5IP7K

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5ip7K00
3S17C 3GTLK 2NVXK 3GTOK 3S1MC 4NOIA 2O5JA 3S1RC 2E2IC 2A6EA 2E2HK 1SFOC 3S15K 3H0GC 1YNNA 5C4XC 4C2MK 4Y7NK 3RZDK 3PO3K 4Q4ZA 1BDFA 2CW0A 3RZOC 3HOYC 3HOZC 5IYBC 4OIRA 2NVQK 2VUMC 3GTKK 3I4NK 4A3BK 4OINA 5IYCK 5M5WK 4G7OA 1I6HK 4OIOA 1ZYRA 4A3CK 3GTMK 1TWAK 1IW7A 4MQ9A 5C3EK 3HOWC 3I4MC 2PPBA 3S17K 4LJZA 3S2HC 3S1MK 2PMZL 4GZYA 3WODA 3S16K 4QIWD 4A3KC 1SFOK 5IP9C 3H0GK 2JA6K 3S15C 1TWGC 1I3QC 1HQMA 5IYBK 3EQLA 4QIWL 3RZDC 2VUMK 3HOZK 4A3BC 2NVQC 3K7AK 3I4NC 3GTKC 2R7ZK 5M5YK 5IYCC 4LK1A 3HOWK 4AYBD 2JA8K 4A3CC 4G7HA 5C3EC 3H3VD 4C3JK 3S2HK 4YFKA 2WB1D 4G7ZA 4A3KK 4AYBL 5IP9K 4A3EC 2B63K 1XPPA 3S16C 3H3VL 2JA6C 5TMCA 1TWGK 1I3QK 3HOXC 4A3IK 4OIPA 2JA5C 3PO2C 3K7AC 4C3IK 2R7ZC 4QJVB 5IYDC 4A3MC 4OIQA 5FLMC 2JA8C 2E2JC 3HOVC 4MEXA 4A3EK 3S1NC 1Y1VC 2B63C 4KMUA 3GTJC 1TWCC 4XLPA 3HOXK 1Y1WC 3M4OC 4A3IC 2JA5K 3PO2K 2NVYK 3HKZD 5IYDK 4ZH4A 4A3MK 2NVTK 5FLMK 3HOUC 3S2DK 2E2JK 3HOVK 4X6AC 2YU9K 3S14K 2R92C 3S1QC 4BXXC 1I50C 4Q5SA 1WCMC 2A68A 3S1NK 1Y1VK 5M3MK 2PA8D 3GTJK 1K83C 4BBSK 1TWCK 4LK0A 5D4DA 1Y1WK 2WB1L 3M4OK 4XSZA 1TWHC 2PA8L 4A3LC 3GTPC 4A3DK 4BY7K 5IP7K 3GTGC 2NVYC 4YFXA 3HOUK 4XSXA 4X6AK 1TWFK 2A6HA 5C4JC 2NVTC 2R93K 2R92K 3S2DC 4BXXK 1I50K 5M3FK 3S1QK 5FJ8K 4JK1A 1WCMK 4BBRC 2YU9C 3S14C 1K83K 1YNJA 4KN4A 4BBSC 4KN7A 5M5XK 1TWHK 4BY1C 4A3JC 2WAQD 4A3LK 3GTPK 3GTGK 3M3YK 2Y0SD 4BY7C 4A3DC 3GTQC 3FKIK 5IP7C 2WAQL 5C4JK 4LLGA 5C44K 4A3FC 3DXJA 4A3GC 1TWFC 4BBRK 2R93C 2Y0SL 3HKZL 1R9TC 2BE5A 4A93C 3CQZK 2JA7C 4YG2A 4BY1K 2PMZD 4A3JK 4Y52C 1SMYA 4MEYA 1I6VA 3GTQK 4QJVA 3S1RK 2E2IK 2NVXC 5TMFA 4A3FK 3GTOC 3GTLC 3M3YC 3FKIC 5C4XK 4A3GK 5C44C 2E2HC 1R9TK 3RZOK 4A93K 3HOYK 4Y7NC 2JA7K 3PO3C 2A69A 3CQZC 2O5IA 4C3HK 3I4MK 4Y52K 4YFNA 1I6HC 3GTMC 4XLNA 1TWAC
chains in the Genus database with same CATH superfamily
1O2BA 3GTLK 1K83A 2GAHC 1YNNA 4XCHA 1IE0A 1O27A 3RZDK 3VA7A 3PO3K 4WJ3M 5IOTA 2CW0A 2ZFZA 4A3BK 2NVQK 3I4NK 3GTOA 3FKIA 1I6HK 4A3CK 3HOWC 3S17K 4LJZA 4QIWD 4O2DA 2JA6K 5IP9C 3H0GK 4J3NA 4KMHA 3G4CA 4KB4A 1TWGC 1HQMA 2R7ZK 2KWAA 5IYCC 2JA8K 2V6SA 2Y3PA 3H3VD 1WORA 2WB1D 1PJ5A 4A3KK 1J6XA 1XPPA 3S16C 3A8JA 1BS2A 1WSRA 5IORA 3GEHA 2NVXA 2JA5C 1VJEA 4C3IK 2ZUFA 4QJVB 1WOSA 4MEXA 4C3JC 4A3EK 3Q3QA 4PAAA 1DCOA 2CFAB 2B63C 3AQOA 1TWCC 3M4OC 1O29A 4GTAA 3PO2K 4WILA 1SFOA 3OPFA 3HOUC 3TFHA 3S2DK 4FM9A 3QX3A 4BXXC 2VUMA 2JA5A 4BLAA 4GTBA 1RU0A 1BJTA 2JH3A 4A3LC 4A3DK 2B63A 4LOWA 2NVYC 3BP3A 1TWCA 4P5BA 2R92K 1I50K 1WCMK 3SZYA 1K83K 1F7UA 1USOA 3FHZA 3M3YK 3GTQC 3FKIK 1O26A 5C4JK 1TWFC 3HKZL 1R9TC 4A93C 2NVYA 4BY1K 4A3JK 4C3HC 1SMYA 1ZVUA 1USMA 4ILDA 4FZBA 4QJVA 4A3FK 4A3GK 1L0WA 5C44C 4C2MC 4Y7NC 2A69A 3GTQA 1TWFA 4KC6A 1J6WA 4YFNA 1TWAC 4KMAA 1R9TA 3GEIA 2NVXK 3NUHA 4NOIA 2A6EA 3AD9C 5C4XC 3GTGA 5IYCK 1WQGA 3HXAA 3GTMK 3S2HC 3S1MK 2PMZL 3S16K 1SFOK 1TWAA 4KM8A 1I3QC 3HOZK 5IYBK 4QIWL 2VUMK 5CHPA 1DD5A 3GTKC 5M5YK 5C3EC 4C3JK 2XCOA 4KATA 2B63K 4BLBA 3H3VL 4KDDA 5TMCA 1XXAA 5IOSA 3HOXC 4GTEA 1C0AA 5JFEA 1VLOA 1WOOA 2E2HA 5IYDC 1XXCA 4OIQA 2E2JC 2XCRB 1KQ4A 3GTKA 3AD7C 2V6TA 3S1NC 1Y1VC 3GTJC 4XLPA 1Y1WC 4KASA 4M1XA 2NVYK 3IPJA 3OEPA 3MMLB 4ZH4A 4A3MK 5FLMK 3HOVK 1BGWA 3V4GA 3S1QC 1GE9A 4P5AA 2A68A 4LK0A 4LQYA 3N0BA 1F9NA 1TWHC 2GAGC 3GTPC 1XZPB 4XSXA 4X6AK 1TWFK 2NVTC 1TWGA 4KM9A 4JK1A 3L4JA 1IQ0A 3LPXA 5M5XK 2WAQD 4DDQA 5JVOA 3GTGK 1VGXA 5C44K 1F7VA 5L46A 1DCPA 4BBRK 3CAGA 2BE5A 3ADAC 2XCQA 1HI9A 1IL2A 2EBBA 1UV7A 3GTLC 5HL8A 5C4XK 1B4AA 2JA7K 3PO3C 1B4BA 3TTGA 2ZUEA 3CQZC 2O5IA 4KB2A 4Y52K 1I6HC 4BKWA 2PPBA 2GSOA 3S17C 2RH6A 3T00A 3GTOK 2O5JA 1ISEA 2E2IC 1INNA 4KMDA 3TFJA 2E2HK 3H0GC 1WOPA 1DCHA 3RZOC 3GTKK 4G7OA 5M5WK 4GFQA 1IW7A 4MQ9A 5C3EK 3CQZA 4GZYA 3WODA 4A3KC 3S15C 1JQWA 3EQLA 2CFAA 4KARA 2E2IA 4LR2A 1YCLA 1VRQC 3H0GA 4LK1A 1AB4A 4AYBD 4C3IC 3HOWK 1PJ6A 1JOEA 4YFKA 1IS1A 5IP9K 4A3EC 1TWGK 3TFIA 4WJ4A 3LAJA 3BUEA 5E68A 3PO2C 3K7AC 1G51A 5EGHA 2W7VA 2FQTA 1O2AA 4KMUA 3BP8C 3T01A 3T02A 4A3IC 2JA5K 4GTLA 3HKZD 4C45A 2NVTK 1O24A 2R92C 1I50C 1XZQB 1WCMC 1V5VA 2PA8D 1K83C 1TWCK 5D4DA 3M4OK 2WB1L 4XSZA 3G4AA 3GSIA 4P9SA 5TJ3A 1WQFA 4YFXA 3A8IA 3HOUK 2A6HA 5C4JC 1I3QA 4BXXK 3FOFA 1F93A 2YU9C 3S14C 1YNJA 4BBSC 4KN7A 4BY1C 4A3JC 2FQOA 4A3LK 1WCMA 3N3YA 2Y0SD 4BY7C 5IP7C 2WAQL 4LLGA 4A3FC 4A3GC 2R93C 3CQZK 1YX2A 1O2FB 4YG2A 1O25A 2PMZD 4MEYA 2YU9A 1I6VA 3GTQK 1Y1VA 2E2IK 2NVXC 3GTJA 1Y1WA 1R9TK 3RZOK 4A93K 4KAWX 4C3HK 3SZZA 2R93A 3GTMC 3AD8C 3S1MC 2V6UA 5EGEA 3S1RC 3S15K 2GSNA 1SFOC 1TWHA 4GTCA 1JVIA 1XZQA 4C2MK 4Y7NK 1ZQ1C 3GTPA 4Q4ZA 1BDFA 3HOYC 4RMFA 5IYBC 4OIRA 2VUMC 3HOZC 3AH5A 4OINA 2RGRA 4OIOA 1ZYRA 1TWAK 3I4MC 3L4KA 4GT9A 3A8KA 1EQRA 2D6FC 3GTMA 1ZXOA 1PJ7A 3RZDC 4A3BC 2NVQC 3K7AK 3I4NC 4G0UA 4A3CC 4G7HA 3S2HK 1J98A 4G7ZA 3AQPA 4AYBL 3FOEA 2JA6C 1I3QK 4A3IK 5IOQA 3GTLA 1J6VA 4OIPA 1EI6A 2R7ZC 4A3MC 5FLMC 2JA8C 1XZPA 3HOVC 3JSTA 1O28A 3HOXK 1XXBA 3GEEA 2P5MA 1IBAA 4G0WA 2JA6A 5IYDK 1ZBSA 2E2JK 4X6AC 2YU9K 3S14K 4Q5SA 3S1NK 1Y1VK 5M3MK 5CJ9A 3GTJK 4BBSK 2R7ZA 1Y1WK 2PA8L 2GSUA 4BY7K 5IP7K 3GTGC 1VH2A 3LAPA 2R93K 3S1QK 3S2DC 5M3FK 5FJ8K 4BBRC 3N0CA 4XLNA 4KN4A 1TWHK 1WSVA 2PHCB 3GTPK 2P8TA 3S0XA 4A3DC 4G0VA 3GDZA 3DXJA 1WIHA 3ERED 1EK8A 2Y0SL 2JA7C 1EH1A 1X31C 4Y52C 4GTFA 1EFWA 4AH6A 3S1RK 5TMFA 3M3YC 3GTOC 3GIRA 3FKIC 4GTDA 2E2HC 3OREA 3HOYK 3I4MK 2R92A 1WQHA 1I50A 4PABA 2JA7A
chains in the Genus database with same CATH topology
3S17C 3GTLK 2NVXK 3GTOK 3S1MC 4NOIA 2O5JA 3S1RC 2E2IC 2A6EA 2E2HK 1SFOC 3S15K 3H0GC 1YNNA 5C4XC 4C2MK 4Y7NK 3RZDK 3PO3K 4Q4ZA 1BDFA 2CW0A 3RZOC 3HOYC 3HOZC 5IYBC 4OIRA 2NVQK 2VUMC 3GTKK 3I4NK 4A3BK 4OINA 5IYCK 5M5WK 4G7OA 1I6HK 4OIOA 1ZYRA 4A3CK 3GTMK 1TWAK 1IW7A 4MQ9A 5C3EK 3HOWC 3I4MC 2PPBA 3S17K 4LJZA 3S2HC 3S1MK 2PMZL 4GZYA 3WODA 3S16K 4QIWD 4A3KC 1SFOK 5IP9C 3H0GK 2JA6K 3S15C 1TWGC 1I3QC 1HQMA 5IYBK 3EQLA 4QIWL 3RZDC 2VUMK 3HOZK 4A3BC 2NVQC 3K7AK 3I4NC 3GTKC 2R7ZK 5M5YK 5IYCC 4LK1A 3HOWK 4AYBD 2JA8K 4A3CC 4G7HA 5C3EC 3H3VD 4C3JK 3S2HK 4YFKA 2WB1D 4G7ZA 4A3KK 4AYBL 5IP9K 4A3EC 2B63K 1XPPA 3S16C 3H3VL 2JA6C 5TMCA 1TWGK 1I3QK 3HOXC 4A3IK 4OIPA 2JA5C 3PO2C 3K7AC 4C3IK 2R7ZC 4QJVB 5IYDC 4A3MC 4OIQA 5FLMC 2JA8C 2E2JC 3HOVC 4MEXA 4A3EK 3S1NC 1Y1VC 2B63C 4KMUA 3GTJC 1TWCC 4XLPA 3HOXK 1Y1WC 3M4OC 4A3IC 2JA5K 3PO2K 2NVYK 3HKZD 5IYDK 4ZH4A 4A3MK 2NVTK 5FLMK 3HOUC 3S2DK 2E2JK 3HOVK 4X6AC 2YU9K 3S14K 2R92C 3S1QC 4BXXC 1I50C 4Q5SA 1WCMC 2A68A 3S1NK 1Y1VK 5M3MK 2PA8D 3GTJK 1K83C 4BBSK 1TWCK 4LK0A 5D4DA 1Y1WK 2WB1L 3M4OK 4XSZA 1TWHC 2PA8L 4A3LC 3GTPC 4A3DK 4BY7K 5IP7K 3GTGC 2NVYC 4YFXA 3HOUK 4XSXA 4X6AK 1TWFK 2A6HA 5C4JC 2NVTC 2R93K 2R92K 3S2DC 4BXXK 1I50K 5M3FK 3S1QK 5FJ8K 4JK1A 1WCMK 4BBRC 2YU9C 3S14C 1K83K 1YNJA 4KN4A 4BBSC 4KN7A 5M5XK 1TWHK 4BY1C 4A3JC 2WAQD 4A3LK 3GTPK 3GTGK 3M3YK 2Y0SD 4BY7C 4A3DC 3GTQC 3FKIK 5IP7C 2WAQL 5C4JK 4LLGA 5C44K 4A3FC 3DXJA 4A3GC 1TWFC 4BBRK 2R93C 2Y0SL 3HKZL 1R9TC 2BE5A 4A93C 3CQZK 2JA7C 4YG2A 4BY1K 2PMZD 4A3JK 4Y52C 1SMYA 4MEYA 1I6VA 3GTQK 4QJVA 3S1RK 2E2IK 2NVXC 5TMFA 4A3FK 3GTOC 3GTLC 3M3YC 3FKIC 5C4XK 4A3GK 5C44C 2E2HC 1R9TK 3RZOK 4A93K 3HOYK 4Y7NC 2JA7K 3PO3C 2A69A 3CQZC 2O5IA 4C3HK 3I4MK 4Y52K 4YFNA 1I6HC 3GTMC 4XLNA 1TWAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 C;  3GTL K;  2NVX K;  3GTO K;  3S1M C;  4NOI A;  2O5J A;  3S1R C;  2E2I C;  2A6E A;  2E2H K;  1SFO C;  3S15 K;  3H0G C;  1YNN A;  5C4X C;  4C2M K;  4Y7N K;  3RZD K;  3PO3 K;  4Q4Z A;  1BDF A;  2CW0 A;  3RZO C;  3HOY C;  3HOZ C;  5IYB C;  4OIR A;  2NVQ K;  2VUM C;  3GTK K;  3I4N K;  4A3B K;  4OIN A;  5IYC K;  5M5W K;  4G7O A;  1I6H K;  4OIO A;  1ZYR A;  4A3C K;  3GTM K;  1TWA K;  1IW7 A;  4MQ9 A;  5C3E K;  3HOW C;  3I4M C;  2PPB A;  3S17 K;  4LJZ A;  3S2H C;  3S1M K;  2PMZ L;  4GZY A;  3WOD A;  3S16 K;  4QIW D;  4A3K C;  1SFO K;  5IP9 C;  3H0G K;  2JA6 K;  3S15 C;  1TWG C;  1I3Q C;  1HQM A;  5IYB K;  3EQL A;  4QIW L;  3RZD C;  2VUM K;  3HOZ K;  4A3B C;  2NVQ C;  3K7A K;  3I4N C;  3GTK C;  2R7Z K;  5M5Y K;  5IYC C;  4LK1 A;  3HOW K;  4AYB D;  2JA8 K;  4A3C C;  4G7H A;  5C3E C;  3H3V D;  4C3J K;  3S2H K;  4YFK A;  2WB1 D;  4G7Z A;  4A3K K;  4AYB L;  5IP9 K;  4A3E C;  2B63 K;  1XPP A;  3S16 C;  3H3V L;  2JA6 C;  5TMC A;  1TWG K;  1I3Q K;  3HOX C;  4A3I K;  4OIP A;  2JA5 C;  3PO2 C;  3K7A C;  4C3I K;  2R7Z C;  4QJV B;  5IYD C;  4A3M C;  4OIQ A;  5FLM C;  2JA8 C;  2E2J C;  3HOV C;  4MEX A;  4A3E K;  3S1N C;  1Y1V C;  2B63 C;  4KMU A;  3GTJ C;  1TWC C;  4XLP A;  3HOX K;  1Y1W C;  3M4O C;  4A3I C;  2JA5 K;  3PO2 K;  2NVY K;  3HKZ D;  5IYD K;  4ZH4 A;  4A3M K;  2NVT K;  5FLM K;  3HOU C;  3S2D K;  2E2J K;  3HOV K;  4X6A C;  2YU9 K;  3S14 K;  2R92 C;  3S1Q C;  4BXX C;  1I50 C;  4Q5S A;  1WCM C;  2A68 A;  3S1N K;  1Y1V K;  5M3M K;  2PA8 D;  3GTJ K;  1K83 C;  4BBS K;  1TWC K;  4LK0 A;  5D4D A;  1Y1W K;  2WB1 L;  3M4O K;  4XSZ A;  1TWH C;  2PA8 L;  4A3L C;  3GTP C;  4A3D K;  4BY7 K;  5IP7 K;  3GTG C;  2NVY C;  4YFX A;  3HOU K;  4XSX A;  4X6A K;  1TWF K;  2A6H A;  5C4J C;  2NVT C;  2R93 K;  2R92 K;  3S2D C;  4BXX K;  1I50 K;  5M3F K;  3S1Q K;  5FJ8 K;  4JK1 A;  1WCM K;  4BBR C;  2YU9 C;  3S14 C;  1K83 K;  1YNJ A;  4KN4 A;  4BBS C;  4KN7 A;  5M5X K;  1TWH K;  4BY1 C;  4A3J C;  2WAQ D;  4A3L K;  3GTP K;  3GTG K;  3M3Y K;  2Y0S D;  4BY7 C;  4A3D C;  3GTQ C;  3FKI K;  5IP7 C;  2WAQ L;  5C4J K;  4LLG A;  5C44 K;  4A3F C;  3DXJ A;  4A3G C;  1TWF C;  4BBR K;  2R93 C;  2Y0S L;  3HKZ L;  1R9T C;  2BE5 A;  4A93 C;  3CQZ K;  2JA7 C;  4YG2 A;  4BY1 K;  2PMZ D;  4A3J K;  4Y52 C;  1SMY A;  4MEY A;  1I6V A;  3GTQ K;  4QJV A;  3S1R K;  2E2I K;  2NVX C;  5TMF A;  4A3F K;  3GTO C;  3GTL C;  3M3Y C;  3FKI C;  5C4X K;  4A3G K;  5C44 C;  2E2H C;  1R9T K;  3RZO K;  4A93 K;  3HOY K;  4Y7N C;  2JA7 K;  3PO3 C;  2A69 A;  3CQZ C;  2O5I A;  4C3H K;  3I4M K;  4Y52 K;  4YFN A;  1I6H C;  3GTM C;  4XLN A;  1TWA C; 
#chains in the Genus database with same CATH topology
 1O2B A;  3GTL K;  1K83 A;  2GAH C;  1YNN A;  4XCH A;  1IE0 A;  1O27 A;  3RZD K;  3VA7 A;  3PO3 K;  4WJ3 M;  5IOT A;  2CW0 A;  2ZFZ A;  4A3B K;  2NVQ K;  3I4N K;  3GTO A;  3FKI A;  1I6H K;  4A3C K;  3HOW C;  3S17 K;  4LJZ A;  4QIW D;  4O2D A;  2JA6 K;  5IP9 C;  3H0G K;  4J3N A;  4KMH A;  3G4C A;  4KB4 A;  1TWG C;  1HQM A;  2R7Z K;  2KWA A;  5IYC C;  2JA8 K;  2V6S A;  2Y3P A;  3H3V D;  1WOR A;  2WB1 D;  1PJ5 A;  4A3K K;  1J6X A;  1XPP A;  3S16 C;  3A8J A;  1BS2 A;  1WSR A;  5IOR A;  3GEH A;  2NVX A;  2JA5 C;  1VJE A;  4C3I K;  2ZUF A;  4QJV B;  1WOS A;  4MEX A;  4C3J C;  4A3E K;  3Q3Q A;  4PAA A;  1DCO A;  2CFA B;  2B63 C;  3AQO A;  1TWC C;  3M4O C;  1O29 A;  4GTA A;  3PO2 K;  4WIL A;  1SFO A;  3OPF A;  3HOU C;  3TFH A;  3S2D K;  4FM9 A;  3QX3 A;  4BXX C;  2VUM A;  2JA5 A;  4BLA A;  4GTB A;  1RU0 A;  1BJT A;  2JH3 A;  4A3L C;  4A3D K;  2B63 A;  4LOW A;  2NVY C;  3BP3 A;  1TWC A;  4P5B A;  2R92 K;  1I50 K;  1WCM K;  3SZY A;  1K83 K;  1F7U A;  1USO A;  3FHZ A;  3M3Y K;  3GTQ C;  3FKI K;  1O26 A;  5C4J K;  1TWF C;  3HKZ L;  1R9T C;  4A93 C;  2NVY A;  4BY1 K;  4A3J K;  4C3H C;  1SMY A;  1ZVU A;  1USM A;  4ILD A;  4FZB A;  4QJV A;  4A3F K;  4A3G K;  1L0W A;  5C44 C;  4C2M C;  4Y7N C;  2A69 A;  3GTQ A;  1TWF A;  4KC6 A;  1J6W A;  4YFN A;  1TWA C;  4KMA A;  1R9T A;  3GEI A;  2NVX K;  3NUH A;  4NOI A;  2A6E A;  3AD9 C;  5C4X C;  3GTG A;  5IYC K;  1WQG A;  3HXA A;  3GTM K;  3S2H C;  3S1M K;  2PMZ L;  3S16 K;  1SFO K;  1TWA A;  4KM8 A;  1I3Q C;  3HOZ K;  5IYB K;  4QIW L;  2VUM K;  5CHP A;  1DD5 A;  3GTK C;  5M5Y K;  5C3E C;  4C3J K;  2XCO A;  4KAT A;  2B63 K;  4BLB A;  3H3V L;  4KDD A;  5TMC A;  1XXA A;  5IOS A;  3HOX C;  4GTE A;  1C0A A;  5JFE A;  1VLO A;  1WOO A;  2E2H A;  5IYD C;  1XXC A;  4OIQ A;  2E2J C;  2XCR B;  1KQ4 A;  3GTK A;  3AD7 C;  2V6T A;  3S1N C;  1Y1V C;  3GTJ C;  4XLP A;  1Y1W C;  4KAS A;  4M1X A;  2NVY K;  3IPJ A;  3OEP A;  3MML B;  4ZH4 A;  4A3M K;  5FLM K;  3HOV K;  1BGW A;  3V4G A;  3S1Q C;  1GE9 A;  4P5A A;  2A68 A;  4LK0 A;  4LQY A;  3N0B A;  1F9N A;  1TWH C;  2GAG C;  3GTP C;  1XZP B;  4XSX A;  4X6A K;  1TWF K;  2NVT C;  1TWG A;  4KM9 A;  4JK1 A;  3L4J A;  1IQ0 A;  3LPX A;  5M5X K;  2WAQ D;  4DDQ A;  5JVO A;  3GTG K;  1VGX A;  5C44 K;  1F7V A;  5L46 A;  1DCP A;  4BBR K;  3CAG A;  2BE5 A;  3ADA C;  2XCQ A;  1HI9 A;  1IL2 A;  2EBB A;  1UV7 A;  3GTL C;  5HL8 A;  5C4X K;  1B4A A;  2JA7 K;  3PO3 C;  1B4B A;  3TTG A;  2ZUE A;  3CQZ C;  2O5I A;  4KB2 A;  4Y52 K;  1I6H C;  4BKW A;  2PPB A;  2GSO A;  3S17 C;  2RH6 A;  3T00 A;  3GTO K;  2O5J A;  1ISE A;  2E2I C;  1INN A;  4KMD A;  3TFJ A;  2E2H K;  3H0G C;  1WOP A;  1DCH A;  3RZO C;  3GTK K;  4G7O A;  5M5W K;  4GFQ A;  1IW7 A;  4MQ9 A;  5C3E K;  3CQZ A;  4GZY A;  3WOD A;  4A3K C;  3S15 C;  1JQW A;  3EQL A;  2CFA A;  4KAR A;  2E2I A;  4LR2 A;  1YCL A;  1VRQ C;  3H0G A;  4LK1 A;  1AB4 A;  4AYB D;  4C3I C;  3HOW K;  1PJ6 A;  1JOE A;  4YFK A;  1IS1 A;  5IP9 K;  4A3E C;  1TWG K;  3TFI A;  4WJ4 A;  3LAJ A;  3BUE A;  5E68 A;  3PO2 C;  3K7A C;  1G51 A;  5EGH A;  2W7V A;  2FQT A;  1O2A A;  4KMU A;  3BP8 C;  3T01 A;  3T02 A;  4A3I C;  2JA5 K;  4GTL A;  3HKZ D;  4C45 A;  2NVT K;  1O24 A;  2R92 C;  1I50 C;  1XZQ B;  1WCM C;  1V5V A;  2PA8 D;  1K83 C;  1TWC K;  5D4D A;  3M4O K;  2WB1 L;  4XSZ A;  3G4A A;  3GSI A;  4P9S A;  5TJ3 A;  1WQF A;  4YFX A;  3A8I A;  3HOU K;  2A6H A;  5C4J C;  1I3Q A;  4BXX K;  3FOF A;  1F93 A;  2YU9 C;  3S14 C;  1YNJ A;  4BBS C;  4KN7 A;  4BY1 C;  4A3J C;  2FQO A;  4A3L K;  1WCM A;  3N3Y A;  2Y0S D;  4BY7 C;  5IP7 C;  2WAQ L;  4LLG A;  4A3F C;  4A3G C;  2R93 C;  3CQZ K;  1YX2 A;  1O2F B;  4YG2 A;  1O25 A;  2PMZ D;  4MEY A;  2YU9 A;  1I6V A;  3GTQ K;  1Y1V A;  2E2I K;  2NVX C;  3GTJ A;  1Y1W A;  1R9T K;  3RZO K;  4A93 K;  4KAW X;  4C3H K;  3SZZ A;  2R93 A;  3GTM C;  3AD8 C;  3S1M C;  2V6U A;  5EGE A;  3S1R C;  3S15 K;  2GSN A;  1SFO C;  1TWH A;  4GTC A;  1JVI A;  1XZQ A;  4C2M K;  4Y7N K;  1ZQ1 C;  3GTP A;  4Q4Z A;  1BDF A;  3HOY C;  4RMF A;  5IYB C;  4OIR A;  2VUM C;  3HOZ C;  3AH5 A;  4OIN A;  2RGR A;  4OIO A;  1ZYR A;  1TWA K;  3I4M C;  3L4K A;  4GT9 A;  3A8K A;  1EQR A;  2D6F C;  3GTM A;  1ZXO A;  1PJ7 A;  3RZD C;  4A3B C;  2NVQ C;  3K7A K;  3I4N C;  4G0U A;  4A3C C;  4G7H A;  3S2H K;  1J98 A;  4G7Z A;  3AQP A;  4AYB L;  3FOE A;  2JA6 C;  1I3Q K;  4A3I K;  5IOQ A;  3GTL A;  1J6V A;  4OIP A;  1EI6 A;  2R7Z C;  4A3M C;  5FLM C;  2JA8 C;  1XZP A;  3HOV C;  3JST A;  1O28 A;  3HOX K;  1XXB A;  3GEE A;  2P5M A;  1IBA A;  4G0W A;  2JA6 A;  5IYD K;  1ZBS A;  2E2J K;  4X6A C;  2YU9 K;  3S14 K;  4Q5S A;  3S1N K;  1Y1V K;  5M3M K;  5CJ9 A;  3GTJ K;  4BBS K;  2R7Z A;  1Y1W K;  2PA8 L;  2GSU A;  4BY7 K;  5IP7 K;  3GTG C;  1VH2 A;  3LAP A;  2R93 K;  3S1Q K;  3S2D C;  5M3F K;  5FJ8 K;  4BBR C;  3N0C A;  4XLN A;  4KN4 A;  1TWH K;  1WSV A;  2PHC B;  3GTP K;  2P8T A;  3S0X A;  4A3D C;  4G0V A;  3GDZ A;  3DXJ A;  1WIH A;  3ERE D;  1EK8 A;  2Y0S L;  2JA7 C;  1EH1 A;  1X31 C;  4Y52 C;  4GTF A;  1EFW A;  4AH6 A;  3S1R K;  5TMF A;  3M3Y C;  3GTO C;  3GIR A;  3FKI C;  4GTD A;  2E2H C;  3ORE A;  3HOY K;  3I4M K;  2R92 A;  1WQH A;  1I50 A;  4PAB A;  2JA7 A; 
#chains in the Genus database with same CATH homology
 3S17 C;  3GTL K;  2NVX K;  3GTO K;  3S1M C;  4NOI A;  2O5J A;  3S1R C;  2E2I C;  2A6E A;  2E2H K;  1SFO C;  3S15 K;  3H0G C;  1YNN A;  5C4X C;  4C2M K;  4Y7N K;  3RZD K;  3PO3 K;  4Q4Z A;  1BDF A;  2CW0 A;  3RZO C;  3HOY C;  3HOZ C;  5IYB C;  4OIR A;  2NVQ K;  2VUM C;  3GTK K;  3I4N K;  4A3B K;  4OIN A;  5IYC K;  5M5W K;  4G7O A;  1I6H K;  4OIO A;  1ZYR A;  4A3C K;  3GTM K;  1TWA K;  1IW7 A;  4MQ9 A;  5C3E K;  3HOW C;  3I4M C;  2PPB A;  3S17 K;  4LJZ A;  3S2H C;  3S1M K;  2PMZ L;  4GZY A;  3WOD A;  3S16 K;  4QIW D;  4A3K C;  1SFO K;  5IP9 C;  3H0G K;  2JA6 K;  3S15 C;  1TWG C;  1I3Q C;  1HQM A;  5IYB K;  3EQL A;  4QIW L;  3RZD C;  2VUM K;  3HOZ K;  4A3B C;  2NVQ C;  3K7A K;  3I4N C;  3GTK C;  2R7Z K;  5M5Y K;  5IYC C;  4LK1 A;  3HOW K;  4AYB D;  2JA8 K;  4A3C C;  4G7H A;  5C3E C;  3H3V D;  4C3J K;  3S2H K;  4YFK A;  2WB1 D;  4G7Z A;  4A3K K;  4AYB L;  5IP9 K;  4A3E C;  2B63 K;  1XPP A;  3S16 C;  3H3V L;  2JA6 C;  5TMC A;  1TWG K;  1I3Q K;  3HOX C;  4A3I K;  4OIP A;  2JA5 C;  3PO2 C;  3K7A C;  4C3I K;  2R7Z C;  4QJV B;  5IYD C;  4A3M C;  4OIQ A;  5FLM C;  2JA8 C;  2E2J C;  3HOV C;  4MEX A;  4A3E K;  3S1N C;  1Y1V C;  2B63 C;  4KMU A;  3GTJ C;  1TWC C;  4XLP A;  3HOX K;  1Y1W C;  3M4O C;  4A3I C;  2JA5 K;  3PO2 K;  2NVY K;  3HKZ D;  5IYD K;  4ZH4 A;  4A3M K;  2NVT K;  5FLM K;  3HOU C;  3S2D K;  2E2J K;  3HOV K;  4X6A C;  2YU9 K;  3S14 K;  2R92 C;  3S1Q C;  4BXX C;  1I50 C;  4Q5S A;  1WCM C;  2A68 A;  3S1N K;  1Y1V K;  5M3M K;  2PA8 D;  3GTJ K;  1K83 C;  4BBS K;  1TWC K;  4LK0 A;  5D4D A;  1Y1W K;  2WB1 L;  3M4O K;  4XSZ A;  1TWH C;  2PA8 L;  4A3L C;  3GTP C;  4A3D K;  4BY7 K;  5IP7 K;  3GTG C;  2NVY C;  4YFX A;  3HOU K;  4XSX A;  4X6A K;  1TWF K;  2A6H A;  5C4J C;  2NVT C;  2R93 K;  2R92 K;  3S2D C;  4BXX K;  1I50 K;  5M3F K;  3S1Q K;  5FJ8 K;  4JK1 A;  1WCM K;  4BBR C;  2YU9 C;  3S14 C;  1K83 K;  1YNJ A;  4KN4 A;  4BBS C;  4KN7 A;  5M5X K;  1TWH K;  4BY1 C;  4A3J C;  2WAQ D;  4A3L K;  3GTP K;  3GTG K;  3M3Y K;  2Y0S D;  4BY7 C;  4A3D C;  3GTQ C;  3FKI K;  5IP7 C;  2WAQ L;  5C4J K;  4LLG A;  5C44 K;  4A3F C;  3DXJ A;  4A3G C;  1TWF C;  4BBR K;  2R93 C;  2Y0S L;  3HKZ L;  1R9T C;  2BE5 A;  4A93 C;  3CQZ K;  2JA7 C;  4YG2 A;  4BY1 K;  2PMZ D;  4A3J K;  4Y52 C;  1SMY A;  4MEY A;  1I6V A;  3GTQ K;  4QJV A;  3S1R K;  2E2I K;  2NVX C;  5TMF A;  4A3F K;  3GTO C;  3GTL C;  3M3Y C;  3FKI C;  5C4X K;  4A3G K;  5C44 C;  2E2H C;  1R9T K;  3RZO K;  4A93 K;  3HOY K;  4Y7N C;  2JA7 K;  3PO3 C;  2A69 A;  3CQZ C;  2O5I A;  4C3H K;  3I4M K;  4Y52 K;  4YFN A;  1I6H C;  3GTM C;  4XLN A;  1TWA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...