1F9NA

Crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
KGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ARGININE REPRESSOR/ACTIVATOR PROTEIN
publication title The structure of AhrC, the arginine repressor/activator protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f9nA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1f9nA02
5FFXA 3NRVA 3O3KA 2ESHA 5TJJA 1H0MA 2FQ3A 3FMQA 2XRNA 3HYIA 3R0AA 1XSDA 1BN5A 2W85A 1YO5C 4HX7A 5D5UB 4M74A 2R7FA 2CQKA 1IN8A 1R1UA 2K7LA 2OAZA 3V8JA 4N0BA 3LAJA 3PFIA 4I01A 4HAMA 3T8RA 4UNOA 3F8CA 2YSRA 5A2QZ 3ROUA 1HXDA 4MHGA 5E1WA 4EJTA 2M8EA 2CG4A 3P9CA 2L02A 3PQJA 4HZFA 1FYMA 3LWFA 2F2EA 3WG9A 3KETA 1BC8C 1FBQA 4R8HA 3DF8A 4I98B 1WQGA 3EETA 4LGWA 4EGYA 1ZG1A 1DD5A 2DPUA 1RI7A 6PAXA 3PQKA 2KWAA 3FM3A 2VE9A 1BI1A 3HRSA 2IT0A 1XXAA 4ENNA 1EH1A 3JTGA 4OIPF 3HSRA 4U88A 3I64A 2MLKA 4G6DA 2EWNA 2FMLA 3MCZA 2CW0F 4LK0F 1SFUA 3T8TA 1W7PA 2V1XA 1OPCA 4IVNA 5FFZA 1DP7P 1T39A 1FY7A 3V8KA 3GO5A 3CJNA 2DQLA 2OZUA 4G9YA 1U3EM 2CWEA 1P92A 4I0BA 3HHHA 3QPHA 1ZLKA 2Z5UA 2CO5A 3H92A 1K79A 1LEBA 2LNBA 2ZFZA 1QO0D 3FXUA 1DDNA 4HLYA 1PDNC 4XSZF 1TTYA 1QGPA 2OU2A 4AVPA 2VONA 2JTVA 3VOEA 2P8TA 2MLGA 3HHGA 3CO6C 4HQEA 3GEZA 4GO1A 3REOA 3IHUA 4EV0A 4BXUA 3AAFA 2B0LA 4A5NA 2RVCA 3I59A 3JTHA 3KP2A 5D5VB 4KAWX 3I71A 5HS8A 2PN6A 5HDKA 1R00A 5D6FA 5EEHA 4M72A 2XCRB 2QQBA 4CHUA 2BE5F 3GLXA 2EFNA 3L4KA 3ZMUA 4WF2A 1K78A 3LSTA 1Z9CA 5DCMA 5DV5A 1F1ZA 2O6GE 3D0SA 5LHHA 3WU0A 3TKYA 5J8FA 1ZG5A 2KJCA 2DO7A 1XXCA 2QBYA 4G0WA 2K27A 1WQ2A 2CFXA 4S04A 3Q9VA 1O3SA 1D8KA 2EV0A 1TQMA 4ZZDA 2PHCB 4RGRA 3KP5A 4RAZA 5BPDA 1BOAA 4EJUA 5K5OA 2HS5A 2ZFWA 2DPDA 1XB4A 5CVIA 1IW7F 2IA0A 1R7JA 2Q2EA 3QAHA 4A6EA 1LJ9A 2XAJA 1T6SA 2HKOA 2OA4A 2PG4A 3O6BB 2XKPA 2P6SA 4XLPF 5AONA 5JR3A 3MEXA 3QU3A 3KP7A 2LF8A 2VT2A 1O7FA 1EH6A 1WRJA 3HTUA 1YLFA 4KDDA 4EJOA 3HRTA 3WTXC 2K86A 3OEPA 4IJAA 5E8IA 5EEGA 1R1VA 4Y17A 2MBFA 1HW1A 4E70A 2RGRA 4ZH4F 1FWZA 1U5TA 4KN7X 1B4BA 3ABTA 2ZBKA 1R36A 1YYVA 3MQ0A 1FNNA 5H6QA 1GXQA 1BIBA 5E8GA 2A07F 1ZYRF 4YFXF 1ISEA 1BJAA 3SXYA 2RN7A 2JPCA 1RUOA 1HKTA 1EK8A 2COMA 5ED4A 2KIFA 1TNSA 4PGGA 1DUXC 3M1EA 1YIOA 4KUMA 2R7DA 4ENJA 1GE9A 2DU9A 2O3FA 4L9NA 4KT5C 1XD7A 4UV9A 3WTZA 2HFHA 4HF0A 1ON2A 4KIGA 4EVIA 5D6EA 1VTNC 4KICA 5BS6A 1U2WA 2X4HA 1ZVUA 4UVAA 1ONVA 3GFIA 3FOFA 3NQOA 1RIOH 3E6DA 3VB2A 2IVMA 3FX3A 4P9UA 1B59A 3W6JB 1NHAA 3GUDA 1SD6A 2FNAA 3P9IA 4KB4A 5D5WB 1SD4A 4O3MA 5FD5A 1KU9A 2KIUA 2EV5A 2A61A 4KIBA 1KQ9A 5D4SA 3RPQA 4AIHA 3QPTA 4WK8F 3P7NA 1AB4A 1KU3A 2L4AA 3CAGA 4I02A 3BUEA 1MGTA 4YIIA 2J5OA 1BC7C 3E5UA 3GVAA 3QOPA 4R79A 1B9NA 3WE2A 1FBSA 3K1PA 4HA8A 3KLOA 1YG2A 2R3SA 2FOKA 1PP8F 2QYOA 4GGGA 4PGHA 3C18A 3J80Z 2D1VA 2EV6A 4LLNA 4KMUX 2Z99A 2PJPA 4G7OF 3VFZA 1SD5A 1O3RA 4IRIA 2D45A 5BQTA 5JHUA 3F72A 1UCRA 5J8CA 1SAXA 3TOAA 2VT3A 2MD5A 5E1XA 3L00A 2F5EA 2PI0A 1R22A 2AS5F 5CVVA 1O57A 1TQPA 2JPBA 4D0PA 2ZJ2A 1U78A 1SMTA 2Z3YA 4G0VA 1SFEA 2H6BA 3RPUA 2AXLA 3GW2A 4GXOA 3J7AO 5LHGA 1KU2A 4XRFA 4UVBA 3F22A 4Q5SF 3J81Z 4S05A 3OREA 2MH9A 3GFMA 1JHFA 1IN7A 2P5KA 1G3TA 2G7HA 3QP6A 2W24A 3IL2A 5ICEA 2FBIA 3RDIA 2Y0MA 1QNTA 3VODA 2K02A 1C0WA 4LLGF 3KZZA 3LAPA 2P7CB 2RDPA 3KFWX 1KYZA 2RC4A 2UZKA 3TGNA 1TW3A 4TV7A 3GZ6A 4WCGA 5L3FA 4EJVA 4A0YA 5DUKA 3KP6A 3K9TA 1IAWA 2OQRA 4A5MA 1W5SA 2TDXA 4O5VA 2RNJA 4HBLA 3FXQA 3WGGA 3CUQB 4L5IA 3HIFA 3I4PA 4MGRA 3IWZA 1QQIA 4Y15A 2H94A 1MDMB 2GXGA 4NHJA 2NYXA 3R0JA 3IRQA 2ZO4A 3WGIA 2EA2A 1I6XA 5LGUA 2M45A 4KYWA 1V3FA 1T2KA 4MEYF 4M9XA 4U0VA 4ZYEA 3RTRA 3N4MA 2IP2A 1LDKB 1U5TC 3GF2A 1KGSA 1G3SA 4ZYHA 2Z33A 2L54A 1IN5A 2M1BA 3DXJF 3ZN1A 2QZ8A 3ZMZA 2KIMA 1YW7A 3F8FA 3BPXA 1J75A 3KE2A 1OMIA 2K4BA 1PP7U 4IXAA 3R4KA 4BHBA 4XLNF 4AIKA 2O03A 4RAYA 1IXCA 4KB2A 4HX8A 5CYVA 2A68F 1XCBA 4ETSA 2HTSA 3WGHA 1ZHFA 2NAZA 2M30A 2J5PA 5ICGA 2KJBA 2HTJA 1IUYA 3SZPA 4R1HA 3BOQA 4P96A 4A12A 1XGMA 1XSXA 2KKOA 2MA3A 5BOXA 1GHCA 1HW5A 3B02A 2OZ6A 4A0XA 2DQRA 5LHIA 4G8XA 4Q48A 3TO6A 1QZZA 1ZG3A 3U1DA 4LK1F 3ISPA 2ZKZA 2YR2A 1Q1HA 5LEKA 4KA4A 3KCCA 4EM1A 4G94A 2DT5A 3SQNA 1A04A 2L01A 1S29A 2ACJA 3BP8A 1T0FA 1R23A 4ASNA 1UHMA 1ZARA 1T98A 1ODDA 1XDUA 1FP2A 2HKXA 1GXPA 4FT8A 1CF7A 3K2ZA 3TOBA 4Y13A 4O6JA 4HQMA 4RGXA 1ZRDA 4I09A 4UUVA 2XVCA 2IPQX 1I5ZA 2ADUA 3WTSC 3F6VA 5ICFA 2PBIA 1XCVA 1ON1A 1WSUA 2CSOA 2F5CA 3E6CC 3WTYC 2IA1A 5LGNA 3WTVC 3MMLB 1XSVA 3T0YA 2QM3A 2C6YA 5AIPA 4M73A 3WTTC 3O2PE 1FSHA 1B6AA 2STTA 1ZGJA 3CO7C 2HZTA 4A6DA 3TDUC 4GYGA 3FM5A 5HLGA 2QENA 1WIHA 4EGZA 1CGPA 3TQNA 1B1BA 4EMSA 4OOIA 1F4KA 1LQ1A 1L3LA 2YX4A 3JAMZ 3RIRA 3EYYA 4FX0A 3CUQC 1BI0A 3RI4A 5JI6A 3JSOA 2HDCA 3MAJA 3ABUA 3N97A 1H9GA 2QQAA 2NS0A 4WXCA 3JSPA 1MJ9A 4EM2A 5K5RA 1IN4A 2VBZA 1BJTA 3ECOA 3HOSA 1FLIA 1FP1D 2XAQA 3T1BA 3RKWA 4IHTA 2FEZA 3GFLA 4BHPA 1RNLA 3M9AA 2W25A 3IWFA 3WE3A 2Y3PA 1ZLJA 4FX4A 1MKMA 3IRRA 3ZQ7A 1J59A 4JK1X 4L9JA 3DPLC 2VOOA 1IRGA 3I59B 5AIQA 3NUHA 5IT9K 3OPFA 2K4JA 4K2EA 1ZGAA 3GWZA 4RS8A 5LGTA 4RGSA 1KYWA 2F5DA 2A69F 1P6RA 3D5LA 4MQ9F 4HV5A 2XIGA 5JFRA 1FT9A 3FMRA 4YFNF 1P2FA 2HOEA 4CZZA 3DQVC 3VA7A 2VBWA 1DPRA 2DW4A 1K7AA 2WTEA 4LMYA 1J5YA 1MJBA 2E1CA 2A3SA 4HDUA 4ESBA 4GCVA 1ZAOA 3KZYA 4L18B 2OD5A 2QBYB 3KLNA 2F5FA 5CJ9A 3DV8A 4I0AA 1W7PD 5L3EA 2PQ8A 3COAC 1DPUA 1QBJA 4L9VA 4DQ2A 4HF1A 4EQQA 4OMZA 5HDNA 3TO9A 4L0YB 3R6SA 2PLYA 3F21A 4MQVA 4WX9A 3DKWA 3KEQA 1YS6A 2CGPA 2QVOA 1SMYF 1OYWA 5ILSA 4P5OA 2XAHA 2GA1A 1OR7A 4JBAA 2HGCA 1EV7A 1LEAA 4AIJA 3ERED 1FBUA 3V7CA 2O8XA 2ZMEB 5D8KB 4M9SA 5E18F 2FA5A 3Q5FA 2IRFG 2PMHA 3L7WA 4B09A 2YX7A 5DD4A 1XGNA 4ZZLA 2XCQA 3HRMA 1IN6A 3ULQB 1IXRC 1LVAA 4CICA 1FPQA 1ZRCA 3LQRA 1USSA 2GZWA 2BV6A 2KRFA 3ML6A 1U5TB 1I1SA 5D5XB 4HLXA 1S3JA 4RGUA 5ILVA 2YU3A 4ZYGA 1KQ0A 1WI9A 4FHTA 2FSWA 3L2CA 2BYVE 1YS7A 3JW4A 2WC2A 2EB7A 2D2WA 4NQWA 2WWYA 1R5HA 3KEOA 1YTYA 5FLXZ 2P5VA 2P5MA 1GVJA 3SFZA 1BM9A 1IS1A 4DNCA 5HVQC 3ZMSA 4LG0A 2VBYA 4UVCA 2RKHA 3M8FA 1J7KA 3KP4A 4ENKA 1D8JA 2G9WA 1FC3A 1O7LA 4UV8A 1U6GA 4A0ZA 4MEXF 4LB5A 4LJZF 5DUIA 3V8LA 1I1GA 3K69A 1J9IA 3ZN0A 3OV8A 2V1DA 3ZP5A 1UHWA 3TDZC 1HKQA 4ESJA 2XASA 1WQHA 2FNPA 2EA4A 2FXAA 2UXXA 1F5TA 5E20A 5A2QK 1LNWA 3FOEA 3LA2A 1MZBA 2XV4S 4CGZA 2EFOA 2XAGA 2CYYA 2EFWA 3CDHA 4I2OA 1S8NA 1B9MA 1XGSA 1Y0UA 4AD9A 2IJLA 1EH8A 4RB1A 1ZH5A 5F6FA 1BBYA 1T38A 1AOYA 2XGXA 3K0LA 1K6OA 2Q8KA 2DFIA 4HOBA 3R60A 3BJ6A 5L3DA 4Q4ZF 4KNYA 2NNNA 1HW2A 5E17F 4RB2C 1J2XA 1D5VA 3V7RA 3EDPA 4BH9A 5D8LB 2VODA 4J3NA 2DBBA 2GA2A 2FBHA 4YIFA 4QLCU 1WWXA 1YW9A 3HSFA 5HOOA 2MH2A 5BMZA 4XBFA 3WU1B 1X3UA 5HS9A 2VN2A 1MD0A 2ESNA 1UFMA 2GWRA 4QWQA 2GQQA 4IPAA 4OIOF 5ERIA 3G3ZA 2EFQA 2FRHA 2LKPA 4H0EA 3W6KB 4HW0A 1H9TA 4WXDA 5CVUA 4XSXF 3LPXA 5CLSA 2NRAC 2UWMA 3DPTA 3RYPA 5L3BA 2ISZA 3C1DA 2WV0A 3EQLF 2JSCA 4P9FA 2VC1A 3RYRA 3EUHA 3L9FA 4U7BA 2ZCWA 2XKOA 4UXNA 3U2RA 4KC6A 1MJAA 1BIAA 5HLIA 2G7UA 4KN4X 4CXFA 1R58A 3F23A 1AWCA 4GYIA 1REPC 4N9HA 4CYDA 4YFKF 3JAMK 2W57A 5CVJA 4L9TA 3IKVA 4IRGA 2V6CA 2P5LC 5LEJA 4LD5A 4L0ZB 4BAYA 1ZN2A 1FYKA 3KP3A 1QPMA 3CUOA 2V79A 5ILUA 4N9IA 2Y75A 5LBQA 1FX7A 2A6HF 1OYYA 3LA3A 5DDGA 1SD7A 1UB9A 3MWMA 5FB2A 2QQ9A 1XMKA 5BPIA 3E3VA 5LRRA 2RGVA 3L4JA 3ZMDA 4Z2YA 4MTEA 4FM9A 4G6QA 1HSTA 3RKYA 3MZHA 1STZA 2VXZA 4HDVA 3FMSA 4HV6A 1P4AA 2QWWA 5LRSA 2M5WA 5DD8A 3NEUA 1Z1DA 2RV8A 2DLLA 1U8RA 2FMYA 1TLHB 1L0OC 4PDKA 2PFBA 1KA8A 3GXOA 2ELHA 3K1NA 3CLOA 3QU6A 2Y48A 1IF1A 3G73A 2V1UA 1XXBA 1W7PB 1S7OA 3WTWC 1RUNA 1IZ1A 2JRTA 4ESFA 3V7SA 4BNCA 4OINF 1WKMA 3GFJA 2DAOA 4MNUA 3E97A 5K1YA 1CF7B 4NB5A 5L3GA 2FBKA 3LA7A 4BQAA 1J0RA 2NNYA 3MZYA 5TRDA 3F3XA 3HTSB 2RQPA 1I27A 1Z6TA 2Q0OA 1V4RA 1EH7A 1G6NA 2JZYA 2HYFA 2VC0A 3E5XA 4KDPA 3BDDA 2M87A 5IT3A 1R1TA 4IRHA 1IRFA 1Z6RA 2BEOA 1S7AA 4OU0A 2P6TA 3FZVA 4A2UA 2L3DA 1FOKA 4OMYA 2E7XA 4KMFA 2HWVA 4Q47A 3TO7A 5FO5A 1TNTA 4B8XA 3L09A 1JGSA 4GFQA 1TW2A 5E1ZB 4ON0A 1P4XA 3I54A 3BJOA 2UXNA 3BY6A 1K78B 4MTDA 1ULYA 4BYYA 5DCMB 2QUFA 2ZNZA 2STWA 2O61A 3E6BA 2ZMEA 1LDDA 3GZ5A 1RZ4A 3M7GA 4M71A 2VBXA 2HQNA 3RKXA 5FGMA 2E1NA 3HRUA 2ZXJA 4KFCA 2XCOA 4CO8A 2W84A 3P9KA 2ETHA 4M9ZA 3M8EA 1S6LA 5H6RA 2EJRA 3MFKA 3HSEA 3LQQA 2E7WA 3F8NA 1BI2A 3LFKA 5FLXK 4JQFA 4I7HA 4AWXB 1YFHA 1KU7A 3J80K 1JHHA 4RB3C 2P7VB 3B73A 2H27A 5H20A 2LF7A 2QLZA 2EK5A 1XMAA 4IF4A 3V4GA 2JT1A 1ZREA 3VEPA 3BZ6A 4M6YA 1G4DA 4P55A 1O3QA 3DEUA 3K1MA 2GAUA 1LB2A 1FYLA 3BJAA 1KQ8A 3ZMTA 3SZTA 1LDJA 2FF4A 4RB0A 3ECHA 2LSOA 2IW5A 1WQFA 2GIVA 1O3TA 4PCQA 1E17A 3I5UA 3RJPA 2IA2A 3HOTA 5ICCA 3T5XA 3H3UA 1W4MA 1D3YA 3CTAA 4HF2A 5IT9Z 4WWCA 1SFXA 1W5TA 2ISYA 4U0YA 1JXSA 1G3WA 4ENMA 4F7ZA 2H6CA 2VE8A 3J81K 4G0UA 3SHFA 1TBXA 1ZRFA 4IHSA 5KK1A 3ELKA 3F8BA 4L5JA 4EJWA 5KVRA 1YW8A 4LLLA 3WTUC 1HKSA 4LB6B 1R5GA 3S2WA 2GXBA 3E6MA 1OYIA 2PEXA 4OIRF 3I53A 5D4RA 1E2XA 3QX3A 2A5YB 4U0WA 2H09A 1QZYA 1USTA 2YPRA 3C3WA 3QP5A 1F9NA 2HR3A 2P4WA 4U7DA 3C7JA 3H3ZA 2OBPA 3WODF 5JVTA 2DK8A 2X0LA 1HQCA 1XGOA 1P4WA 4M6XA 3DP7A 4OIQF 1HSJA 5K5QA 1FZPB 2BBYA 2DK5A 2D1HA 1Z91A 3BPVA 3U9GA 4G7HF 2O0YA 1XN7A 3IC7A 5DEQA 2XROA 1XDSA 3I0TA 2MC3A 2ZNYA 4YG2F 3GYHX 2HYGD 3BROA 3ZPLA 2EFPA 5HS7A 2XAFA 2VOPA 1Z05A 5DCFA 1JE8A 3FXRA 4WXHA 5LLQA 4DDQA 5HLHA 3FF5A 5HDGA 3FWEA 1Z7UA 2PMUA 4KIFA 2OQGA 4PZJA 4UHTA 2Z9OA 3OOPA 3CUQA 3GX4X 2XUBA 3BWGA 3R61A 2A6EF 1IXSB 4EM0B 3F6OA 1BGWA 5J6XA 2DI3A 1TQIA 1MDMA 5F1RA 2FE3A 2L4MA 1FSEA 2LDUA 5L3CA 4LFUA 4LG0B 3F8MA 4G7ZF 1B4AA 5CVRA 4BHCA 5F64A 3Q9SA 3IKTA 3EYIA 2BGCA 1YQAA 3HUGA 2FU4A 5DYMA 4HX4A 2XHKA 5JVOA 1G3YA 3I58A 1HBXG 3ZMVA 2V9VA 1PUEE 4CDGA 3QRFF 5FD6A 3FHZA 4ZYDA 2HEOA 3DFGA 1BI3A 3E5QA 2HQRA 4HYEA 1OKRA 2DTRA
chains in the Genus database with same CATH superfamily
5FFXA 4OIQA 2L9SA 3NRVA 1R6RA 3O3KA 3GTLJ 4KMDA 2KT0A 3IH3A 1DCHA 3CQZK 1X19A 3S1QJ 2ESHA 5TJJA 1H0MA 2FQ3A 3OL4A 3E1SA 2IGKA 4LOCA 3FMQA 4ZTFA 2XRNA 3HYIA 3R0AA 1XSDA 4G7OA 1IRZA 2YU9C 1BN5A 3HPGA 2W85A 1YO5C 2LG4A 4HX7A 1WJDA 1A31A 3WG7H 4C3JC 2EZIA 5D5UB 4BQQA 4M74A 2CJJA 2QGUA 2R7FA 1YOVB 2CQKA 2YU9J 1IN8A 1R1UA 4C3JJ 4FZBA 2W82A 2K7LA 2OAZA 4MFDA 3A8JA 2WV1A 2DXIA 2X1DA 3TFHA 3V8JA 4N0BA 2ECBA 3LAJA 4DOZA 2E2IC 3PFIA 4I01A 2LMDA 4UUTA 4HAMA 2F4OB 3T8RA 4UNOA 3F8CA 2YSRA 3PIPF 5A2QZ 3GTJC 3ROUA 1HXDA 3RQIA 4MHGA 4S0HB 2E2IJ 5E1WA 1CQTA 3GTJJ 3H0GK 1LVKA 4EJTA 3OYAA 4GTLA 1BW6A 2M8EA 2CG4A 2E19A 3P9CA 1ZQ1C 2L02A 2NVTC 3PQJA 4HZFA 3IAM2 1MW7A 1RC9A 4ZJZA 1FYMA 3LSIA 1GLNA 3LWFA 2I8DA 4E7HA 2F2EA 5C4JC 3WG9A 2NVTJ 3KETA 1BC8C 2A6EA 5IP7K 4PFPA 1FBQA 4R8HA 1FJLA 4B44A 3OOUA 3S0XA 3M4OK 3MKZA 2NOGA 3CJRB 1TWHC 3DF8A 3CQZA 4CA0A 5GTIC 3GTMK 5IYDK 4PJNA 5GPCA 5M5XK 1TL8A 1YITI 1TWHJ 4I98B 2VLAA 1WQGA 3EETA 3JCUC 5EEAA 4LGWA 4EGYA 1ZG1A 1DD5A 2BW3B 2HXIA 2DPUA 3ZQLA 4G7ZA 2A05A 1RI7A 3CCQI 2HPIA 2TCTA 1AKHB 1I50A 2I10A 3HOZC 4AIDA 6PAXA 3PQKA 1HF0A 2KWAA 2BY1A 3FM3A 2JQ7A 2VE9A 1BI1A 3HRSA 1SANA 2W4SA 3HOZJ 2IT0A 1XXAA 3HOXJ 3OIPA 3S17K 4XMYA 4ENNA 1VQPI 1EH1A 3JTGA 4OIPF 3HSRA 1E3HA 4U88A 3H0GA 3I64A 2Y0SL 1BR2A 2MLKA 3MKYB 2WADA 4G6DA 1FTZA 2R7XA 2EWNA 1DGWY 2FMLA 2EINH 2WY7Q 3MCZA 4A3FC 4KJZA 3G4AA 3I4NK 1LFUP 2CW0F 3CMYA 3TTGA 1N77A 3H3VK 4A3FJ 4LK0F 2ZJRF 1SFUA 2VQHA 3T8TA 4BDYA 1W7PA 1FOYA 2QEXI 5FKKA 4YRVA 2L7MP 2V1XA 2DMPA 5B1AH 2EZLA 1OPCA 2X6WA 2VIXA 4IVNA 5FFZA 1DP7P 2COBA 1FY7A 1WH5A 3DBLB 4ITVA 3V8KA 1ZR2A 1T39A 4GT9A 3GO5A 3CJNA 4BXFA 3D5SC 4A3BK 4D7NA 5M3MJ 2DQLA 2OZUA 3A2KA 4G9YA 1U3EM 3Q0WA 3DTEA 3S8PA 1G59A 2CWEA 2L9NA 3HOYK 2R5YA 3FKJA 3I9V2 2V6TA 2ELKA 3S1NK 2K9SA 1P92A 4I0BA 3HHHA 3GTGK 1BOBA 2EILH 3QPHA 5TISC 4BACA 4M3GA 2K5CA 3BG5A 1ZLKA 4Y4RA 2Z5UA 3OS1A 2CO5A 3P5JA 3H92A 5LFAA 1K79A 1LEBA 1QVTA 5M5WK 1JT0A 2LNBA 1RESA 2ZFZA 1S5LC 1QO0D 3FXUA 2ZXIA 1DDNA 2E35A 4HLYA 2V6SA 3HPHA 1IV8A 5K7HA 3DU6A 1POGA 3CMEI 1PDNC 4XSZF 1TTYA 3DKYA 4KITB 1R9TK 4UB8C 1QGPA 2OU2A 4X6AJ 5F0CA 4AVPA 2VONA 4OAYA 4J00A 2LBFA 4A3MK 1S72I 2JTVA 3VOEA 4C2UA 4CUGA 4C3IC 2P8TA 1MBHA 2X1CA 2MLGA 3HHGA 3D1NI 3CO6C 4HQEA 2Z2SB 3GEZA 4GO1A 4BBSK 5IY5H 2E2HK 3REOA 3IHUA 3QWLA 4U87A 4IOAF 1HI9A 4EV0A 5EDNA 4BXUA 3AAFA 1HC8A 4QIWD 1WHUA 3C2GA 4MIMA 2B0LA 4A5NA 2GLOA 1GT0C 2RVCA 4XLNA 2MG4A 3I59A 3RKQA 3JTHA 4BEHB 3Q3SA 3KP2A 5D5VB 4KAWX 3I71A 3W2VA 4DZJA 5HS8A 2PN6A 3FK7A 5HDKA 1R00A 3UKGA 1NH3A 5IOSA 3GTGA 5D6FA 3A03A 4M72A 5EEHA 5C3EC 2XCRB 2QQBA 4F93B 4N4NB 1VQMI 4CHUA 2BE5F 3GLXA 5DM7F 4A3CC 2EFNA 3SDBA 5C3EJ 3L4KA 3ZMUA 4WF2A 2E71A 1K78A 2X51A 3LSTA 1Z9CA 5DCMA 2W48A 4F92B 1MMDA 3FXMA 4OIPA 5DV5A 2R93C 2H8WA 3O8GA 2OTJI 3X2QH 1F1ZA 1R9TA 4IHYA 2O6GE 2DT6A 3D0SA 5LHHA 3MVPA 3DLAA 2R93J 3DTIA 3WU0A 5J1UA 3TKYA 4FCYA 5J8FA 1ZG5A 2QKMB 2KJCA 1BA5A 1JTXA 2DO7A 1XXCA 3RZOC 2QBYA 4G0WA 2CW0A 2K27A 1RR7A 2R92C 1WQ2A 2CFXA 1MMGA 2OV7A 4S04A 1K83K 3RZOJ 3Q9VA 4LK0A 2JVGA 1O3SA 2R92J 2E2HA 1D8KA 2K85A 4ABZA 2EV0A 3BTIA 3A01B 3LSRA 2ME6A 1TQMA 1N25A 4ZZDA 2PHCB 3DU5A 1JKPC 2EH3A 4RGRA 1JQWA 3KP5A 4RAZA 5BPDA 1BOAA 1AA7A 4EJUA 3Q3QA 5K5OA 2JA7C 2HS5A 2ZFWA 1T33A 4XLCA 3JR9A 3BT9A 3OYDA 1XB4A 5CVIA 2DPDA 2WB1L 2YS9A 1IW7F 1B8IA 2JA7J 2IA0A 1R7JA 2R7TA 3BQYA 1G8XA 3UNGC 2Q2EA 3QAHA 1JKQC 4A6EA 1LJ9A 3CF2A 2XAJA 1T6SA 2HKOA 1I3AA 2UUZA 5KCMA 2OA4A 1Y0NA 2GAGC 4XOPA 2PG4A 3O6BB 2PMZL 2XKPA 1IGNA 1Z3YA 1YX3A 2CUEA 2P6SA 4LG3A 2B63C 4XLPF 5AONA 3VYRB 2A6TA 1VRQC 4GZYA 2Y0SN 5JR3A 3MEXA 3QU3A 3KP7A 1XC5A 2DMQA 5FJ8K 2LF8A 4XSZA 2VT2A 1O7FA 1EH6A 1TC3C 1RETA 2K9LA 1WRJA 4B43A 3HTUA 4PK4A 1YLFA 1LFBA 4BKXA 5FRMA 4KDDA 2H1LA 4EJOA 1ORKA 3HRTA 1K83A 3TMOA 1PJ6A 4A3EC 1X2MA 3WTXC 2K86A 3OEPA 2LD5A 2NVXC 4IJAA 5E8IA 4BQNA 1S7EA 3CC4I 4V2GA 2FOWA 3DPUA 5EEGA 1R1VA 1KONA 3H36A 1WJEA 4A3EJ 1VZ0A 2NVXJ 5J47A 2DYSH 3S3MA 3GTPK 4Y17A 2MBFA 1OCRH 4RM3A 1UG0A 1HW1A 2RQQA 2XF7A 4Y7NJ 4E70A 3JRHA 4PJLA 2RGRA 1B72B 4ZH4F 3OYGA 3AL0B 1VI0A 1FWZA 1U5TA 4KN7X 4XQFA 3ABTA 1B4BA 2ZBKA 4KISA 1VJEA 2CFAB 4CZCA 1R36A 2OF7A 1GVDA 5J40A 1YYVA 3MQ0A 4AYBL 3DEEA 3HOWC 1FNNA 5H6QA 1GXQA 5E3MA 1X1PA 1BIBA 5E8GA 2Y0SA 3CCUI 2A07F 1ZYRF 4YFXF 1ISEA 1BJAA 3SXYA 1D1CA 2WAQD 3HOWJ 2RN7A 4ZC3A 1Z67A 2JPCA 1HDPA 1RUOA 2AHQA 5FKOA 1HKTA 2JK3A 1EK8A 2COMA 5E3LA 3K6GA 5ED4A 2KIFA 3HJEA 2GIZA 3L2RA 1TNSA 4PGGA 1DUXC 2R5ZB 3M1EA 5KNLA 1YIOA 4KUMA 1BL0A 3HOVK 2ZUEA 2R7DA 4ENJA 1ERDA 3S1MC 1GE9A 4ZDOA 2DU9A 3H9JA 2O3FA 4L9NA 4KT5C 1XD7A 2LTPA 4F91B 3RSNA 4UV9A 3WTZA 3K10A 4J19A 3G6EI 2V6EA 3S15J 2HFHA 4UY8I 3DCFA 4KN7A 3EUHC 4HF0A 1ON2A 1T8IA 5FRNA 1XZQB 2L7ZA 4KIGA 3FHNA 1Y1WC 3GTPA 4PJJA 4EVIA 2K40A 3H9GA 3CCJI 5D6EA 2F6CA 4CYCA 1Y1WJ 1DCOA 4IL6C 1VTNC 4KICA 1ZGWA 2DT7B 1OCTC 5BS6A 1I50C 4AH6A 3HKZD 5IOYA 1U2WA 1IW7A 2X4HA 2XSJC 1U8BA 2E1OA 1ZVUA 3BR5A 3BLYA 1DQUA 5IOQA 1J6WA 3CP2A 4UVAA 1ONVA 3GFIA 3FOFA 3J7ZI 3NQOA 1PJRA 1RIOH 2BZTA 2KHMA 3CJTB 3E6DA 3VB2A 2VQCA 4XKVA 2F4MB 2IVMA 4EEFG 3FX3A 2Q1ZB 4P9UA 2FQOA 1D1AA 2LH9A 1B59A 2ID3A 4BGDA 4XLPA 4A93K 3W6JB 1R4MB 1Z3XA 1NHAA 3GUDA 4OWRB 1K4TA 1SD6A 2FNAA 3P9IA 1YJNI 9ANTA 1JUPA 1DU0A 4KB4A 3S1RK 3AG4H 5D5WB 1SD4A 1N75A 4O3MA 1QZEA 5FD5A 5J4YA 1KU9A 2KIUA 2EV5A 3OSGA 2A61A 2MW8A 4KIBA 4CCKA 1K61A 3A0HC 1J98A 1KQ9A 2FJ1A 5D4SA 3RPQA 1LFPA 4AIHA 3QPTA 4WK8F 3JRFA 3P7NA 4B3XA 1AB4A 1KU3A 2ZJPF 2L4AA 1T95A 3CAGA 4I02A 4XKBA 3BUEA 1MGTA 2HOTA 1C0AA 4YIIA 2L0KA 4DGWB 5JLWA 2J5OA 1BC7C 3GSIA 3E5UA 2BY3A 1BR4A 2WB1N 3GVAA 3SEZA 3QOPA 4R79A 3N3YA 3ASNH 2V26A 2V9KA 1B9NA 3WE2A 1QHGA 1FBSA 4BXXC 4KARA 3K1PA 4HA8A 4ZH4A 3K4BA 3S14C 3KLOA 4E6KG 2E2JK 2X48A 1YG2A 3IUOA 4BXXJ 4BE2A 2MC4A 2PMZN 3BTCA 2R3SA 2KFDA 3S14J 3ADAC 4CCLA 2FOKA 2IS2A 3OYMA 1PP8F 2QYOA 2DA3A 4GGGA 2QKLB 4PGHA 1JGGA 3C18A 2OCEA 3J80Z 1EQRA 1ZYRA 2D1VA 4YFXA 1VQLI 2EV6A 1SC7A 4BLBA 4LLNA 4KMUX 1W1WE 4QJVB 4P9SA 2Z99A 3VYSB 1S9HA 2PJPA 2KISA 4G7OF 4C3HC 3VFZA 1SD5A 2XPWA 5KHDA 1O3RA 4IRIA 2D45A 5BQTA 5JHUA 1IC8A 3K4KA 2F4IA 3F72A 4C3HJ 1UCRA 5J8CA 1SAXA 4GTBA 3TOAA 2VT3A 2MD5A 2BVLA 5EGOB 1SFOC 5E1XA 4C2TA 3L00A 3B6CA 2F5EA 2VXDA 2PI0A 1RU0A 1R22A 2AS5F 3BG6A 4V2FA 3EUKL 5CVVA 3CCLI 2JA8C 3PIOF 1SFOJ 1O57A 2P0WA 1TQPA 2JPBA 2JN6A 4D0PA 1DU6A 2WB1A 4A3BC 5GADJ 2ZJ2A 1U78A 2JA8J 2ID6A 2CV2A 4AUXA 1SMTA 1UAAA 2Z3YA 2JA5J 1Y1VK 2UV1A 4G0VA 1SFEA 2H6BA 3RPUA 2PMZA 2AXLA 1YE9A 1M1EB 2L9VA 4AYBN 3GW2A 4KMUA 4GXOA 1JKOC 2W7NA 4Y52J 3J7AO 4XLFA 4Y33A 5LHGA 1K6YA 4H4KC 4NQWB 3K7AK 4RMFA 1KU2A 5HLTA 2CQQA 4XRFA 2VKEA 4UVBA 3S3NA 4MLOA 1L0WA 2JUCA 2XDVA 3FK6A 3F22A 4Q5SF 3HZJA 2O5IA 4I76A 3J81Z 1KZHA 4LR2A 1XZPA 2X6XA 2ZSHB 4S05A 3OREA 3SYTA 2MH9A 4G6TB 1D0YA 3U21A 3GTOC 3M3YK 3GFMA 1JHFA 1EI6A 1IN7A 4A3IC 2LREA 2P5KA 1G3TA 2G7HA 3QP6A 3GTOJ 2W24A 3IL2A 5ICEA 1I3QC 2FBIA 3RDIA 4A3IJ 4O2DA 2VI6A 5IYBJ 3OSFA 2Y0MA 4XIDA 2IBDA 3BCAA 1QNTA 4HSTA 3VODA 2K02A 3K4MA 4UUSB 1I3QJ 1GUUA 1C0WA 4LLGF 3KZZA 3J7YJ 3LAPA 1WSRA 3L2WA 4NC6A 4QPQA 1X4OA 3FDYA 2P7CB 1D5YA 1J6VA 2WAEA 2RDPA 3V42A 1IO2A 4FTHA 3KFWX 3IV5A 1KYZA 2RC4A 5HODA 4W97A 1Y1VA 3RQ4A 1Z7LA 3PL8A 2UZKA 3S2HC 2VJ4A 3RCOA 4AYBA 1XPXA 2GM4A 1SEUA 3PSIA 3TGNA 3FBNB 1W5CC 3S2HJ 1TW3A 2O7OA 3GZNB 1ZKGA 2PA8D 2L2OA 3QPLA 1FIAA 1HQMA 4TV7A 3SZYA 3HB9A 5M3FK 5CQEA 2MYSA 3GZ6A 3F0CA 4WCGA 1YX5A 5L3FA 4EJVA 1NK3P 3HL2A 3GDZA 2X6YA 2BW3A 4A0YA 3GTQC 5DUKA 3KP6A 2OJED 3K9TA 1IAWA 2XB5A 2OQRA 2ZMEC 3S2DK 4A5MA 1W5SA 2VJJA 2TDXA 4O5VA 2RNJA 3GTQJ 1LPQA 4HBLA 5IP9C 3FXQA 3S15K 3WGGA 3CUQB 4QPOA 1HOMA 3T02A 2XPVA 4L5IA 1WOPA 3JRAA 2VKHA 3HIFA 5IP9J 3I4PA 1YRNB 4MGRA 1PUFA 3IWZA 1QQIA 4Y15A 4DYCA 2H94A 1MDMB 2GXGA 4NHJA 2NYXA 3R0JA 2R7ZC 3IRQA 2ZO4A 3WGIA 4B3AA 2OCCH 2CUJA 2QSFX 2EA2A 3HBLA 4FE4A 1I6XA 5LGUA 2R7ZJ 2M45A 4KYWA 3QPSA 1V3FA 1IJWC 1T2KA 4MEYF 1Z21A 4M9XA 4U0VA 4ZYEA 3IH2A 3RTRA 3N4MA 2IP2A 1LDKB 1AHDP 1U5TC 5J4VA 3SJMA 3HOUK 3JRGA 5GAGJ 2EPFA 3GF2A 1FOWA 1KGSA 1G3SA 4ZYHA 2Z33A 1A5JA 2L54A 1IN5A 2M1BA 3DXJF 3ZN1A 1WJCA 1IDYA 2QZ8A 3ZMZA 4F3QA 1VQOI 3QODA 2VB6A 5C4JJ 4RDUA 2KIMA 1YW7A 3F8FA 3BPXA 4D7MA 4MO7A 1J75A 1P7JA 2XF5A 3KE2A 3RZDK 1OMIA 3TW6A 2K4BA 1PP7U 5C4XK 4IXAA 4HRIA 3M07A 5CPRB 4Q5SA 3KEYA 2XC7A 3R4KA 4BHBA 3MKLA 4XLNF 2HQ5A 4X1EA 4QSHA 2O03A 4AIKA 4RAYA 1MSFC 1IXCA 5M5YK 1ZXOA 4KB2A 4HX8A 5CYVA 2NVQK 2A68F 2NS8A 3FXLA 4RLQA 1XCBA 4ETSA 2FX0A 2HTSA 3HXLA 3WGHA 5HNFA 1ACIA 5IPAA 1ZHFA 2NAZA 4KM9A 2M30A 3JRIA 2J5PA 5ICGA 2KJBA 3ABMH 2HTJA 1IUYA 3SZPA 4R1HA 3BOQA 4P96A 4LLGA 2RAEA 4A12A 1XGMA 1XSXA 2IS1A 5FLMK 4HEA2 2KKOA 2MA3A 5BOXA 1GHCA 1HW5A 2BOLA 4JX5A 3B02A 2OZ6A 2JUGA 4A0XA 4E7SA 4M3EA 3S32A 2DQRA 1TWAK 2LR8A 2BHZA 5LHIA 3LNQA 3CMAI 4G8XA 4Q48A 3TO6A 4A3DC 1QZZA 4PSWA 3CESA 2VUMK 1ZG3A 3PNYA 3U1DA 4Q4ZA 1MBFA 4PSXA 1TP4A 3OR1C 1TWFK 5HNHA 2CW7A 3GEHA 4LK1F 4A3DJ 3ISPA 2ZKZA 2YR2A 5K7FA 1Q1HA 1WI3A 2R7OA 4DYQA 5LEKA 3OYEA 4KA4A 3A0BC 3KCCA 4EM1A 4G94A 1J6XA 1TWGK 1ZELA 2DT5A 2K9NA 3G2BA 1A04A 1Z0XA 2L01A 3SQNA 4CCJA 1S29A 4M1XA 1YNJA 3PO3K 3GTMA 2ACJA 3BP8A 1T0FA 1R23A 1MBGA 4ASNA 3UR3C 1UHMA 1JOEA 3QYBA 1ZARA 1T98A 4M3FA 1FOXA 4BBRC 1SFKA 2M7AA 4LQYA 1ODDA 1JKRC 3CJQB 3BCBA 1XDUA 4JYKA 1I6VA 1FP2A 2HKXA 3ABLH 1HCRA 2DOAA 1GXPA 2XSDC 4BBRJ 2QA4I 4FT8A 1K4SA 1CF7A 2DA6A 3MKWB 3IAS2 2PJRA 1P7IA 3K2ZA 4IOCF 3T01A 3TOBA 2DYRH 4Y13A 3L2VA 2JA5K 4A3LK 2DJNA 4O6JA 4IZZA 3NAUA 1INNA 1RPWA 3LMMA 4HQMA 2ZSIB 4RGXA 5J1YA 3W2AA 5JLXA 4AVZA 1ZRDA 4I09A 4UUVA 4C2MK 2XVCA 2EBBA 2IPQX 4MEYA 1A6QA 1TWAA 1I5ZA 3KPHA 2ADUA 3WTSC 2K9QA 3F6VA 5ICFA 1WCMC 2PBIA 3U1KA 2VUMA 1XCVA 1ON1A 3H35A 1WSUA 2CSOA 2F5CA 3CDIA 1O28A 1TWFA 1MBJA 3E6CC 4D5CA 3I4MC 1WCMJ 3TP3A 3DXJA 2O9LA 3KIOA 2IA1A 3WTYC 4C3IJ 4DW6A 3I4MJ 5LGNA 3WTVC 3MMLB 1XSVA 3T0YA 1TWGA 5FKNA 2QM3A 2NVYK 4BY1K 1XG1A 2C6YA 5AIPA 4E7ZA 4M73A 3WTTC 3O2PE 5IYBK 5C44C 2XF6A 1OQYA 1JT6A 3LFUA 1FSHA 2LK2A 4M3DA 1B6AA 2A68A 2STTA 2KRHA 5C44J 1MBKA 3BR2A 1ZGJA 4BKWA 3CO7C 4CSWA 2HZTA 4A6DA 2E34A 3TDUC 5E3NA 2LP0A 4GYGA 3EQLA 4I99C 4P5AA 5IORA 3K2AA 5E68A 3FM5A 5HLGA 2QENA 1WIHA 4D9JA 3OY9A 4EGZA 1CGPA 3TQNA 1B1BA 2CUZA 4EMSA 2M4KA 3AH5A 4OOIA 1F4KA 4A3CJ 1LQ1A 4HNTA 5L46A 1I6HK 2H1KA 2CQXA 2HVRA 1L3LA 4BY7K 2YX4A 3JAMZ 3RIRA 3CCVI 2R5YB 4WILA 3EYYA 4YEJA 1IRXA 3K4JA 4FX0A 1O27A 1PJ5A 3CUQC 1SVMA 3VSKA 4GTEA 2V6UA 5EGEA 1BI0A 1VQ4I 3RI4A 1GDTA 3GTLK 5JI6A 3JSOA 2HDCA 3MAJA 1TWCC 3ABUA 3N97A 4LK1A 3S1QK 1H9GA 2QQAA 2LKSA 2MSYA 4HSRA 3LSMA 1X58A 4CCMA 2NS0A 4WXCA 1TWCJ 3JSPA 1MJ9A 3FKIC 4EM2A 2FUG2 5K5RA 2NVYA 1IN4A 2VBZA 3A1YA 3ECOA 3I56I 1BJTA 2AQFA 1ZR4A 3JRDA 3HOSA 1H89C 4XM3A 3OYIA 1FLIA 3FKIJ 1FP1D 2Z16A 3W2WA 2YU9K 2XAQA 3T1BA 2O5JA 3RKWA 4IHTA 4C3JK 4GTAA 2FEZA 3GFLA 2O8KA 1XS9A 2G0EA 2DMUA 3DKXA 1Y8QB 4A3JC 4A3KC 2B7EA 2GXAA 2EZKA 4BHPA 4RM2A 1UV7A 2IEKA 4IHWA 1O2BA 1RNLA 3M9AA 2W25A 4A3JJ 2PPBA 3S93A 4A3KJ 3IWFA 2RNGA 4XRSG 4A3GC 3WE3A 2E2IK 2Y3PA 1ZLJA 3GTJK 3ESWB 4NBQA 4FX4A 1MKMA 3IRRA 4A3GJ 2BY2A 5CQGA 3ZQ7A 1J59A 1JJ8C 2MGQA 4JK1X 3ZQHA 1O24A 4L9JA 3DPLC 2VOOA 2R5ZA 1IRGA 3G4SI 3I59B 5AIQA 2B63J 3NUHA 3TL4X 5IT9K 2BXYA 4PAAA 3S16C 3OPFA 2K4JA 4K2EA 2NVTK 1ZGAA 3GTKC 3GWZA 4RS8A 5LGTA 4RGSA 1KYWA 3K70D 3S16J 3F9KA 3SZGA 5FKLA 2F5DA 3GTLA 1VQ7I 2A69F 2LRDA 1P6RA 3GTKJ 3D5LA 2JA6C 4MQ9F 4HV5A 2XIGA 5JFRA 3PUFA 5DS9A 1FT9A 3FMRA 4YFNF 2JA6J 1P2FA 1TWHK 2HOEA 4DZPA 4CZZA 3SEQA 1Z77A 3DQVC 3AG1H 2M9HA 3VA7A 2VBWA 3M8JA 1DPRA 2DDBA 4LOWA 2DW4A 4XONA 1AU7A 2HOAA 1K7AA 2YU9A 2WTEA 2X6OA 4ZTJA 4LMYA 2GOMA 1J5YA 1WPKA 1MJBA 5J3LA 3N0CA 5IYCC 2E1CA 2A3SA 4HDUA 3LOCA 3HGYA 4GCVA 1ZAOA 4ESBA 1F43A 2NVUB 3PNVA 3KZYA 4CH7A 4L18B 3HOZK 2OD5A 2QBYB 3KLNA 4JK1A 4HG2A 3HOXK 3CCEI 5IYCJ 1QHHD 2F5FA 5CJ9A 3DV8A 4I0AA 1W7PD 3K4NA 5EJCA 3OS2A 2M3AA 5TMFA 5L3EA 1UELB 2PQ8A 2L5QA 3PO2C 3LSKA 3COAC 1DPUA 2E2IA 1QBJA 4L9VA 1V5VA 4DQ2A 3A8KA 1WJ5A 2D6FC 3GTJA 4HF1A 3QYFA 4EQQA 4OMZA 5HDNA 2KRCA 3TO9A 4HPQA 4L0YB 3R6SA 2PLYA 1D0ZA 4II3A 1WZ2A 3F21A 1RR8C 3L2UA 4MQVA 3AD9C 4IEJA 4WX9A 4A3FK 1A36A 4QIWL 3DKWA 3KEQA 1YS6A 4F52A 2CGPA 2QVOA 1SMYF 3AQPA 4N4OB 3H0DA 1OYWA 5ILSA 4P5OA 2HVSA 2O5RA 2XAHA 2GA1A 1OR7A 4JBAA 2HGCA 1EV7A 2EIKH 2LKXA 1VH2A 1LEAA 3S1MJ 1YNNA 4AIJA 5M3MK 2HU9A 1TWHA 3ERED 1FBUA 3CQZC 3WHCA 3V7CA 2F5VA 2O8XA 3TP0A 3VDXA 2WBMA 3ABKH 3CQZJ 1VLOA 4FE7A 1IV6A 1A35A 2ZMEB 5D8KB 2CV1A 4M9SA 5E18F 4FISA 2FA5A 3L2QA 3Q5FA 2IRFG 5JHFA 3H3VD 2PMHA 2HOSA 3L7WA 4B09A 2YX7A 2E5ZA 3K70C 5DD4A 1I50J 1XGNA 2GOXB 1WOSA 4ZZLA 2LYCA 4GTFA 3G1MA 2XCQA 3HRMA 3FXJA 4DBQA 1IN6A 1DCPA 2WAFA 3ULQB 1IXRC 5EG0B 1LVAA 1NK2P 4CICA 1ZBSA 1EJ9A 3H0GC 4X6AK 1FPQA 1ZRCA 4ZDLA 3LQRA 4XN0A 1USSA 1F7UA 2GZWA 2BV6A 4E4HA 3BR0A 3H0GJ 2KRFA 3BR3A 5JVGF 3ML6A 1YJ9I 5TMCA 1U5TB 1I1SA 5D5XB 4HLXA 1S3JA 4RGUA 3DEWA 3PUBA 1ETWA 5ILVA 2ELJA 1XMXA 2D5VA 5IP7C 1FTTA 2A69A 3BG9A 2ZXWH 4MQ9A 3GCMA 2YU3A 2WA0A 3M4OC 4ZYGA 1KQ0A 5IP7J 3GTMC 1WI9A 4YFNA 5IYDC 3TBIA 4P1WA 4FHTA 2VPRA 2DCEA 2FSWA 3L2CA 1XTAA 3H5NA 2BYVE 5IYDJ 1YS7A 5M5XJ 3JW4A 4BJ6C 1V5FA 2WC2A 2EB7A 4LIUA 1APLC 2R0QC 1DP3A 1UG2A 5C3EK 2LY9A 5FROA 1ITYA 2D2WA 4NQWA 2WWYA 2DA2A 1R5HA 4A3CK 3KEOA 3SFIA 4XOTA 1YTYA 4ANJA 5FLXZ 3S17C 2M8GX 3GEIA 2P5VA 2P5MA 1GVJA 3SFZA 1O2AA 3TFIA 1BM9A 4AM3A 2FD5A 1IS1A 5CKTA 4DNCA 5HVQC 3S17J 3ZMSA 4LG0A 2VBYA 1OFCX 4NC8A 4UVCA 5KAIC 2R93K 2W1OA 2RKHA 3M8FA 3DLLF 2GSUA 2DJIA 3GIRA 1J7KA 2X9DA 4PUSA 4AU7A 4CYCB 2ZC2A 3KP4A 4ENKA 2Y30A 1D8JA 1OCOH 1R49A 2CH0A 2G9WA 1FC3A 1USMA 3I4NC 1O7LA 1MNMC 4UV8A 3AD8C 3RZOK 1TWFC 1U6GA 2R7UA 4A0ZA 4MEXF 3KYCB 4LB5A 1IQ0A 1SMYA 4LJZF 5DUIA 4KMAA 2R92K 3OWTA 3V8LA 3I4NJ 2R7VA 1I1GA 1X3WB 1MMAA 2VJ5A 2MABA 3K69A 3OR2C 5BNGA 2ZFUA 1J9IA 1ETYA 3ZN0A 3OV8A 4EATA 2V1DA 3ZP5A 1UHWA 1W36C 3CMMA 3TDZC 1WH7A 2ICWG 2JA7K 1HKQA 4ESJA 4A3BJ 3HOYC 2XASA 5F27A 1WQHA 5FKMA 3GBGA 2FNPA 3W3CA 3ZQCA 2WAQL 3S1NC 2EA4A 2FXAA 2UXXA 1F5TA 3CDLA 3HOYJ 3GTGC 2TRTA 1NG7A 5E20A 5EZHA 3A8IA 5A2QK 4RAGA 3S1NJ 4E7LA 1VQ8I 3VYTB 3GTGJ 3JSTA 1LNWA 3FOEA 3NWTA 3LA2A 3HDDA 1MZBA 2XV4S 3DBHB 1YHQI 2GSOA 4CGZA 2JH3A 2EFOA 2XAGA 2CYYA 2EFWA 3CDHA 5M5WJ 1IDZA 4I2OA 1S8NA 2R93A 1B9MA 3CZ6A 1XGSA 1Y0UA 1LKXA 1R9TC 3WHBA 3FXOA 3D5RC 3NWSA 4AD9A 1R9TJ 2DOEA 4A3MC 1YRNA 2IJLA 2R92A 1EH8A 3TFJA 1MSEC 5GAHJ 4A3MJ 1ETVA 4RB1A 4A3EK 2Y0SD 1ZH5A 5F6FA 2NVXK 4BBSC 2M0MA 2E2HC 3HKZL 1U9NA 2JRMA 2R7WA 2DFEA 1BBYA 2K3PA 1FMWA 1T38A 2XGXA 4BBSJ 1AOYA 4Y7NK 3K0LA 2JJ7A 3PFYA 1K6OA 2E2HJ 2Q8KA 2W7VA 2DFIA 2JA7A 1HA8A 4HOBA 3R60A 3BJ6A 2V9PA 2BHYA 5L3DA 2ME0A 4NNJA 3DBRB 5F1JA 2CQNA 4Q4ZF 4KNYA 4W1UA 2R7RA 2L7FP 2NNNA 1NG6A 1QVUA 4XCHA 1HW2A 5E17F 3TW7A 2DODA 3HOWK 3CC7I 1MIJA 2DTZA 2IXSA 2JMWA 5F08A 4HNVA 4E7IA 3A02A 4M6VA 2OTLI 3IPJA 4RB2C 1J2XA 1D5VA 3V7RA 3EDPA 1OCPA 3CCSI 3BZCA 2DMNA 4BH9A 4IHVA 2H8RA 3WODA 5D8LB 1FMVA 1YIJI 3BP3A 3A4CA 2EBIA 2VODA 2KZGA 2HVQA 4J3NA 2DBBA 3BG3A 2GA2A 3HGGA 1AKHA 3OYFA 5F0HA 3BQZA 2FBHA 1YCLA 4YIFA 4QLCU 4F55A 4XNFA 1WWXA 3GTLC 4C45A 1OLTA 3S1MK 1YW9A 5IP6A 3S1QC 4MEXA 1K83C 4LJZA 2KZVA 2NVXA 1LE8B 3HSFA 4B4CA 5HOOA 4D1QA 1K83J 2KQRA 2MH2A 2KP6A 5BMZA 2ZUFA 4XBFA 1Y1WK 3DTKA 3WU1B 2DDAA 1X3UA 5HS9A 3G4CA 1XZPB 4DIQA 3OIOA 2VN2A 1MD0A 2Z1DA 1I50K 2QF7A 2XB0X 2ESNA 4XR6A 3H5RA 1X31C 4G7HA 1UFMA 5DTDA 2GWRA 3Q0VA 1R5ID 4QWQA 2XGEA 3HUGB 2GQQA 3KZIC 4XLEA 4IPAA 4YG2A 4DJAA 2E5NA 5K7ZA 4OIOF 4P5BA 4JOMA 5ERIA 3G3ZA 2EFQA 2FRHA 2LKPA 4RAFA 4H0EA 3OIQA 1VF9A 3HXAA 4MFEA 2HDDA 3W6KB 3KYDB 5DM6F 3PSFA 4HW0A 4FASD 1H9TA 3ASOH 4WXDA 1ZK8A 3BG7A 5CVUA 3L1PA 2JA2A 4XSXF 5FJ8J 3LPXA 5CLSA 2NRAC 2UWMA 3AQOA 1OR7C 3DPTA 3RYPA 5L3BA 2ISZA 3G1OA 1O2FB 3C1DA 2WV0A 3EQLF 2JSCA 4P9FA 1UHSA 2VC1A 3RYRA 4ZYAA 3EUHA 3L9FA 4KASA 5F04A 2GAHC 4U7BA 2L9RA 2ZCWA 2XKOA 4UXNA 3GTPC 1Y1WA 3HC7A 2HPMA 2MD0A 2DN0A 2NXNB 3BTLA 2YUSA 3DWLE 3U2RA 3GEEA 1X1CA 4KC6A 3GTPJ 2WAQN 1MJAA 1YI2I 1BIAA 2FQTA 4BXXK 5HLIA 3SZZA 2G7UA 2LY1A 4KN4X 3S14K 3HOXC 4CXFA 4WJ3M 1R58A 3F23A 1AWCA 4GYIA 3H5AA 3ERMA 1REPC 4N9HA 3MZ8A 1HDDC 3VYUB 4IHXA 4CYDA 1PUFB 3AG2H 4YFKF 2WB1D 2CRGA 3JAMK 1WJAA 3FISA 1WOOA 2W57A 5CVJA 1HLVA 4L9TA 1NTCA 1TT0A 2HQAA 3IKVA 4IRGA 3CF5F 4PJMA 1W0UA 4XLHA 1U9OA 3AKZA 2V6CA 2P5LC 2DA1A 4BEHA 5LEJA 4C3HK 1D0XA 4LD5A 3RPUD 2PMZD 4L0ZB 4BAYA 1ZN2A 1FYKA 4RA2A 3HOVC 3KP3A 1QPMA 1VQ6I 2VASA 3CUOA 2V79A 5ILUA 1PYVA 1ETQA 3CLQA 4N9IA 4XORA 1SFOK 2XGDA 3HOVJ 3NARA 1P9QC 2Y75A 3HKZN 3OYNA 5LBQA 5B5EC 1FX7A 2JA8K 1IG7A 4BL0B 1V5EA 2A6HF 1ETOA 1OYYA 3LA3A 3LSHA 1J09A 4KN4A 4XN3A 4LIVA 4B48A 2VKDA 5DDGA 2PA8L 2Y31A 2WAQA 1SD7A 2DA5A 4DYRA 1R71A 1E3OC 1UB9A 3MWMA 5FB2A 2QQ9A 4BS9A 1PVEA 2EZHA 1XMKA 2V4JC 3E3VA 1EA3A 1D1BA 5BPIA 3W6VA 5LRRA 2RGVA 2XGCA 3L4JA 4Y52K 3ZMDA 4Z2YA 4MTEA 3VSLA 4C9YA 4FM9A 5TGTA 4G6QA 1HSTA 2IGNA 3RKYA 3BC8A 3MZHA 4BU2A 1STZA 2VXZA 1VQ5I 4HDVA 2DA7A 3FMSA 4HV6A 1BR1A 1P4AA 2QWWA 5LRSA 2M5WA 3A01A 4NC7A 1A6IA 5DD8A 3NEUA 1Z1DA 1VQKI 2RV8A 3ONQA 2VQLA 2DLLA 1JJ6C 1U8RA 2DMTA 4OIOA 4X6AC 3OYBA 1G2HA 2FMYA 4XLAA 3QYEA 1TLHB 4A93C 3H9QA 1L0OC 4PDKA 3GTOK 1OISA 2PFBA 5EF6A 1KA8A 3I55I 4AYBD 4HNUA 4A93J 3GXOA 2ELHA 3S1RC 4A3IK 2A5WA 4FETA 3K1NA 3HKZA 3CLOA 3KX2A 4OAZA 3QU6A 4XSXA 3S1RJ 3LL7A 4II2A 2Y48A 1I3QK 3E7LA 4RMNA 1IF1A 1SFOA 3G73A 3HG9A 3O8HA 4PJ0C 2V1UA 3ZQGA 1XXBA 4Y3OA 2DFHA 1T56A 5CHPA 3T00A 1W7PB 3EUAA 1UMQA 2CS3A 2OUMA 2KDOA 1S7OA 1GV5A 2LOOA 3WTWC 1RUNA 2JA5A 3OS0A 1IZ1A 2JRTA 4ESFA 3V7SA 1UJ8A 2M7BA 1VGXA 3JRCA 4BNCA 2E1MB 4OINF 3S2HK 1WKMA 1R4NB 4B47A 3ZR8X 2CW8A 2CMPA 3QOEA 2KMUA 3GFJA 4XKCA 2DAOA 2E2JC 4MNUA 5JFEA 2M4GA 3E97A 5K1YA 1CF7B 2E2JJ 1T08B 4NB5A 5L3GA 1IUFA 2PJRB 4PFOA 2FBKA 3LA7A 4BQAA 2QQ8A 1J0RA 2AQEA 5GTHC 2ZJQF 2CU7A 4YFKA 2EIMH 2NNYA 2L7KA 3MZYA 3MN2A 4G12A 5TRDA 2HI3A 3F3XA 5GP9A 1MBEA 1TT5B 5EYRA 4IX7A 3GTQK 3GTOA 1F7VA 2JWTA 3HTSB 1B72A 2EQRA 3OYKA 2IGOA 3CCYA 3OYJA 1VQNI 2RQPA 1JTYA 1I27A 1Z6TA 5IP9K 2Q0OA 2CFAA 1I3QA 2JVHA 1W0TA 1V4RA 2LBFB 4NOIA 3PJRA 1EH7A 2KIQA 4IO9F 1G6NA 3SDGA 2JZYA 2HYFA 2VC0A 2VKVA 1WJFA 2XRLA 2R7ZK 3E5XA 4XL9A 4KDPA 2A6HA 3BDDA 2M87A 5IT3A 4V19K 2AO9A 2M34A 1R1TA 4IRHA 1QRYA 1IRFA 1Z6RA 2BEOA 4BUPA 1ZQ3P 1S7AA 3CD6I 4CCOA 4OU0A 1RKTA 2P6TA 3FZVA 2OC6A 4GRIA 4A2UA 2L3DA 1Y1VC 2HZDA 4YELA 1FOKA 4OMYA 1O4XA 2E7XA 4ZDPA 1GV2A 1BJZA 2HWVA 4Q47A 4KMFA 5HL8A 1WORA 1N78A 1Y1VJ 3TO7A 4KMHA 5FO5A 5C4JK 1TNTA 3QQAA 3WU2C 4B8XA 3L09A 3BTJA 1JGSA 1I39A 2LY2A 3K7AC 1RRJA 1MNDA 4GFQA 1TW2A 5E1ZB 2R7QA 4ON0A 4BJTA 1XZQA 1P4XA 3I54A 3BJOA 1KQ4A 3K7AJ 2UXNA 3BY6A 4XK4A 1K78B 4D5FA 4MTDA 2K3FA 1JUSA 1UZCA 1ULYA 4BYYA 5DCMB 1F36A 2M0CA 2QUFA 3B6AA 3GTQA 2ZNZA 3ZQIA 2STWA 1V54H 3VWBA 2O61A 5EGHA 3LSGA 3M3YC 3E6BA 2ZMEA 2NOJB 2R4GA 1LDDA 2GSNA 3GZ5A 3M3YJ 3BZKA 1RZ4A 1Y8RB 3M7GA 4BE1A 2V1NA 4E7JA 4M71A 2VBXA 2W00A 3FBIB 2HQNA 2NS7A 1LUJB 3RKXA 3C2HA 3CCMI 1X1DA 1Y39A 4C30A 5FGMA 3G71I 2Y9ZA 2E1NA 3HRUA 2ZXJA 4KFCA 2XCOA 2R7ZA 4CO8A 3CP8A 5EG0A 2W84A 3P9KA 4Y7NC 2ETHA 4M9ZA 2MFZA 3M8EA 2Y69H 3HM5A 3PO2J 2EIJH 3CCRI 4GTCA 1S6LA 5H6RA 2EJRA 3MD2A 5LD2C 3MFKA 3HSEA 3LQQA 1O25A 3Q0UA 1MNEA 4OINA 2E7WA 3F8NA 1BI2A 2DA4A 3LFKA 3G1LA 5FLXK 4GTDA 4JQFA 4BDZA 1YJWI 4A3DK 4I7HA 4XICA 1WGXA 4AWXB 1B8IB 4A69C 3C2BA 1YFHA 5B3SH 2CUFA 1KU7A 3J80K 2QCOA 2BE5A 2IGMA 2HNHA 1JHHA 2Q2EB 4RB3C 2P7VB 2I5UA 1H8AC 3B73A 2E60A 2H27A 3M1CA 5H20A 2IS4A 4BJ5C 2LF7A 2R7SA 5M3FJ 2QLZA 1PJ7A 4BE0A 1OJLA 2EK5A 1XMAA 4IF4A 3V4GA 2JT1A 1ZREA 3VEPA 3BZ6A 3S2DC 4BBRK 1F93A 4M6YA 1O29A 1IE0A 3JRBA 1G4DA 4P55A 1O3QA 3DEUA 1FIPA 3K1MA 2GAUA 1LB2A 4AC0A 2B9SA 1FYLA 3S2DJ 3S15C 3BJAA 3ZGKA 2N8GA 1KQ8A 2E36A 3ZMTA 3SZTA 1LDJA 2FF4A 4RB0A 3ECHA 2K9MA 1E0EA 2LSOA 4RLFA 2IW5A 1WQFA 2GIVA 3BR1A 2VJIA 1QA6A 1XX5A 1O3TA 4PCQA 1VQ9I 3HEFA 1E17A 1TZLA 2VQGA 3I5UA 4QJVA 3RJPA 2IA2A 3HOTA 2GBYA 5ICCA 1W36D 2RREA 5F0FA 3OYHA 3T5XA 5IOTA 2HYJA 3H3UA 1W4MA 4J01A 1G51A 2Y9YA 1D3YA 1VNDA 3CTAA 3HOUC 3EPZA 4HF2A 1WFXA 1Y6IA 2CV0A 1WCMK 4L5EA 1Y56A 5EGOA 2KDZA 5IT9Z 4WWCA 1SFXA 5H2FC 1E3PA 1W5TA 5KAFC 3HOUJ 2ISYA 4U0YA 1JXSA 4C3IK 3I4MK 1G3WA 4JP0A 4ENMA 4F7ZA 4IQ4A 2H6CA 2VE8A 1MH4A 3J81K 4G0UA 4KT6A 3SHFA 1X4PA 1TBXA 3RZDC 4BLAA 1ZRFA 4IHSA 3IP4B 5KK1A 5C4XC 3ELKA 3F8BA 2IS6A 4L5JA 4EJWA 2Y2ZA 2BY0A 2OPTA 5KVRA 1YW8A 3RZDJ 1T0FC 4LLLA 3M4OJ 1O26A 3BP8C 2E1MC 5C4XJ 1IBAA 3WTUC 3N0BA 1HKSA 3GTMJ 4LB6B 5C44K 2NVQC 4XRMA 1R5GA 5M5YJ 2KPMA 3S2WA 2GXBA 3ZXSA 3E6MA 1OYIA 3AD7C 2ZB9A 3IH4A 2PEXA 1EF4A 2NVQJ 2HDWA 4ILDA 2F48A 4OIRF 3I53A 5D4RA 1E2XA 3QX3A 2A5YB 2WY8Q 2LC2A 4U0WA 5E79C 2H09A 3TEDA 1QZYA 1USTA 2YPRA 3C3WA 4X0GA 4I6ZA 2ZXHA 3QP5A 5FLMC 1JUMA 1F9NA 3CC2I 2HR3A 2DFFA 3FIWA 2P4WA 4U7DA 1XPPA 4KM8A 3C7JA 3H3ZA 2OBPA 5E3OA 3WODF 1X1BA 5B1BH 5JVTA 2DK8A 5FLMJ 4IQJA 2VL8A 2X0LA 1HQCA 1TWAC 1XGOA 1QPIA 4B1RA 4FQGA 1QU3A 1P4WA 4GDFA 4M6XA 1WCMA 2VUMC 4KATA 3ZCOA 1EKEA 1MMNA 1TWAJ 4UB6C 3LSPA 3KYLA 4IKFA 1BW5A 4M3BA 4UUSA 2PX9A 2XAUA 3S3OA 3DP7A 2KL4A 2VUMJ 4OIQF 1TWCK 1HSJA 3ZQFA 1ETKA 5K5QA 1FZPB 3ZRGA 3I3LA 1TWFJ 2BBYA 3FXKA 1SVLA 4CCNA 2X1EA 3PM1A 1VFCA 3FKIK 2DK5A 1TWGC 2RH6A 2FQ4A 5IOZA 5D4DA 3PO3C 4NUBA 3JREA 4LITA 3J7AY 5TJ3A 1TWGJ 3MMYB 1U0JA 2M2EA 3PO3J 2D1HA 4QTRA 1Z91A 1IL2A 3BPVA 5EZGA 3U9GA 1OCCH 4G7HF 4A3JK 2O0YA 4A3KK 1XN7A 3IC7A 1RKWA 2AXTC 3E0JB 3OYCA 5DEQA 2XROA 1MMSA 2LFBA 1JVIA 1XDSA 3I0TA 3VPRA 1WJBA 1X3ZB 4A3GK 1WVRA 1FEXA 2MC3A 4Z6YA 2ZNYA 4NDLA 4YG2F 3GYHX 1EFWA 2HYGD 3BROA 3ZPLA 2V7FA 2X85A 3GLLA 2JA5C 4A3LC 2EFPA 5HS7A 2XAFA 2VOPA 1Z05A 2CQ7A 2LLKA 5DCFA 2ECCA 2JSPA 2KLOA 5GAEJ 2B63K 1JE8A 4C2MC 3OL3A 3FXRA 4WXHA 5LLQA 4A3LJ 4DDQA 5HLHA 4JX4A 3FF5A 4XKWA 5J1RA 5HDGA 4PABA 1DGRM 4Y52C 4C2MJ 3FWEA 1Z7UA 2PMUA 4KIFA 2OQGA 4JX6A 4PZJA 4QIWN 3S16K 4UHTA 2Z9OA 3GTKK 3K4CA 1OCZH 3OOPA 3CUQA 3GX4X 2XUBA 1SVOA 3BWGA 1Q1VA 3R61A 1MH3A 2A6EF 1IXSB 4EM0B 3OYLA 3F6OA 3LSJA 1SAUA 1LE8A 5J6XA 1BGWA 2JA6K 2DI3A 1TQIA 1TWCA 1MDMA 5F1RA 2FE3A 2L4MA 1YX2A 1BDFA 1FSEA 2LDUA 5L3CA 3FKIA 3H3VL 2NVYC 4BY1C 3OMYA 2VPLA 3BR6A 4LFUA 1JI8A 4LG0B 1H88C 3F8MA 4G7ZF 2BXZA 1X1AA 3AL0C 2NVYJ 3ZOBA 4BY1J 5IYBC 1B4AA 5CVRA 4BHCA 5F64A 4GFBA 3AFHA 3Q9SA 3H1CA 5B66C 3IKTA 3N05A 3EYIA 2BGCA 5IYCK 4DBRA 4RBOA 2HXOA 1YQAA 3HUGA 1ENHA 1V55H 2FU4A 2DOFA 5DYMA 4XRSA 4HX4A 4OIRA 2XHKA 5JVOA 1ZTRA 3PO2K 5FLVA 1X2NA 1ETXA 3K4LA 3PNTA 1G3YA 1V5GA 1USOA 3I58A 4YIRX 1HBXG 4E7KA 3ZMVA 2V9VA 1PUEE 2QSGX 2CFOA 4CDGA 2B63A 3QRFF 2IAIA 5FD6A 3FHZA 4ZYDA 2HEOA 1I6HC 2BVMA 4BQOA 1WSVA 4BY7C 3DFGA 1I6HJ 3AG3H 2QSHX 4WJ4A 1BI3A 3GMEA 3GTKA 4BY7J 3ZQQA 2XPUA 3E5QA 1BS2A 5GPAA 2LVSA 2HQRA 2JA6A 4HYEA 1OKRA 2P81A 2DTRA
chains in the Genus database with same CATH topology
5FFXA 3NRVA 3O3KA 4KMDA 2ESHA 5TJJA 1H0MA 2FQ3A 3FMQA 2XRNA 3HYIA 3R0AA 1XSDA 1BN5A 2W85A 1YO5C 4HX7A 4C3JC 5D5UB 4M74A 2R7FA 2CQKA 1IN8A 1R1UA 4FZBA 2K7LA 2OAZA 3V8JA 4N0BA 3LAJA 3PFIA 4I01A 4HAMA 3T8RA 4UNOA 3F8CA 2YSRA 5A2QZ 3ROUA 1HXDA 4MHGA 5E1WA 4EJTA 4GTLA 2M8EA 2CG4A 3P9CA 2L02A 3PQJA 4HZFA 1FYMA 3LWFA 2F2EA 3WG9A 3KETA 1BC8C 1FBQA 4R8HA 3S0XA 3DF8A 3CQZA 4I98B 1WQGA 3EETA 4LGWA 4EGYA 1ZG1A 1DD5A 2DPUA 1RI7A 1I50A 6PAXA 3PQKA 2KWAA 3FM3A 2VE9A 1BI1A 3HRSA 2IT0A 1XXAA 4ENNA 1EH1A 3JTGA 4OIPF 3HSRA 3H0GA 4U88A 3I64A 2MLKA 4G6DA 2EWNA 2FMLA 3MCZA 3G4AA 2CW0F 4LK0F 1SFUA 3T8TA 1W7PA 2V1XA 1OPCA 4IVNA 5FFZA 1DP7P 1T39A 1FY7A 3V8KA 4GT9A 3GO5A 3CJNA 2DQLA 2OZUA 4G9YA 1U3EM 2CWEA 1P92A 4I0BA 3HHHA 3QPHA 1ZLKA 2Z5UA 2CO5A 3H92A 1K79A 1LEBA 2LNBA 2ZFZA 1QO0D 3FXUA 1DDNA 4HLYA 1PDNC 4XSZF 1TTYA 1QGPA 2OU2A 4AVPA 2VONA 2JTVA 3VOEA 4C3IC 2P8TA 2MLGA 3HHGA 3CO6C 4HQEA 3GEZA 4GO1A 3REOA 3IHUA 4EV0A 4BXUA 3AAFA 2B0LA 4A5NA 2RVCA 3I59A 3JTHA 3KP2A 5D5VB 4KAWX 3I71A 5HS8A 2PN6A 5HDKA 1R00A 5IOSA 3GTGA 5D6FA 5EEHA 4M72A 2XCRB 2QQBA 4CHUA 2BE5F 3GLXA 2EFNA 3L4KA 3ZMUA 4WF2A 1K78A 3LSTA 1Z9CA 5DCMA 5DV5A 1F1ZA 1R9TA 2O6GE 3D0SA 5LHHA 3WU0A 3TKYA 5J8FA 1ZG5A 2KJCA 2DO7A 1XXCA 2QBYA 4G0WA 2K27A 1WQ2A 2CFXA 4S04A 3Q9VA 1O3SA 2E2HA 1D8KA 2EV0A 1TQMA 4ZZDA 2PHCB 4RGRA 3KP5A 4RAZA 5BPDA 1BOAA 4EJUA 3Q3QA 5K5OA 2HS5A 2ZFWA 2DPDA 1XB4A 5CVIA 1IW7F 2IA0A 1R7JA 2Q2EA 3QAHA 4A6EA 1LJ9A 2XAJA 1T6SA 2HKOA 2OA4A 2PG4A 3O6BB 2XKPA 2P6SA 4XLPF 5AONA 5JR3A 3MEXA 3QU3A 3KP7A 2LF8A 2VT2A 1O7FA 1EH6A 1WRJA 3HTUA 1YLFA 4KDDA 4EJOA 3HRTA 1K83A 3WTXC 2K86A 3OEPA 4IJAA 5E8IA 5EEGA 1R1VA 4Y17A 2MBFA 1HW1A 4E70A 2RGRA 4ZH4F 1FWZA 1U5TA 4KN7X 1B4BA 3ABTA 2ZBKA 2CFAB 1R36A 1YYVA 3MQ0A 1FNNA 5H6QA 1GXQA 1BIBA 5E8GA 2A07F 1ZYRF 4YFXF 1ISEA 1BJAA 3SXYA 2RN7A 2JPCA 1RUOA 1HKTA 1EK8A 2COMA 5ED4A 2KIFA 1TNSA 4PGGA 1DUXC 3M1EA 1YIOA 4KUMA 2R7DA 4ENJA 1GE9A 2DU9A 2O3FA 4L9NA 4KT5C 1XD7A 4UV9A 3WTZA 2HFHA 4HF0A 1ON2A 4KIGA 3GTPA 4EVIA 5D6EA 1VTNC 4KICA 5BS6A 1U2WA 2X4HA 1ZVUA 5IOQA 4UVAA 1ONVA 3GFIA 3FOFA 3NQOA 1RIOH 3E6DA 3VB2A 2IVMA 3FX3A 4P9UA 1B59A 3W6JB 1NHAA 3GUDA 1SD6A 2FNAA 3P9IA 4KB4A 5D5WB 1SD4A 4O3MA 5FD5A 1KU9A 2KIUA 2EV5A 2A61A 4KIBA 1KQ9A 5D4SA 3RPQA 4AIHA 3QPTA 4WK8F 3P7NA 1AB4A 1KU3A 2L4AA 3CAGA 4I02A 3BUEA 1MGTA 4YIIA 2J5OA 1BC7C 3E5UA 3GVAA 3N3YA 3QOPA 4R79A 1B9NA 3WE2A 1FBSA 4KARA 3K1PA 4HA8A 3KLOA 1YG2A 2R3SA 2FOKA 1PP8F 2QYOA 4GGGA 4PGHA 3C18A 3J80Z 2D1VA 2EV6A 4BLBA 4LLNA 4KMUX 2Z99A 2PJPA 4G7OF 4C3HC 3VFZA 1SD5A 1O3RA 4IRIA 2D45A 5BQTA 5JHUA 3F72A 1UCRA 5J8CA 1SAXA 4GTBA 3TOAA 2VT3A 2MD5A 5E1XA 3L00A 2F5EA 2PI0A 1R22A 2AS5F 5CVVA 1O57A 1TQPA 2JPBA 4D0PA 2ZJ2A 1U78A 1SMTA 2Z3YA 4G0VA 1SFEA 2H6BA 3RPUA 2AXLA 3GW2A 4GXOA 3J7AO 5LHGA 1KU2A 4XRFA 4UVBA 3F22A 4Q5SF 3J81Z 4LR2A 4S05A 3OREA 2MH9A 3GFMA 1JHFA 1IN7A 2P5KA 1G3TA 2G7HA 3QP6A 2W24A 3IL2A 5ICEA 2FBIA 3RDIA 2Y0MA 1QNTA 3VODA 2K02A 1C0WA 4LLGF 3KZZA 3LAPA 2P7CB 2RDPA 3KFWX 1KYZA 2RC4A 1Y1VA 2UZKA 3TGNA 1TW3A 4TV7A 3GZ6A 4WCGA 5L3FA 4EJVA 4A0YA 5DUKA 3KP6A 3K9TA 1IAWA 2OQRA 4A5MA 1W5SA 2TDXA 4O5VA 2RNJA 4HBLA 3FXQA 3WGGA 3CUQB 4L5IA 3HIFA 3I4PA 4MGRA 3IWZA 1QQIA 4Y15A 2H94A 1MDMB 2GXGA 4NHJA 2NYXA 3R0JA 3IRQA 2ZO4A 3WGIA 2EA2A 1I6XA 5LGUA 2M45A 4KYWA 1V3FA 1T2KA 4MEYF 4M9XA 4U0VA 4ZYEA 3RTRA 3N4MA 2IP2A 1LDKB 1U5TC 3GF2A 1KGSA 1G3SA 4ZYHA 2Z33A 2L54A 1IN5A 2M1BA 3DXJF 3ZN1A 2QZ8A 3ZMZA 2KIMA 1YW7A 3F8FA 3BPXA 1J75A 3KE2A 1OMIA 2K4BA 1PP7U 4IXAA 3R4KA 4BHBA 4XLNF 4AIKA 2O03A 4RAYA 1IXCA 1ZXOA 4KB2A 4HX8A 5CYVA 2A68F 1XCBA 4ETSA 2HTSA 3WGHA 1ZHFA 2NAZA 4KM9A 2M30A 2J5PA 5ICGA 2KJBA 2HTJA 1IUYA 3SZPA 4R1HA 3BOQA 4P96A 4A12A 1XGMA 1XSXA 2KKOA 2MA3A 5BOXA 1GHCA 1HW5A 3B02A 2OZ6A 4A0XA 2DQRA 5LHIA 4G8XA 4Q48A 3TO6A 1QZZA 1ZG3A 3U1DA 4LK1F 3ISPA 2ZKZA 2YR2A 1Q1HA 5LEKA 4KA4A 3KCCA 4EM1A 4G94A 2DT5A 3SQNA 1A04A 2L01A 4M1XA 3GTMA 1S29A 2ACJA 3BP8A 1T0FA 1R23A 4ASNA 1UHMA 1ZARA 1T98A 4LQYA 1ODDA 1XDUA 1FP2A 2HKXA 1GXPA 4FT8A 1CF7A 3K2ZA 3TOBA 4Y13A 4O6JA 4HQMA 4RGXA 1ZRDA 4I09A 4UUVA 2XVCA 2IPQX 1TWAA 1I5ZA 2ADUA 3WTSC 3F6VA 5ICFA 2PBIA 2VUMA 1XCVA 1ON1A 1WSUA 2CSOA 2F5CA 1O28A 1TWFA 3E6CC 3WTYC 2IA1A 5LGNA 3WTVC 3MMLB 1XSVA 3T0YA 1TWGA 2QM3A 2C6YA 5AIPA 4M73A 3WTTC 3O2PE 1FSHA 1B6AA 2STTA 1ZGJA 4BKWA 3CO7C 2HZTA 4A6DA 3TDUC 4GYGA 4P5AA 5IORA 3FM5A 5HLGA 2QENA 1WIHA 4EGZA 1CGPA 3TQNA 1B1BA 4EMSA 3AH5A 4OOIA 1F4KA 1LQ1A 1L3LA 2YX4A 3JAMZ 3RIRA 3EYYA 4FX0A 1O27A 3CUQC 4GTEA 5EGEA 1BI0A 3RI4A 5JI6A 3JSOA 2HDCA 3MAJA 3ABUA 3N97A 1H9GA 2QQAA 2NS0A 4WXCA 3JSPA 1MJ9A 4EM2A 5K5RA 2NVYA 1IN4A 2VBZA 1BJTA 3ECOA 3HOSA 1FLIA 1FP1D 2XAQA 3T1BA 3RKWA 4IHTA 4GTAA 2FEZA 3GFLA 4BHPA 1O2BA 1RNLA 3M9AA 2W25A 3IWFA 3WE3A 2Y3PA 1ZLJA 4FX4A 1MKMA 3IRRA 3ZQ7A 1J59A 4JK1X 1O24A 4L9JA 3DPLC 2VOOA 1IRGA 3I59B 5AIQA 3NUHA 5IT9K 3OPFA 2K4JA 4K2EA 1ZGAA 3GWZA 4RS8A 5LGTA 4RGSA 1KYWA 2F5DA 3GTLA 2A69F 1P6RA 3D5LA 4MQ9F 4HV5A 2XIGA 5JFRA 1FT9A 3FMRA 4YFNF 1P2FA 2HOEA 4CZZA 3DQVC 3VA7A 2VBWA 1DPRA 2DW4A 1K7AA 2YU9A 2WTEA 4LMYA 1J5YA 1MJBA 3N0CA 2E1CA 2A3SA 4HDUA 4ESBA 4GCVA 1ZAOA 3KZYA 4L18B 2OD5A 2QBYB 3KLNA 2F5FA 5CJ9A 3DV8A 4I0AA 1W7PD 5L3EA 2PQ8A 3COAC 1DPUA 2E2IA 1QBJA 4L9VA 4DQ2A 3GTJA 4HF1A 4EQQA 4OMZA 5HDNA 3TO9A 4L0YB 3R6SA 2PLYA 3F21A 4MQVA 4WX9A 3DKWA 3KEQA 1YS6A 3AQPA 2CGPA 2QVOA 1SMYF 1OYWA 5ILSA 4P5OA 2XAHA 2GA1A 1OR7A 4JBAA 2HGCA 1EV7A 1LEAA 4AIJA 1TWHA 3ERED 1FBUA 3V7CA 2O8XA 2ZMEB 5D8KB 4M9SA 5E18F 2FA5A 3Q5FA 2IRFG 2PMHA 3L7WA 4B09A 2YX7A 5DD4A 1XGNA 4ZZLA 4GTFA 2XCQA 3HRMA 1IN6A 3ULQB 1IXRC 1LVAA 4CICA 1ZBSA 1FPQA 1ZRCA 3LQRA 1USSA 2GZWA 2BV6A 2KRFA 3ML6A 1U5TB 1I1SA 5D5XB 4HLXA 1S3JA 4RGUA 5ILVA 2YU3A 4ZYGA 1KQ0A 1WI9A 4FHTA 2FSWA 3L2CA 2BYVE 1YS7A 3JW4A 2WC2A 2EB7A 2D2WA 4NQWA 2WWYA 1R5HA 3KEOA 1YTYA 5FLXZ 2P5VA 2P5MA 1GVJA 3SFZA 1O2AA 1BM9A 1IS1A 4DNCA 5HVQC 3ZMSA 4LG0A 2VBYA 4UVCA 2RKHA 3M8FA 2GSUA 1J7KA 3KP4A 4ENKA 1D8JA 2G9WA 1FC3A 1O7LA 4UV8A 1U6GA 4A0ZA 4MEXF 4KMAA 4LB5A 4LJZF 5DUIA 3V8LA 1I1GA 3K69A 1J9IA 3ZN0A 3OV8A 2V1DA 3ZP5A 1UHWA 3TDZC 1HKQA 4ESJA 2XASA 1WQHA 2FNPA 2EA4A 2FXAA 2UXXA 1F5TA 5E20A 5A2QK 1LNWA 3FOEA 3LA2A 1MZBA 2XV4S 2GSOA 4CGZA 2JH3A 2EFOA 2XAGA 2CYYA 2EFWA 3CDHA 4I2OA 1S8NA 2R93A 1B9MA 1XGSA 1Y0UA 4AD9A 2IJLA 2R92A 1EH8A 4RB1A 1ZH5A 5F6FA 1BBYA 1T38A 1AOYA 2XGXA 3K0LA 1K6OA 2Q8KA 2DFIA 2JA7A 4HOBA 3R60A 3BJ6A 5L3DA 4Q4ZF 4KNYA 2NNNA 1HW2A 5E17F 4RB2C 1J2XA 1D5VA 3V7RA 3EDPA 4BH9A 5D8LB 2VODA 4J3NA 2DBBA 2GA2A 2FBHA 4YIFA 4QLCU 1WWXA 1YW9A 2NVXA 3HSFA 5HOOA 2MH2A 5BMZA 4XBFA 3WU1B 1X3UA 5HS9A 3G4CA 2VN2A 1MD0A 2ESNA 1UFMA 2GWRA 4QWQA 2GQQA 4IPAA 4OIOF 4P5BA 5ERIA 3G3ZA 2EFQA 2FRHA 2LKPA 4H0EA 3W6KB 4HW0A 1H9TA 4WXDA 5CVUA 4XSXF 3LPXA 5CLSA 2NRAC 2UWMA 3AQOA 3DPTA 3RYPA 5L3BA 2ISZA 3C1DA 2WV0A 3EQLF 2JSCA 4P9FA 2VC1A 3RYRA 3EUHA 3L9FA 4KASA 4U7BA 2ZCWA 2XKOA 4UXNA 1Y1WA 3U2RA 4KC6A 1MJAA 1BIAA 5HLIA 2G7UA 4KN4X 4CXFA 1R58A 3F23A 1AWCA 4GYIA 1REPC 4N9HA 4CYDA 4YFKF 3JAMK 2W57A 5CVJA 4L9TA 3IKVA 4IRGA 2V6CA 2P5LC 5LEJA 4LD5A 4L0ZB 4BAYA 1ZN2A 1FYKA 3KP3A 1QPMA 3CUOA 2V79A 5ILUA 4N9IA 2Y75A 5LBQA 1FX7A 2A6HF 1OYYA 3LA3A 5DDGA 1SD7A 1UB9A 3MWMA 5FB2A 2QQ9A 1XMKA 5BPIA 3E3VA 5LRRA 2RGVA 3L4JA 3ZMDA 4Z2YA 4MTEA 4FM9A 4G6QA 1HSTA 3RKYA 3MZHA 1STZA 2VXZA 4HDVA 3FMSA 4HV6A 1P4AA 2QWWA 5LRSA 2M5WA 5DD8A 3NEUA 1Z1DA 2RV8A 2DLLA 1U8RA 2FMYA 1TLHB 1L0OC 4PDKA 2PFBA 1KA8A 3GXOA 2ELHA 3K1NA 3CLOA 3QU6A 2Y48A 1IF1A 1SFOA 3G73A 2V1UA 1XXBA 5CHPA 1W7PB 1S7OA 3WTWC 1RUNA 2JA5A 1IZ1A 2JRTA 4ESFA 3V7SA 4BNCA 4OINF 1WKMA 3GFJA 2DAOA 4MNUA 5JFEA 3E97A 5K1YA 1CF7B 4NB5A 5L3GA 2FBKA 3LA7A 4BQAA 1J0RA 2NNYA 3MZYA 5TRDA 3F3XA 3GTOA 3HTSB 2RQPA 1I27A 1Z6TA 2Q0OA 2CFAA 1I3QA 1V4RA 1EH7A 1G6NA 2JZYA 2HYFA 2VC0A 3E5XA 4KDPA 3BDDA 2M87A 5IT3A 1R1TA 4IRHA 1IRFA 1Z6RA 2BEOA 1S7AA 4OU0A 2P6TA 3FZVA 4A2UA 2L3DA 1FOKA 4OMYA 2E7XA 4KMFA 2HWVA 4Q47A 3TO7A 4KMHA 5FO5A 1TNTA 4B8XA 3L09A 1JGSA 4GFQA 1TW2A 5E1ZB 4ON0A 1P4XA 3I54A 3BJOA 1KQ4A 2UXNA 3BY6A 1K78B 4MTDA 1ULYA 4BYYA 5DCMB 2QUFA 3GTQA 2ZNZA 2STWA 2O61A 5EGHA 3E6BA 2ZMEA 2GSNA 1LDDA 3GZ5A 1RZ4A 3M7GA 4M71A 2VBXA 2HQNA 3RKXA 5FGMA 2E1NA 3HRUA 2ZXJA 4KFCA 2XCOA 2R7ZA 4CO8A 2W84A 3P9KA 2ETHA 4M9ZA 3M8EA 4GTCA 1S6LA 5H6RA 2EJRA 3MFKA 3HSEA 3LQQA 1O25A 2E7WA 3F8NA</