 4WXCA 1BA5A 1O24A 2ZUFA 2A69F 4Y7NC 3KPHA 4P9SA 3ZR8X 4HF1A 3L4KA 2FMYA 3HXLA 1IW7A 4ZZDA 5TRDA 4FE4A 4EM1A 2AXLA 4PJMA 2XC7A 1X3ZB 4JX4A 2R7OA 4WILA 3D0SA 3HOYJ 4WJ3M 1MBHA 4ENMA 2XIGA 3BR2A 4DGWB 3H0GC 5D5UB 3MZYA 1F5TA 1EF4A 3GTGK 3AG1H 1E17A 3PO2J 3QYFA 1HA8A 4BY7C 4IEJA 1DPRA 1BJZA 4WXHA 3S3MA 4QWQA 2GIVA 4ESBA 4EVIA 1FTTA 3HDDA 2JA5J 1F7UA 5D5VB 2ZNYA 3OYCA 4C2MC 4OIOF 3CO6C 1IGNA 3KP4A 2NOJB 2VJ5A 3DPTA 4M6VA 4RA2A 3B02A 3T01A 3HL2A 4HF0A 4ZYHA 1REPC 3BR3A 4R8HA 3DTEA 4RBOA 1GV5A 3HIFA 4QSHA 3OY9A 2XGXA 2CQ7A 4IPAA 4M9ZA 4MEYF 3IH3A 2NOGA 3G4AA 2MC4A 4JOMA 3KCCA 1USSA 4L18B 3S14C 5GAEJ 2EZKA 4G8XA 5E79C 1V5VA 1TWCK 1WVRA 2VKHA 1SFOJ 3I4MJ 3GTOK 1G3WA 3BZ6A 4BUPA 4UUSA 2XRNA 3TQNA 3BZKA 4A2UA 1ISEA 3MKWB 1JE8A 3WODF 1O7FA 1VQKI 1FP1D 3F8MA 4P1WA 2L3DA 2LBFB 1WSVA 2ESHA 1WJDA 2QVOA 3OV8A 1VQNI 2VOPA 3S32A 3HHGA 1S3JA 1LVKA 4BQQA 1KU7A 2K9SA 2HTJA 1SAUA 2E34A 4CH7A 3GTQJ 2KKOA 2HOAA 1EFWA 1IN7A 4D7NA 2ZJ2A 1MMNA 4DDQA 1O2AA 1DGRM 1D0XA 5DCFA 5GADJ 1HDPA 5C4XJ 3F9KA 1V5EA 3TKYA 3ZQIA 5LD2C 1OMIA 2BVLA 3SZPA 3CCMI 1ZG5A 2AO9A 5IT9K 2L7KA 1R4NB 1XSVA 3FXMA 3KEYA 3LPXA 3A1YA 3S1QJ 3SQNA 5D4SA 4KITB 1DCHA 4FTHA 3R6SA 2K4BA 1ZTRA 5KHDA 3GMEA 2STWA 1IF1A 1CF7B 4OIQF 1IAWA 1F1ZA 4UVBA 1E3PA 2R7RA 3RSNA 2VE9A 4N4NB 3N05A 4MQ9A 3F23A 4ESJA 3DV8A 2GAGC 3IRRA 3PO3K 3CUOA 2QM3A 4R79A 4G0UA 3HJEA 1WSUA 4ZC3A 4AIDA 2O6GE 1PJ5A 1B59A 3RCOA 3FHZA 3N4MA 1OISA 3GTKJ 3S1NJ 2WY8Q 2X1DA 2R7ZK 1T2KA 3S1RK 1T8IA 1V54H 3V8JA 3C3WA 1WSRA 2E1MC 3DCFA 5HS7A 3LAPA 3ZRGA 3HPGA 1YNJA 1E2XA 3GUDA 1VQLI 3BT9A 5IT9Z 3GTJK 5LHHA 1Y1VA 5FKMA 2RQPA 2HDDA 3K7AK 4FT8A 4L0YB 3VDXA 4CYCA 3S0XA 4PFPA 2X48A 1X4PA 1IV6A 3PQKA 1ONVA 5HLIA 4M72A 3WGHA 4RAYA 1RIOH 4P5AA 4KM8A 1KYZA 2Y9ZA 1MBEA 3BY6A 2YPRA 5HLTA 2DDBA 2A6EA 3OYJA 4IHWA 1MMSA 2B63A 1K4SA 3D5SC 2CFAA 1N75A 4GTDA 3CQZK 1Y1VC 3FXLA 1GXPA 2X1CA 1IXCA 3R60A 1MBJA 1YW9A 4RLQA 4XRFA 5HS9A 3ZN0A 1ZYRA 4YG2F 4LG3A 2LRDA 1I1SA 4A3CK 1XXBA 1QRYA 4GFBA 1TWGK 1SVOA 3MQ0A 1YYVA 3VEPA 1V5GA 1YITI 3HOVJ 1ETOA 5FB2A 4AIKA 2F5DA 1BI1A 1XX5A 2B63C 3ZMUA 5J4YA 2JMWA 4JX6A 5BQTA 4ZYEA 1WOOA 1P7JA 2W25A 1W0TA 1X2MA 2L4AA 2LMDA 1MDMB 1KQ4A 3JSOA 4IL6C 4HNVA 4GTBA 3TGNA 1TL8A 1YNNA 3CCYA 1I6XA 2DPDA 1K83K 2DA3A 3FKJA 4UB6C 1UFMA 2OTLI 3CMMA 1G3SA 4GDFA 3DQVC 2GQQA 3S2DJ 2DCEA 4X6AJ 5ICCA 1ZLKA 3T02A 4NHJA 2IAIA 2E1OA 1RESA 1VH2A 5E3OA 1RKWA 5F64A 2KQRA 3RZOK 2L9RA 3EQLA 2Y75A 1P4AA 2V9VA 1OYIA 4A3IJ 4G7HA 2GIZA 2Q2EB 3H5NA 4E7ZA 3K70C 2UXNA 4Y3OA 2HQ5A 2JPBA 2C6YA 2ZXWH 1XGOA 1TTYA 2XPWA 4UNOA 2IXSA 2P7CB 1HSTA 3TL4X 1VLOA 5FRNA 3JRGA 4A5NA 4XRSA 2KZGA 3IAM2 2IA1A 3M4OK 1OJLA 2DA5A 3G1OA 1JKPC 3IUOA 5DDGA 4GZYA 1XCVA 4KN4A 3GSIA 3WHBA 3SXYA 5K5RA 3RKQA 1PP8F 3CCEI 3OYFA 3CC4I 1VQ4I 1PP7U 2IS2A 4BE2A 2A68A 3E6DA 4I09A 4GTFA 2XAUA 1LEBA 3I53A 1W36C 3CCLI 4AYBN 1HF0A 3I56I 2DMPA 3M3YJ 2QF7A 1ETYA 2VKVA 1FZPB 1IZ1A 1IRGA 1X1DA 4FETA 1WZ2A 2KJCA 3J7YJ 4HYEA 3I0TA 2GOXB 1MMDA 5ED4A 2MH9A 3MAJA 5M5XJ 3NQOA 5CVIA 2BEOA 3BJ6A 3HOSA 1FPQA 2LKSA 4EM0B 3F8FA 1ENHA 5B5EC 2RDPA 2ZC2A 4PGGA 2E2HJ 1NK2P 1OCTC 4AC0A 1O3SA 3A8KA 1IN5A 3K4NA 2XF6A 4AWXB 1PUFB 2DA2A 2O03A 2E35A 3BP8A 4WF2A 1RUNA 3FK6A 5TGTA 1VFCA 4Q4ZA 2VLAA 1H0MA 4WJ4A 1WQFA 3ABKH 4HQMA 2CUEA 3HSFA 4HX4A 2MFZA 4ENJA 2XROA 1ZGJA 2M30A 3CD6I 4O2DA 4BBRJ 4A3BJ 2IVMA 2ME0A 3WG7H 1QZYA 4IRGA 4JBAA 3OL3A 3HOXC 5EYRA 1U9NA 2DBBA 4A5MA 3GTMJ 1D1CA 2PMZN 5IYBK 1RU0A 3ZGKA 1T33A 1TNTA 2XDVA 3HUGB 1ZQ1C 3CMYA 3ULQB 2FQ4A 3JAMK 3BP8C 3AQOA 5L3DA 4DZPA 3HKZN 3RTRA 3X2QH 3P5JA 1LFPA 4PJJA 3S17J 3RYPA 2R92K 3OSFA 1U5TA 1LVAA 2HDCA 3CDLA 2MW8A 2BE5F 2IRFG 3VODA 2DTRA 2DJNA 4U7BA 3QODA 4GTAA 1J2XA 2LP0A 1OFCX 2GXGA 4IOAF 4KN7A 4UVAA 2MD0A 1SFXA 1XD7A 2CYYA 4RGXA 4RAGA 1JT0A 1QNTA 5C3EK 5DV5A 3DBHB 1IRXA 4PCQA 2GAUA 5CVVA 3GEEA 3QU6A 1U5TC 2ZXHA 3CUQA 4ON0A 5IP7J 5E8GA 5FKOA 4PSXA 3MCZA 3GCMA 1H9TA 4A0ZA 2AHQA 4AYBA 3KZIC 2KMUA 4PGHA 1UHMA 3DPLC 3GTOA 4Z6YA 4P9UA 2HQAA 4I01A 4QIWN 1QHHD 4HV6A 1MDMA 2DK5A 1TW3A 1Y39A 1DP3A 3H3VD 3G71I 1HQCA 1X3UA 1T08B 4XLNA 2DN0A 2DJIA 2PX9A 4M3DA 4ILDA 4CA0A 4OIOA 3S1NC 2NVXA 3W6JB 3CUQC 2VJIA 3T00A 4O5VA 1JUSA 1LDJA 4UY8I 3I58A 1AB4A 1ETXA 2BY1A 2WAFA 2OV7A 2QKMB 2VT2A 3QWLA 4KMFA 1MMGA 2M8EA 4MEYA 4C45A 3IHUA 4P5BA 2VB6A 3M1CA 3GEIA 1XXCA 3QPTA 1BN5A 3K1MA 2XF5A 2KIMA 4BE1A 1MGTA 2CJJA 1H9GA 2E19A 5J1UA 4MFEA 3F72A 1KU3A 3Q9SA 2ZFUA 2FSWA 2NVXC 4XR6A 2H1KA 3FKIA 3WODA 1NH3A 1R36A 2R93K 2XKOA 4KMUX 5BNGA 5EGOB 4HLYA 1JXSA 1O57A 2EBIA 1I50A 3JRIA 5E68A 2BW3B 2K9QA 2KT0A 3Q3SA 2FQTA 2PMZL 2D6FC 2EH3A 2PMZA 4Y7NJ 4XORA 3C1DA 1MZBA 2XAJA 4WCGA 1KGSA 2DYRH 2P0WA 4XMYA 3BTCA 1MNDA 3HEFA 2UV1A 3AL0B 2PLYA 3HKZA 4J19A 1ZBSA 3OREA 2FXAA 4EJTA 4MQ9F 2F6CA 2KZVA 3H0GJ 3A0HC 5LGNA 3LA3A 4XN3A 3FKIC 4BY7J 4IRHA 2VUMK 4LOWA 1I50C 2NVTC 5L3GA 3BUEA 2O5IA 2K85A 2L7ZA 4C2MJ 3W6KB 2PBIA 2NNNA 3HM5A 1GT0C 3E5UA 4V2FA 4V2GA 4L9TA 1VZ0A 5FKKA 4A12A 3SFZA 4WK8F 3CC7I 2QENA 4GT9A 5HS8A 3T8RA 5JFRA 5FJ8J 2OCEA 3K70D 1ZXOA 2KRCA 5FKNA 4JQFA 2CV0A 1A31A 3S14J 1SD6A 3KP7A 5E1XA 1Z6RA 1PUFA 3P7NA 3U2RA 2VC0A 4RDUA 2IBDA 2DA1A 4OAYA 2E2JC 4QIWL 1HC8A 1X1CA 1U2WA 2RGVA 2KWAA 4U87A 3E3VA 2G9WA 4RAZA 5BPDA 1Z0XA 4MQVA 2A6EF 4MHGA 4RGSA 4ABZA 2MD5A 4BL0B 4E4HA 5IP6A 3P9KA 5IYDC 5DD4A 2JUCA 4DYQA 1N77A 4D5FA 1I5ZA 2HXOA 1GV2A 1ZYRF 5EEHA 2EFWA 3CMEI 2O5RA 3OOPA 2E2IA 3K69A 3VYUB 5M3MK 2A6HA 3S16C 1YW8A 3VA7A 2A05A 2K86A 1FOYA 4C3HC 1I1GA 4EGZA 3LA2A 4IOCF 3N0CA 2F4OB 4BBSK 4WWCA 2P5LC 2WADA 4EJVA 4BQAA 4ZDPA 5C4JK 2JA7A 5DD8A 2K9MA 2DQLA 3K9TA 2HYJA 5EGHA 2XVCA 2XGCA 2MSYA 2JPCA 1J6WA 3HPHA 2E2IC 2FE3A 4R1HA 3BR0A 2KDZA 1F93A 3Q9VA 4FE7A 2WC2A 2QA4I 3I64A 2HOSA 1I3QK 3CP8A 3BQYA 2KP6A 3DKXA 4ZDLA 2K02A 1BBYA 1LB2A 2M2EA 1PUEE 1JJ8C 3RPUD 1CQTA 2VI6A 1DP7P 1BGWA 4HQEA 5DYMA 1UCRA 2JA7C 2RQQA 1FBUA 5M3FJ 1IN6A 3HOYK 5ILVA 1XTAA 3RQ4A 2PMUA 1B72B 2DOEA 4G7HF 3PO2K 2QSFX 1YX5A 4E7JA 2DODA 2CG4A 3HHHA 4L5JA 2R5ZB 3CCSI 2JA5K 1ZREA 2Y0SN 1FMVA 2MH2A 5JHFA 3IWZA 3MKZA 3LMMA 1S7EA 3CLOA 3J81K 4DQ2A 3FBNB 2XRLA 3OR2C 2V6CA 2Y48A 1UJ8A 1RKTA 3SEZA 2IGNA 1LDKB 2Y9YA 4CCMA 4HDUA 3K0LA 5J1RA 1O27A 1Z05A 2EV0A 2RN7A 4DYCA 1BW5A 2FEZA 2CSOA 1R1UA 2V9KA 3K1PA 1BOBA 3OIQA 5DUKA 1A36A 4Q48A 3PM1A 1Y1VJ 1AWCA 2IGKA 3H92A 1SFOK 3I4MK 1XPPA 2E1NA 4II2A 4RS8A 3L2WA 5E3LA 3ZMVA 2VQHA 1QBJA 4IJAA 3PNYA 5CHPA 1ZELA 3LSIA 5M5WJ 1TWHA 1J98A 1TWFA 1UZCA 3W2WA 3GEHA 1R23A 3HSEA 4D1QA 3GO5A 2JA6A 4G6TB 4YRVA 2BW3A 1JKOC 2PPBA 2M87A 1IBAA 4XSZF 1ZG3A 2B63J 1XGNA 2HOEA 3GTQK 4RAFA 3J81Z 2XGEA 3GTLA 2DT6A 4B3XA 2ECBA 2X6XA 2FQOA 2LREA 4JP0A 3K4MA 1FSEA 5LRRA 4BLAA 5C4XK 4LK1A 5HLGA 1MD0A 2O7OA 4A3LC 1TWHC 2H8WA 2Y2ZA 3B6AA 1TWFC 2ZXIA 4NC6A 3I4NC 3CESA 2H1LA 4XLFA 3JW4A 3S1QK 5F0CA 4QPQA 5J3LA 3ZQQA 2JA6C 5H2FC 3HC7A 1GDTA 4JK1X 2RREA 4GRIA 2F5EA 3G73A 2X0LA 5FLMC 2EFQA 3FXOA 3AD9C 3GTLC 5IOQA 1DCPA 3TEDA 1PYVA 4CCLA 4BNCA 3AL0C 1B8IA 3GZNB 5IOSA 2YX4A 1R9TA 1MBGA 1I6HC 3CCVI 3J7AO 2O8XA 4OMZA 1IUYA 1IG7A 4YFKA 2R7DA 2ZJQF 3K4LA 2D2WA 2P6TA 3I3LA 4LLLA 4M9XA 4DBRA 5EDNA 4KASA 3GTKK 3S1NK 4HPQA 1LQ1A 3I5UA 4HX7A 4DOZA 2EWNA 1TWAA 2WV1A 3D1NI 1Z91A 4KN4X 2XAGA 1PJ6A 1WOPA 1WGXA 5JVTA 2Y0SL 4F55A 4OIPF 1J75A 4A0XA 2M3AA 1R9TC 1D8KA 3KETA 3ROUA 3BCBA 1ZAOA 2X6YA 3KLNA 4DJAA 4KMAA 1LFUP 1EH1A 5EG0B 2NRAC 2CUFA 4BGDA 1ORKA 1WIHA 1XMAA 3WU0A 4Y52C 1ZK8A 3JR9A 1R5GA 2FX0A 1TWAC 2QQBA 1RR7A 4RMNA 5E3MA 2BE5A 2JH3A 3TFIA 3JSPA 2VPLA 4IX7A 2PMZD 1VI0A 4XLPA 1D3YA 5KCMA 2LKXA 1VTNC 3BR5A 2NVUB 4BEHB 1UG0A 2N8GA 2NVYA 4RB2C 4RGUA 4A3JC 1Y0UA 3HKZD 5DS9A 1V55H 3M07A 1RZ4A 1ZQ3P 2OUMA 4BHBA 3GEZA 3VYSB 3M9AA 3GDZA 4A3EC 4XLNF 1RRJA 1YHQI 1JTYA 2HPIA 3BOQA 3HOVK 4L9JA 2DFFA 1MIJA 5HDNA 2ACJA 3FDYA 4BKWA 2ZSHB 3T8TA 5IYCC 1Y0NA 3ABLH 4H0EA 1AU7A 2ZKZA 5J4VA 3FXKA 3FOEA 2BZTA 4A0YA 4BXXC 2NVYC 1D5YA 1B72A 2WB1A 4WXDA 5B1AH 2V9PA 3OR1C 4OWRB 5JVGF 3DP7A 3HOXJ 2QBYB 2R5ZA 2WWYA 1K7AA 3T0YA 1FMWA 3IWFA 4PABA 2ZUEA 2WAQN 3S2DK 3GZ5A 4X6AK 3D5LA 3SEQA 1B6AA 2EB7A 5DUIA 4XQFA 1YRNB 4QIWD 4EJUA 5KAFC 4XKVA 2XAQA 1OQYA 3HXAA 3GX4X 2EJRA 1SFUA 3OYLA 2BOLA 4KN7X 4A3IK 3OYEA 1T6SA 1IDYA 4XKWA 4IQJA 3WTYC 1S72I 2M0CA 1FTZA 3TFHA 3EPZA 3AKZA 2M7AA 1IXRC 2O9LA 1SD7A 3ZCOA 4EV0A 3EUAA 4G94A 4G7OA 1MBFA 3C2HA 4LFUA 4RM3A 5D8LB 4U0VA 4A3FC 4BXFA 2VONA 2Z9OA 4GTEA 4DBQA 4S04A 2HZTA
chains in the Genus database with same CATH topology
2ZMEB 1JHHA 2IT0A 1BI0A 3DXJF 2Y0MA 2JZYA 3JTGA 4KUMA 2XHKA 2E7WA 3I54A 2W24A 3RJPA 1XCBA 3GZ6A 1W5TA 1T98A 1XSXA 3NUHA 3F6OA 5LEKA 3GXOA 4CGZA 5LEJA 1TQMA 4RB0A 2L02A 5E1ZB 1S7AA 2GZWA 4BHPA 1WCMA 3LQRA 2K4JA 4CZZA 2EK5A 1KU2A 2A6HF 2M5WA 1J7KA 4J3NA 4G6DA 2MA3A 4B09A 1SMYF 4Q47A 1A04A 2DW4A 3J80K 3VB2A 1J5YA 3B73A 4OOIA 1HSJA 1TQIA 2RNJA 4G0WA 2LSOA 3L7WA 1BJTA 4RB3C 1BC7C 3ZPLA 2MLGA 2PN6A 1YTYA 2IP2A 3EYIA 4N0BA 2Z99A 1YFHA 2FU4A 1T0FA 3E5QA 1MJAA 4P55A 3GF2A 3IKTA 5K5QA 3EUHA 3V8KA 1DD5A 5JR3A 3N3YA 2LDUA 1YLFA 2GXBA 2LF8A 2V1UA 5HDGA 3J80Z 4AD9A 2FBIA 3KFWX 3KZZA 3ZQ7A 1W7PD 3E5XA 4G0VA 1G6NA 3SZTA 1NHAA 3AAFA 2XKPA 4DNCA 2P6SA 4MGRA 4KICA 1UB9A 2OZUA 3V7RA 3TDUC 2P4WA 1ZARA 4ENNA 4Z2YA 1QZZA 2YX7A 4KDPA 2EFNA 4P5OA 3F22A 1ULYA 2PMHA 3HOTA 3H3UA 4Q5SF 4M74A 2HR3A 4IXAA 5A2QZ 4LK1F 1XGSA 2STTA 3P9CA 4YFNF 4A6EA 3RKWA 1YQAA 3R0AA 3TO6A 2RGRA 1B4BA 1CF7A 3GTPA 3WTTC 2HWVA 5HOOA 2XASA 3U9GA 3KLOA 5LHGA 5FD6A 4YFKF 3QX3A 3CO7C 1R22A 1HBXG 4IHTA 1G3TA 3R61A 5LLQA 2ADUA 3TO9A 2Z5UA 4LB5A 2PQ8A 1MKMA 1WI9A 3AH5A 2Y3PA 2FQ3A 2V1XA 1GXQA 2F5FA 2ZNZA 5JFEA 1YG2A 3BJOA 2ZCWA 1T39A 3ISPA 3EETA 4XLPF 2XCRB 1XDSA 2D45A 1Y1WA 2ELHA 2P7VB 6PAXA 2ZXJA 2BBYA 4KC6A 2QQ9A 3FOFA 5K5OA 1ZRDA 2FMLA 3N0BA 2O61A 2E7XA 3M7GA 1WWXA 2HKXA 3ERED 1EK8A 2GSNA 2YU9A 1Z1DA 2OA4A 4AVPA 4KM9A 5KK1A 2XUBA 3GFJA 4KATA 5J6XA 4LGWA 1U3EM 4B8XA 1HW5A 4XSXF 4RGRA 3JTHA 5CVJA 1SAXA 4CHUA 4FM9A 4ENKA 2OZ6A 4C3IC 1P6RA 2KIUA 4BYYA 3MWMA 4UV9A 2A3SA 3RPQA 2YSRA 1LDDA 1XMKA 5DEQA 5LGUA 3DKWA 4ZYDA 2F2EA 2ZBKA 2Q2EA 4O6JA 3WTUC 3TO7A 1ZN2A 3QPHA 3KP3A 4U88A 5FGMA 3ZP5A 1FYMA 4CICA 4G7OF 3F6VA 4E70A 3BPXA 1S8NA 1XDUA 4M9SA 1TNSA 1YIOA 4EM2A 1BI2A 3GTGA 4LLNA 1XSDA 3R0JA 4LG0B 3ECHA 2W84A 1ODDA 4MTDA 2OD5A 5ICFA 3N97A 4HX8A 1U6GA 3KE2A 2J5PA 3TOBA 1B1BA 3F21A 3V7SA 5D6EA 5EGEA 4N9HA 3FMRA 4I0BA 3WTWC 1XN7A 5L3BA 5FFXA 1RNLA 1TWCA 2MBFA 2JRTA 4HW0A 3GTOA 3ABUA 3FXUA 3FMSA 4ZZLA 2HS5A 4IF4A 5AONA 4GFQA 1R1TA 1BM9A 1GVJA 4KB2A 2ZFWA 2W85A 2EV6A 2HTSA 2MLKA 2HYGD 3ECOA 2HEOA 4P96A 5CVRA 2PI0A 4MEXF 4KAWX 2VC1A 2QUFA 3HUGA 2HGCA 4KNYA 2AS5F 3RKYA 4MNUA 3HRUA 2YU3A 2DLLA 3AQPA 2JT1A 3KZYA 1F9NA 4KIFA 4FZBA 5JI6A 4Y17A 3LSTA 5F1RA 3CAGA 2L4MA 2GA1A 4LMYA 3WTZA 1B9MA 2R7ZA 3ZMTA 5AIPA 1O3QA 1QPMA 3DF8A 2GA2A 3GTJA 3NEUA 1B4AA 2COMA 2P8TA 1BIAA 4AIHA 2IA0A 1QGPA 5EEGA 2BGCA 5LBQA 2DQRA 1MJBA 2CW0F 1P2FA 4ZH4F 2O3FA 1WQ2A 1STZA 3OPFA 1FP2A 2R3SA 3HSRA 1K79A 1EH8A 4OIRF 3CQZA 2WV0A 3WU1B 3LQQA 5DCMB 1DDNA 1S6LA 2EA4A 1FC3A 1TWGA 4YFXF 1FYKA 1LNWA 4GTLA 3CJNA 4GGGA 1J0RA 4ESFA 2E1CA 2ISZA 4G7ZF 3FMQA 1Q1HA 3V4GA 1K83A 5J8CA 4LG0A 1Z6TA 1P4XA 3CTAA 2VBXA 4KMDA 3WGIA 4TV7A 2FBKA 1IN8A 4EMSA 2D1HA 4GCVA 3G4CA 4QLCU 2H27A 2HFHA 3BDDA 5HVQC 2PJPA 3O3KA 2YR2A 2H09A 3Q5FA 1F4KA 2ETHA 1OYYA 1ZG1A 3HTSB 3QOPA 5ILUA 3GFIA 3E6CC 4FHTA 2CGPA 1PDNC 3E6BA 5LRSA 3RDIA 2V79A 3FXQA 2Z3YA 4OU0A 2A07F 2O0YA 3FF5A 3FZVA 1XB4A 2PFBA 3QRFF 1HW1A 2BYVE 5D5WB 1FLIA 4HF2A 4LQYA 2GWRA 3H3ZA 4L9VA 2IA2A 3BROA 2FF4A 1YO5C 1O2BA 1OR7A 1CGPA 4F7ZA 3OEPA 1JHFA 1GE9A 2X4HA 5BMZA 2VBYA 4UV8A 2VBWA 4HOBA 4HZFA 1BC8C 3WTXC 3V8LA 2DPUA 1LEAA 4KMHA 4NB5A 2NS0A 2R92A 4G6QA 4HLXA 3BWGA 4UVCA 2L54A 3FX3A 4BXUA 3ZMDA 1WKMA 1BI3A 5DCMA 2Z33A 4HBLA 5JHUA 4BAYA 3CDHA 1USTA 5D4RA 2H94A 3WGGA 4UUVA 3C18A 1FOKA 2F5CA 5H6QA 3DEUA 5H6RA 2J5OA 3QP5A 3FWEA 3K2ZA 3BPVA 2FOKA 3HYIA 3C7JA 3KEQA 1KQ8A 2DFIA 3WE2A 5AIQA 2BV6A 3GFMA 1R1VA 1IRFA 4PDKA 2ESNA 2UZKA 1KQ0A 4O3MA 2IPQX 2DK8A 3M8EA 2NNYA 3EDPA 1JGSA 1BIBA 2HQNA 4OINF 3R4KA 3LAJA 2R93A 1ZHFA 3T1BA 1Z7UA 4L5IA 4ZYGA 2P5MA 4M73A 2MC3A 3KEOA 2CFXA 1K78B 4GO1A 1G3YA 3TDZC 4I02A 2QYOA 3GWZA 1R00A 1WRJA 1TBXA 3BJAA 2VUMA 5CJ9A 3MFKA 3PFIA 1U5TB 3F8BA 4LD5A 4EJWA 1L3LA 3K1NA 1ON1A 1ZH5A 5D8KB 1O3RA 2GSOA 1S7OA 1YS7A 4I98B 2A61A 3CUQB 4LLGF 5FO5A 4A6DA 4U7DA 1YS6A 3MEXA 1IN4A 3G3ZA 5A2QK 4EJOA 3RKXA 1FT9A 1FBSA 5CYVA 1S29A 3FM3A 3F8CA 2QBYA 5F6FA 5TJJA 3IC7A 2QZ8A 1I27A 2M45A 3S2WA 3KP2A 2XAHA 3RIRA 1RUOA 1O29A 5IORA 4HDVA 2VXZA 3P9IA 3HRTA 4G9YA 3VFZA 3GW2A 2H6CA 1I3QA 4IVNA 3IRQA 4BLBA 2RH6A 4M6XA 3NRVA 4P9FA 1J59A 1FSHA 3WG9A 2RV8A 2Q8KA 2GSUA 2L01A 3DFGA 2ZMEA 3GYHX 2KRFA 5E8IA 3I59B 1R58A 4KDDA 2FNAA 1O7LA 3LWFA 3ELKA 2RC4A 2LKPA 2B0LA 2JA5A 3F8NA 2QQAA 3COAC 2DO7A 4N9IA 1K6OA 1J9IA 3RPUA 4KT5C 2D1VA 3IKVA 3KP5A 2DU9A 1FY7A 4ASNA 4HA8A 2K7LA 1SFOA 1TQPA 4KIGA 2KJBA 1O26A 1DUXC 4NQWA 1ON2A 2VODA 2VBZA 4OMYA 5BPIA 2OQGA 1B9NA 5E17F 3V7CA 2TDXA 5CLSA 2CWEA 1K78A 3GTQA 3ZMZA 5E20A 2Q0OA 5L3FA 5CVUA 3LA7A 3GLXA 1D5VA 1XGMA 5ERIA 4IRIA 2OU2A 3L2CA 2OQRA 5J8FA 3L09A 3WTSC 1IW7F 3L00A 1O28A 3WE3A 2IW5A 3M8FA 1DPUA 4PZJA 2UWMA 3TOAA 2FBHA 3GTKA 1UHWA 1IS1A 3IL2A 4C3JC 1FX7A 1KQ9A 2ISYA 1TW2A 2XCQA 3JAMZ 3L9FA 3F3XA 3VOEA 1P4WA 1SD5A 1OYWA 4CXFA 5LHIA 1HKSA 3I4PA 4CDGA 2EV5A 2FRHA 4GYGA 3Q3QA 4Y13A 2R7FA 1BOAA 4EGYA 2W57A 1P92A 4K2EA 4KFCA 3MMLB 2HKOA 2LF7A 1TLHB 1MJ9A 4AIJA 2CQKA 4FX4A 4HV5A 1SMTA 2VT3A 4GYIA 1U78A 2XV4S 5LGTA 5E1WA 1KYWA 4GTCA 3GFLA 1FBQA 2QWWA 3T5XA 3I59A 1QO0D 2JSCA 1ZGAA 5BOXA 4KYWA 5ICGA 2QLZA 3HRMA 3E6MA 2P5VA 1W4MA 1Z9CA 4BHCA 4LR2A 1W7PB 2WTEA 4KA4A 1FYLA 4I2OA 4GXOA 3WTVC 2G7UA 2OAZA 3HTUA 3E97A 4FX0A 4LK0F 1GHCA 1OKRA 1HKQA 4LB6B 3QP6A 4D0PA 2VOOA 4I0AA 3ZMSA 5FFZA 1R7JA 5E18F 5L3EA 2VN2A 1WQHA 2HQRA 1XXAA 2PEXA 4I7HA 2CO5A 4Y15A 1BJAA 5FLXK 1OPCA 1SFEA 3ZN1A 1ZVUA 1U8RA 2RVCA 5TJ3A 1ZLJA 2FNPA 4L0ZB 1O25A 2E2HA 5HDKA 5JVOA 2HYFA 4CYDA 4WX9A 4ETSA 4KIBA 4CO8A 2G7HA 1AOYA 5HLHA 3QAHA 2ZFZA 3M1EA 2K27A 5D6FA 2NAZA 3GVAA 3L4JA 5K1YA 1R5HA 4L9NA 3SHFA 2VE8A 4HAMA 2EFOA 3O6BB 3EQLF 3KP6A 5FLXZ 3MZHA 2NYXA 3ML6A 3GTMA 1ZRFA 1W5SA 1C0WA 1HKTA 1O3TA 1HXDA 4LJZF 2EA2A 1KU9A 5D5XB 5ICEA 1G4DA 4BH9A 1FWZA 2P5KA 2EFPA 2A5YB 3I71A 1KA8A 1EH7A 4EQQA 2PG4A 5KVRA 3LFKA 5H20A 4RB1A 2PHCB 2A68F 1FNNA 5ILSA 1SD4A 2DI3A 3HRSA 4M71A 2IJLA 3U1DA 1IXSB 1LJ9A 1WQGA 4U0WA 3RI4A 4M1XA 2LNBA 3RYRA 2DAOA 2KIFA 4UXNA 5IT3A 2OBPA 2H6BA 2XAFA 2XCOA 1EV7A 3FM5A 1YW7A 1W7PA 2RKHA 3REOA 4MTEA 5L3CA 4Q4ZF 1ZRCA 2JTVA 4KARA 4KB4A 4S05A 5FD5A 3FXRA 1EH6A 2UXXA 1V4RA 2V1DA 1D8JA 1T38A 2M1BA 1L0OC 3O2PE 3QU3A 4XBFA 5BS6A 3ABTA 1QQIA 1V3FA 4YIFA 2CFAB 2ZO4A 1RI7A 4U0YA 4IHSA 2DT5A 3H0GA 4UHTA 3EYYA 2FA5A 3PQJA 5IOTA 4M6YA 4YIIA 1HW2A 4WXCA 1O24A 2A69F 4HF1A 3L4KA 2FMYA 4ZZDA 5TRDA 4EM1A 2AXLA 3D0SA 4ENMA 2XIGA 5D5UB 3MZYA 1F5TA 1E17A 1DPRA 4WXHA 4QWQA 4EVIA 2GIVA 4ESBA 5D5VB 2ZNYA 4C2MC 4OIOF 3CO6C 3KP4A 3DPTA 3B02A 4HF0A 4ZYHA 1REPC 4R8HA 3HIFA 2XGXA 4M9ZA 4IPAA 4MEYF 3G4AA 3KCCA 1USSA 4L18B 4G8XA 1G3WA 3BZ6A 2XRNA 3TQNA 4A2UA 1ISEA 1JE8A 3WODF 1O7FA 1FP1D 3F8MA 2L3DA 2ESHA 2QVOA 3OV8A 2VOPA 3HHGA 1S3JA 1KU7A 2HTJA 2KKOA 1IN7A 2ZJ2A 4DDQA 1O2AA 5DCFA 3TKYA 1OMIA 3SZPA 1ZG5A 5IT9K 3LPXA 1XSVA 3SQNA 5D4SA 3R6SA 2K4BA 2STWA 1IF1A 1CF7B 4OIQF 1IAWA 1F1ZA 4UVBA 2VE9A 3F23A 4ESJA 3DV8A 3IRRA 3CUOA 2QM3A 4R79A 4G0UA 1WSUA 2O6GE 1B59A 3FHZA 3N4MA 1T2KA 3V8JA 3C3WA 5HS7A 3LAPA 1E2XA 3GUDA 5IT9Z 5LHHA 1Y1VA 2RQPA 4FT8A 4L0YB 3S0XA 3PQKA 1ONVA 5HLIA 4M72A 3WGHA 4RAYA 1RIOH 4P5AA 4KM8A 1KYZA 3BY6A 2YPRA 2B63A 2CFAA 4GTDA 1GXPA 1IXCA 3R60A 1YW9A 5HS9A 4XRFA 3ZN0A 4YG2F 1I1SA 1XXBA 3MQ0A 1YYVA 3VEPA 5FB2A 4AIKA 2F5DA 1BI1A 3ZMUA 5BQTA 4ZYEA 2W25A 2L4AA 1MDMB 1KQ4A 3JSOA 4GTBA 3TGNA 1I6XA 2DPDA 1UFMA 1G3SA 3DQVC 2GQQA 5ICCA 1ZLKA 4NHJA 5F64A 2Y75A 1P4AA 2V9VA 1OYIA 2UXNA 2JPBA 2C6YA 1XGOA 1TTYA 4UNOA 2P7CB 1HSTA 4A5NA 2IA1A 5DDGA 1XCVA 3SXYA 5K5RA 1PP8F 1PP7U 4I09A 3E6DA 4GTFA 1LEBA 3I53A 1FZPB 1IZ1A 1IRGA 2KJCA 4HYEA 3I0TA 5ED4A 2MH9A 3MAJA 3NQOA 5CVIA 2BEOA 3BJ6A 3HOSA 1FPQA 4EM0B 3F8FA 2RDPA 4PGGA 1O3SA 1IN5A 4AWXB 2O03A 3BP8A 4WF2A 1RUNA 1H0MA 1WQFA 4HQMA 3HSFA 4HX4A 4ENJA 2XROA 1ZGJA 2M30A 2IVMA 1QZYA 4IRGA 4JBAA 2DBBA 4A5MA 1TNTA 3ULQB 3JAMK 3AQOA 5L3DA 3RTRA 3RYPA 1U5TA 1LVAA 2HDCA 2BE5F 2IRFG 3VODA 2DTRA 4U7BA 4GTAA 1J2XA 2GXGA 4UVAA 1SFXA 1XD7A 2CYYA 4RGXA 1QNTA 5DV5A 4PCQA 2GAUA 5CVVA 3QU6A 1U5TC 3CUQA 4ON0A 5E8GA 3MCZA 1H9TA 4A0ZA 4PGHA 1UHMA 3DPLC 4P9UA 4I01A 1MDMA 4HV6A 2DK5A 1TW3A 1HQCA 1X3UA 4ILDA 2NVXA 3W6JB 3CUQC 4O5VA 1LDJA 3I58A 1AB4A 2VT2A 4KMFA 2M8EA 3IHUA 4P5BA 1XXCA 3QPTA 1BN5A 3K1MA 2KIMA 1MGTA 1H9GA 3F72A 1KU3A 3Q9SA 2FSWA 3FKIA 1R36A 2XKOA 4KMUX 4HLYA 1JXSA 1O57A 1I50A