5IP7K

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5ip7K00
3GTOC 3GTKK 3S14C 2NVTC 4A93K 2JA5K 3EQLA 2NVYK 1I50K 5IYCK 3HOXK 4G7ZA 1Y1WC 2O5JA 4YFKA 3GTJK 4BBSK 3I4NC 1R9TK 1Y1VK 4ZH4A 5FLMK 4Q4ZA 4LK1A 4A3FK 2JA6C 4QIWD 1K83C 2E2IC 2YU9K 4BBRK 4JK1A 4A3MK 1HQMA 3FKIC 4A3JK 2Y0SD 1I3QC 1TWHK 3H0GK 1SFOC 3HOUC 4BXXC 2PA8L 1I6HK 5M5YK 3I4MC 5IYBC 3S1QK 3S1RK 2B63K 5IYDK 3CQZK 2VUMK 2WB1D 5TMFA 3S1MC 3M3YK 4A93C 2JA5C 2NVYC 1I50C 5IYCC 4XLNA 3HOXC 4A3EK 3HOWK 4BBSC 3GTJC 1R9TC 1Y1VC 5FLMC 1IW7A 4A3FC 4OIRA 2A69A 4BBRC 2YU9C 2JA7K 3S2DK 2A6EA 4A3CK 4A3MC 4A3JC 4QIWL 5C3EK 5TMCA 1TWHC 4KMUA 3H0GC 4NOIA 3H3VD 4A3BK 4Y52K 3HOVK 3S1QC 1BDFA 2Y0SL 5IYDC 3S1RC 2B63C 3PO2K 4A3GK 3CQZC 3S1NK 2E2JC 4YG2A 3DXJA 3M3YC 4C2MK 4A3DK 1TWFK 2A68A 5C44K 3HOZK 4OIOA 3M4OC 4A3EC 3HOWC 4G7OA 1I6VA 2WB1L 3GTLK 4QJVA 4C3IK 3GTKC 3GTPK 2JA8K 2JA7C 3S2DC 3WODA 2WAQD 3RZDK 4XSZA 1TWAK 4AYBD 2E2HK 5C3EC 4A3BC 3PO3K 4XLPA 2A6HA 5M3FK 1YNJA 4Y52C 5D4DA 4G7HA 3RZOK 5IP7K 3S15K 5C4XK 4YFXA 2NVQK 3I4NK 3HOVC 3HKZD 5C4JK 2R92K 3S2HK 3H3VL 4A3KK 2PPBA 4BY7K 4A3IK 3S1NC 2PMZD 4MEXA 1TWCK 4Y7NK 4MQ9A 1SMYA 4OINA 4OIQA 3GTMK 1TWFC 5C44C 4A3DC 5M5WK 3HOZC 5IP9K 4OIPA 1WCMK 2VUMC 4X6AK 4LJZA 4A3LK 3GTLC 4BY1K 1TWGK 4LLGA 3GTPC 2R7ZK 3GTGK 5M3MK 2NVXK 3S16K 3RZDC 3S17K 1TWAC 2E2HC 3HOYK 3PO3C 3S15C 1I6HC 3RZOC 4A3CC 3K7AK 2WAQL 5IP7C 2CW0A 2NVQC 3GTQK 2R93K 5C4XC 3GTOK 3S14K 4C3HK 5M5XK 5C4JC 4AYBL 2NVTK 4KN4A 4LK0A 1Y1WK 4A3KC 2R92C 3S2HC 4BY7C 4A3IC 1TWCC 4Y7NC 4Q5SA 1ZYRA 3HKZL 4C3JK 1K83K 2E2IK 2JA6K 3GTMC 4GZYA 3PO2C 5IP9C 2O5IA 1WCMC 3FKIK 4A3GC 2PA8D 4X6AC 4A3LC 2PMZL 1YNNA 1TWGC 4BY1C 1I3QK 2R7ZC 1SFOK 4BXXK 3HOUK 3GTGC 2NVXC 3S16C 4YFNA 2E2JK 4XSXA 1XPPA 3S17C 4QJVB 3I4MK 5IYBK 3HOYC 2BE5A 4MEYA 2JA8C 3M4OK 3K7AC 3S1MK 4KN7A 5FJ8K 3GTQC 2R93C
chains in the Genus database with same CATH superfamily
3S14C 3GTKK 4A93K 2JA5K 1V5VA 2NVYK 1I50K 1WCMA 5IYCK 4YFKA 3OREA 2R7ZA 5JVOA 3GEIA 3GTGA 4KAWX 2P8TA 3N0CA 4A3JK 4KMAA 1WORA 4BXXC 3H0GK 1SFOC 3HOUC 1R9TA 4GTLA 2XCQA 5M5YK 5IYBC 1XZQB 3S1QK 2JA6A 4A93C 2XCOA 2JA5C 2NVYC 1I50C 3G4AA 3FKIA 5IYCC 3HOWK 1I3QA 1DCPA 3LPXA 5EGHA 2B63A 4A3CK 3FOEA 4A3JC 5C3EK 4KMUA 3H0GC 4NOIA 2XCRB 4O2DA 2FQOA 1BDFA 3S1QC 3GTJA 3DXJA 4A3DK 1TWFK 1WQHA 2A68A 1G51A 5C44K 3HOWC 1B4BA 3WODA 1XXCA 1JOEA 1JQWA 4XSZA 3A8IA 5C3EC 4XLPA 3S15K 3CQZA 1I6HK 4LOWA 3RZOK 2VUMA 1EH1A 3FOFA 3HKZD 5C4JK 4BY7K 3S2HK 2W7VA 3AD7C 2PMZD 4MEXA 4Y7NK 4OINA 4OIQA 3TTGA 4A3DC 4WJ3M 1TWFC 5C44C 2JA7A 5IP9K 4X6AK 4RMFA 2GSUA 1WOSA 3A8KA 2R92A 2V6TA 1WSVA 4LR2A 3ADAC 3S17K 3GIRA 3S15C 1I6HC 3RZOC 4GTDA 1DCHA 4C3HK 5C4JC 4BY7C 1Y1WK 3S2HC 3T02A 1IBAA 3BUEA 1J98A 1PJ5A 4Y7NC 1IE0A 3VA7A 3HKZL 4XCHA 1K83K 1O27A 5IP9C 2O5IA 4A3GC 4X6AC 1TWAA 2PMZL 2ZUEA 4XSXA 3S17C 1XXAA 4QJVB 3I4MK 4GTFA 1TWCA 5JFEA 1Y1WC 2O5JA 3I4NC 1Y1VK 4ZH4A 5FLMK 1VLOA 1K83C 2YU9K 4BBRK 4G0WA 1O24A 2JA5A 1I50A 1TWHK 1AB4A 2R93A 3I4MC 4KB4A 4C45A 3S1RK 4KMHA 4WILA 2E2IA 1WQGA 1Y1VC 5FLMC 1IW7A 1F93A 4J3NA 1IQ0A 2A69A 4BBRC 2YU9C 2A6EA 2D6FC 1J6WA 3LAJA 5TMCA 1TWHC 1O2AA 1YCLA 4Y52K 1VJEA 1J6XA 3HOVK 2P5MA 1XXBA 3L4KA 4P5AA 3S1RC 1J6VA 4BKWA 1DD5A 1X31C 4KM9A 3HOZK 1I6VA 5L46A 3GTLK 4M1XA 4QJVA 3GTKC 3GTPK 2JA8K 2WAQD 1VGXA 4AYBD 2E2HK 4P9SA 4Y52C 2RH6A 5C4XK 2GAHC 3HOVC 4A3KK 2PPBA 4A3IK 4MQ9A 1O2FB 4GFQA 1ISEA 4KM8A 3HOZC 1WCMK 4A3LK 3GTLC 1TWGK 1VRQC 4LLGA 3GTPC 2R7ZK 3GTGK 1IS1A 1ZVUA 2E2HC 4A3CC 2FQTA 1JVIA 2WAQL 5C4XC 1USOA 5M5XK 4AYBL 4KN4A 4LK0A 4A3KC 4A3IC 1ZYRA 2JA6K 4C3JK 3GDZA 1WCMC 3FKIK 4A3LC 1TWGC 1BS2A 1I3QK 2R7ZC 1ZQ1C 3AD9C 1GE9A 3GTGC 4YFNA 2E2JK 1K83A 3M4OK 3S1MK 4KN7A 3GTMA 3EQLA 1O2BA 1DCOA 3TFIA 4BBSK 3GTJK 4Q4ZA 3MMLB 2JA6C 4JK1A 4GT9A 1HQMA 3FKIC 1C0AA 1BJTA 2Y0SD 1I3QC 4KC6A 3L4JA 3GTQA 1KQ4A 5IYDK 4PABA 3G4CA 3CQZK 2VUMK 3S1MC 3Q3QA 3M3YK 4XLNA 4BBSC 3GTJC 3AQPA 4FZBA 4OIRA 1WIHA 4C3HC 3NUHA 1XZPA 1SFOA 3GEHA 2JA7K 3H3VD 5EGEA 1USMA 3GTKA 1F9NA 1O26A 2NVYA 2Y0SL 3TFHA 3BP8C 5IYDC 3PO2K 3CQZC 5IOTA 3M3YC 1EK8A 4P5BA 1F7VA 1O29A 4OIOA 3FHZA 1PJ7A 4C3IK 3H0GA 2JA7C 3S0XA 3RZDK 1TWAK 3N0BA 5IORA 4KB2A 1L0WA 5CHPA 4G7HA 5IP7K 2NVQK 1WOPA 2Y3PA 1O28A 3H3VL 1TWCK 4GTCA 1SMYA 2E2HA 2CFAB 2V6UA 4OIPA 4LJZA 5HL8A 4C3IC 3SZYA 4BLBA 5M3MK 2NVXK 3S16K 3RZDC 1TWAC 5IP7C 1WQFA 2NVQC 1TWGA 2R93K 3IPJA 3GTOK 1TWFA 1PJ6A 2NVTK 1WOOA 1B4AA 4KATA 1TWCC 2E2IK 3N3YA 4GZYA 3ERED 4GTAA 2PA8D 3GEEA 4G0VA 4DDQA 1YNNA 3OPFA 3A8JA 2NVXC 3S16C 1XPPA 2V6SA 1YX2A 2BE5A 2JA8C 3LAPA 3GSIA 3AD8C 2GSNA 2R93C 3GTOC 4FM9A 2NVTC 1XZPB 3CAGA 3HOXK 4G7ZA 1R9TK 1IL2A 4A3FK 4LK1A 4QIWD 2E2IC 3TFJA 4A3MK 4PAAA 2PHCB 1ZBSA 2GAGC 2PA8L 1Y1WA 2CFAA 2B63K 3JSTA 1UV7A 2WB1D 5TMFA 1EI6A 2JH3A 5CJ9A 2GSOA 3QX3A 3HOXC 4A3EK 1VH2A 1R9TC 4GTBA 4A3FC 3S2DK 4A3MC 3T01A 1ZXOA 4C3JC 4QIWL 4A3BK 2ZUFA 2B63C 4A3GK 1Y1VA 3S1NK 2E2JC 4YG2A 4C2MK 1XZQA 2YU9A 4WJ4A 3HXAA 3M4OC 4A3EC 4G7OA 4ILDA 4BLAA 2WB1L 1HI9A 1RU0A 1TWHA 3S2DC 4AH6A 2RGRA 5TJ3A 4A3BC 3PO3K 2EBBA 2A6HA 5M3FK 1YNJA 3BP3A 5D4DA 4YFXA 3I4NK 3AQOA 4KASA 5IOSA 2R92K 1WSRA 1EQRA 2ZFZA 3S1NC 4C2MC 4LQYA 3GTMK 4KDDA 5M5WK 2VUMC 4BY1K 3SZZA 4KARA 3V4GA 3AH5A 4KMDA 3HOYK 3OEPA 3PO3C 1INNA 3K7AK 1BGWA 2CW0A 3GTQK 3S14K 1F7UA 2R92C 2NVXA 5IOQA 2KWAA 3GTLA 4Q5SA 3GTMC 3GTPA 4G0UA 3PO2C 3GTOA 5E68A 4GTEA 4BY1C 1O25A 4BXXK 1SFOK 3HOUK 5IYBK 3HOYC 1EFWA 4MEYA 3T00A 3K7AC 5FJ8K 3GTQC
chains in the Genus database with same CATH topology
3GTOC 3GTKK 3S14C 2NVTC 4A93K 2JA5K 3EQLA 2NVYK 1I50K 5IYCK 3HOXK 4G7ZA 1Y1WC 2O5JA 4YFKA 3GTJK 4BBSK 3I4NC 1R9TK 1Y1VK 4ZH4A 5FLMK 4Q4ZA 4LK1A 4A3FK 2JA6C 4QIWD 1K83C 2E2IC 2YU9K 4BBRK 4JK1A 4A3MK 1HQMA 3FKIC 4A3JK 2Y0SD 1I3QC 1TWHK 3H0GK 1SFOC 3HOUC 4BXXC 2PA8L 1I6HK 5M5YK 3I4MC 5IYBC 3S1QK 3S1RK 2B63K 5IYDK 3CQZK 2VUMK 2WB1D 5TMFA 3S1MC 3M3YK 4A93C 2JA5C 2NVYC 1I50C 5IYCC 4XLNA 3HOXC 4A3EK 3HOWK 4BBSC 3GTJC 1R9TC 1Y1VC 5FLMC 1IW7A 4A3FC 4OIRA 2A69A 4BBRC 2YU9C 2JA7K 3S2DK 2A6EA 4A3CK 4A3MC 4A3JC 4QIWL 5C3EK 5TMCA 1TWHC 4KMUA 3H0GC 4NOIA 3H3VD 4A3BK 4Y52K 3HOVK 3S1QC 1BDFA 2Y0SL 5IYDC 3S1RC 2B63C 3PO2K 4A3GK 3CQZC 3S1NK 2E2JC 4YG2A 3DXJA 3M3YC 4C2MK 4A3DK 1TWFK 2A68A 5C44K 3HOZK 4OIOA 3M4OC 4A3EC 3HOWC 4G7OA 1I6VA 2WB1L 3GTLK 4QJVA 4C3IK 3GTKC 3GTPK 2JA8K 2JA7C 3S2DC 3WODA 2WAQD 3RZDK 4XSZA 1TWAK 4AYBD 2E2HK 5C3EC 4A3BC 3PO3K 4XLPA 2A6HA 5M3FK 1YNJA 4Y52C 5D4DA 4G7HA 3RZOK 5IP7K 3S15K 5C4XK 4YFXA 2NVQK 3I4NK 3HOVC 3HKZD 5C4JK 2R92K 3S2HK 3H3VL 4A3KK 2PPBA 4BY7K 4A3IK 3S1NC 2PMZD 4MEXA 1TWCK 4Y7NK 4MQ9A 1SMYA 4OINA 4OIQA 3GTMK 1TWFC 5C44C 4A3DC 5M5WK 3HOZC 5IP9K 4OIPA 1WCMK 2VUMC 4X6AK 4LJZA 4A3LK 3GTLC 4BY1K 1TWGK 4LLGA 3GTPC 2R7ZK 3GTGK 5M3MK 2NVXK 3S16K 3RZDC 3S17K 1TWAC 2E2HC 3HOYK 3PO3C 3S15C 1I6HC 3RZOC 4A3CC 3K7AK 2WAQL 5IP7C 2CW0A 2NVQC 3GTQK 2R93K 5C4XC 3GTOK 3S14K 4C3HK 5M5XK 5C4JC 4AYBL 2NVTK 4KN4A 4LK0A 1Y1WK 4A3KC 2R92C 3S2HC 4BY7C 4A3IC 1TWCC 4Y7NC 4Q5SA 1ZYRA 3HKZL 4C3JK 1K83K 2E2IK 2JA6K 3GTMC 4GZYA 3PO2C 5IP9C 2O5IA 1WCMC 3FKIK 4A3GC 2PA8D 4X6AC 4A3LC 2PMZL 1YNNA 1TWGC 4BY1C 1I3QK 2R7ZC 1SFOK 4BXXK 3HOUK 3GTGC 2NVXC 3S16C 4YFNA 2E2JK 4XSXA 1XPPA 3S17C 4QJVB 3I4MK 5IYBK 3HOYC 2BE5A 4MEYA 2JA8C 3M4OK 3K7AC 3S1MK 4KN7A 5FJ8K 3GTQC 2R93C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO C;  3GTK K;  3S14 C;  2NVT C;  4A93 K;  2JA5 K;  3EQL A;  2NVY K;  1I50 K;  5IYC K;  3HOX K;  4G7Z A;  1Y1W C;  2O5J A;  4YFK A;  3GTJ K;  4BBS K;  3I4N C;  1R9T K;  1Y1V K;  4ZH4 A;  5FLM K;  4Q4Z A;  4LK1 A;  4A3F K;  2JA6 C;  4QIW D;  1K83 C;  2E2I C;  2YU9 K;  4BBR K;  4JK1 A;  4A3M K;  1HQM A;  3FKI C;  4A3J K;  2Y0S D;  1I3Q C;  1TWH K;  3H0G K;  1SFO C;  3HOU C;  4BXX C;  2PA8 L;  1I6H K;  5M5Y K;  3I4M C;  5IYB C;  3S1Q K;  3S1R K;  2B63 K;  5IYD K;  3CQZ K;  2VUM K;  2WB1 D;  5TMF A;  3S1M C;  3M3Y K;  4A93 C;  2JA5 C;  2NVY C;  1I50 C;  5IYC C;  4XLN A;  3HOX C;  4A3E K;  3HOW K;  4BBS C;  3GTJ C;  1R9T C;  1Y1V C;  5FLM C;  1IW7 A;  4A3F C;  4OIR A;  2A69 A;  4BBR C;  2YU9 C;  2JA7 K;  3S2D K;  2A6E A;  4A3C K;  4A3M C;  4A3J C;  4QIW L;  5C3E K;  5TMC A;  1TWH C;  4KMU A;  3H0G C;  4NOI A;  3H3V D;  4A3B K;  4Y52 K;  3HOV K;  3S1Q C;  1BDF A;  2Y0S L;  5IYD C;  3S1R C;  2B63 C;  3PO2 K;  4A3G K;  3CQZ C;  3S1N K;  2E2J C;  4YG2 A;  3DXJ A;  3M3Y C;  4C2M K;  4A3D K;  1TWF K;  2A68 A;  5C44 K;  3HOZ K;  4OIO A;  3M4O C;  4A3E C;  3HOW C;  4G7O A;  1I6V A;  2WB1 L;  3GTL K;  4QJV A;  4C3I K;  3GTK C;  3GTP K;  2JA8 K;  2JA7 C;  3S2D C;  3WOD A;  2WAQ D;  3RZD K;  4XSZ A;  1TWA K;  4AYB D;  2E2H K;  5C3E C;  4A3B C;  3PO3 K;  4XLP A;  2A6H A;  5M3F K;  1YNJ A;  4Y52 C;  5D4D A;  4G7H A;  3RZO K;  5IP7 K;  3S15 K;  5C4X K;  4YFX A;  2NVQ K;  3I4N K;  3HOV C;  3HKZ D;  5C4J K;  2R92 K;  3S2H K;  3H3V L;  4A3K K;  2PPB A;  4BY7 K;  4A3I K;  3S1N C;  2PMZ D;  4MEX A;  1TWC K;  4Y7N K;  4MQ9 A;  1SMY A;  4OIN A;  4OIQ A;  3GTM K;  1TWF C;  5C44 C;  4A3D C;  5M5W K;  3HOZ C;  5IP9 K;  4OIP A;  1WCM K;  2VUM C;  4X6A K;  4LJZ A;  4A3L K;  3GTL C;  4BY1 K;  1TWG K;  4LLG A;  3GTP C;  2R7Z K;  3GTG K;  5M3M K;  2NVX K;  3S16 K;  3RZD C;  3S17 K;  1TWA C;  2E2H C;  3HOY K;  3PO3 C;  3S15 C;  1I6H C;  3RZO C;  4A3C C;  3K7A K;  2WAQ L;  5IP7 C;  2CW0 A;  2NVQ C;  3GTQ K;  2R93 K;  5C4X C;  3GTO K;  3S14 K;  4C3H K;  5M5X K;  5C4J C;  4AYB L;  2NVT K;  4KN4 A;  4LK0 A;  1Y1W K;  4A3K C;  2R92 C;  3S2H C;  4BY7 C;  4A3I C;  1TWC C;  4Y7N C;  4Q5S A;  1ZYR A;  3HKZ L;  4C3J K;  1K83 K;  2E2I K;  2JA6 K;  3GTM C;  4GZY A;  3PO2 C;  5IP9 C;  2O5I A;  1WCM C;  3FKI K;  4A3G C;  2PA8 D;  4X6A C;  4A3L C;  2PMZ L;  1YNN A;  1TWG C;  4BY1 C;  1I3Q K;  2R7Z C;  1SFO K;  4BXX K;  3HOU K;  3GTG C;  2NVX C;  3S16 C;  4YFN A;  2E2J K;  4XSX A;  1XPP A;  3S17 C;  4QJV B;  3I4M K;  5IYB K;  3HOY C;  2BE5 A;  4MEY A;  2JA8 C;  3M4O K;  3K7A C;  3S1M K;  4KN7 A;  5FJ8 K;  3GTQ C;  2R93 C; 
#chains in the Genus database with same CATH topology
 3S14 C;  3GTK K;  4A93 K;  2JA5 K;  1V5V A;  2NVY K;  1I50 K;  1WCM A;  5IYC K;  4YFK A;  3ORE A;  2R7Z A;  5JVO A;  3GEI A;  3GTG A;  4KAW X;  2P8T A;  3N0C A;  4A3J K;  4KMA A;  1WOR A;  4BXX C;  3H0G K;  1SFO C;  3HOU C;  1R9T A;  4GTL A;  2XCQ A;  5M5Y K;  5IYB C;  1XZQ B;  3S1Q K;  2JA6 A;  4A93 C;  2XCO A;  2JA5 C;  2NVY C;  1I50 C;  3G4A A;  3FKI A;  5IYC C;  3HOW K;  1I3Q A;  1DCP A;  3LPX A;  5EGH A;  2B63 A;  4A3C K;  3FOE A;  4A3J C;  5C3E K;  4KMU A;  3H0G C;  4NOI A;  2XCR B;  4O2D A;  2FQO A;  1BDF A;  3S1Q C;  3GTJ A;  3DXJ A;  4A3D K;  1TWF K;  1WQH A;  2A68 A;  1G51 A;  5C44 K;  3HOW C;  1B4B A;  3WOD A;  1XXC A;  1JOE A;  1JQW A;  4XSZ A;  3A8I A;  5C3E C;  4XLP A;  3S15 K;  3CQZ A;  1I6H K;  4LOW A;  3RZO K;  2VUM A;  1EH1 A;  3FOF A;  3HKZ D;  5C4J K;  4BY7 K;  3S2H K;  2W7V A;  3AD7 C;  2PMZ D;  4MEX A;  4Y7N K;  4OIN A;  4OIQ A;  3TTG A;  4A3D C;  4WJ3 M;  1TWF C;  5C44 C;  2JA7 A;  5IP9 K;  4X6A K;  4RMF A;  2GSU A;  1WOS A;  3A8K A;  2R92 A;  2V6T A;  1WSV A;  4LR2 A;  3ADA C;  3S17 K;  3GIR A;  3S15 C;  1I6H C;  3RZO C;  4GTD A;  1DCH A;  4C3H K;  5C4J C;  4BY7 C;  1Y1W K;  3S2H C;  3T02 A;  1IBA A;  3BUE A;  1J98 A;  1PJ5 A;  4Y7N C;  1IE0 A;  3VA7 A;  3HKZ L;  4XCH A;  1K83 K;  1O27 A;  5IP9 C;  2O5I A;  4A3G C;  4X6A C;  1TWA A;  2PMZ L;  2ZUE A;  4XSX A;  3S17 C;  1XXA A;  4QJV B;  3I4M K;  4GTF A;  1TWC A;  5JFE A;  1Y1W C;  2O5J A;  3I4N C;  1Y1V K;  4ZH4 A;  5FLM K;  1VLO A;  1K83 C;  2YU9 K;  4BBR K;  4G0W A;  1O24 A;  2JA5 A;  1I50 A;  1TWH K;  1AB4 A;  2R93 A;  3I4M C;  4KB4 A;  4C45 A;  3S1R K;  4KMH A;  4WIL A;  2E2I A;  1WQG A;  1Y1V C;  5FLM C;  1IW7 A;  1F93 A;  4J3N A;  1IQ0 A;  2A69 A;  4BBR C;  2YU9 C;  2A6E A;  2D6F C;  1J6W A;  3LAJ A;  5TMC A;  1TWH C;  1O2A A;  1YCL A;  4Y52 K;  1VJE A;  1J6X A;  3HOV K;  2P5M A;  1XXB A;  3L4K A;  4P5A A;  3S1R C;  1J6V A;  4BKW A;  1DD5 A;  1X31 C;  4KM9 A;  3HOZ K;  1I6V A;  5L46 A;  3GTL K;  4M1X A;  4QJV A;  3GTK C;  3GTP K;  2JA8 K;  2WAQ D;  1VGX A;  4AYB D;  2E2H K;  4P9S A;  4Y52 C;  2RH6 A;  5C4X K;  2GAH C;  3HOV C;  4A3K K;  2PPB A;  4A3I K;  4MQ9 A;  1O2F B;  4GFQ A;  1ISE A;  4KM8 A;  3HOZ C;  1WCM K;  4A3L K;  3GTL C;  1TWG K;  1VRQ C;  4LLG A;  3GTP C;  2R7Z K;  3GTG K;  1IS1 A;  1ZVU A;  2E2H C;  4A3C C;  2FQT A;  1JVI A;  2WAQ L;  5C4X C;  1USO A;  5M5X K;  4AYB L;  4KN4 A;  4LK0 A;  4A3K C;  4A3I C;  1ZYR A;  2JA6 K;  4C3J K;  3GDZ A;  1WCM C;  3FKI K;  4A3L C;  1TWG C;  1BS2 A;  1I3Q K;  2R7Z C;  1ZQ1 C;  3AD9 C;  1GE9 A;  3GTG C;  4YFN A;  2E2J K;  1K83 A;  3M4O K;  3S1M K;  4KN7 A;  3GTM A;  3EQL A;  1O2B A;  1DCO A;  3TFI A;  4BBS K;  3GTJ K;  4Q4Z A;  3MML B;  2JA6 C;  4JK1 A;  4GT9 A;  1HQM A;  3FKI C;  1C0A A;  1BJT A;  2Y0S D;  1I3Q C;  4KC6 A;  3L4J A;  3GTQ A;  1KQ4 A;  5IYD K;  4PAB A;  3G4C A;  3CQZ K;  2VUM K;  3S1M C;  3Q3Q A;  3M3Y K;  4XLN A;  4BBS C;  3GTJ C;  3AQP A;  4FZB A;  4OIR A;  1WIH A;  4C3H C;  3NUH A;  1XZP A;  1SFO A;  3GEH A;  2JA7 K;  3H3V D;  5EGE A;  1USM A;  3GTK A;  1F9N A;  1O26 A;  2NVY A;  2Y0S L;  3TFH A;  3BP8 C;  5IYD C;  3PO2 K;  3CQZ C;  5IOT A;  3M3Y C;  1EK8 A;  4P5B A;  1F7V A;  1O29 A;  4OIO A;  3FHZ A;  1PJ7 A;  4C3I K;  3H0G A;  2JA7 C;  3S0X A;  3RZD K;  1TWA K;  3N0B A;  5IOR A;  4KB2 A;  1L0W A;  5CHP A;  4G7H A;  5IP7 K;  2NVQ K;  1WOP A;  2Y3P A;  1O28 A;  3H3V L;  1TWC K;  4GTC A;  1SMY A;  2E2H A;  2CFA B;  2V6U A;  4OIP A;  4LJZ A;  5HL8 A;  4C3I C;  3SZY A;  4BLB A;  5M3M K;  2NVX K;  3S16 K;  3RZD C;  1TWA C;  5IP7 C;  1WQF A;  2NVQ C;  1TWG A;  2R93 K;  3IPJ A;  3GTO K;  1TWF A;  1PJ6 A;  2NVT K;  1WOO A;  1B4A A;  4KAT A;  1TWC C;  2E2I K;  3N3Y A;  4GZY A;  3ERE D;  4GTA A;  2PA8 D;  3GEE A;  4G0V A;  4DDQ A;  1YNN A;  3OPF A;  3A8J A;  2NVX C;  3S16 C;  1XPP A;  2V6S A;  1YX2 A;  2BE5 A;  2JA8 C;  3LAP A;  3GSI A;  3AD8 C;  2GSN A;  2R93 C;  3GTO C;  4FM9 A;  2NVT C;  1XZP B;  3CAG A;  3HOX K;  4G7Z A;  1R9T K;  1IL2 A;  4A3F K;  4LK1 A;  4QIW D;  2E2I C;  3TFJ A;  4A3M K;  4PAA A;  2PHC B;  1ZBS A;  2GAG C;  2PA8 L;  1Y1W A;  2CFA A;  2B63 K;  3JST A;  1UV7 A;  2WB1 D;  5TMF A;  1EI6 A;  2JH3 A;  5CJ9 A;  2GSO A;  3QX3 A;  3HOX C;  4A3E K;  1VH2 A;  1R9T C;  4GTB A;  4A3F C;  3S2D K;  4A3M C;  3T01 A;  1ZXO A;  4C3J C;  4QIW L;  4A3B K;  2ZUF A;  2B63 C;  4A3G K;  1Y1V A;  3S1N K;  2E2J C;  4YG2 A;  4C2M K;  1XZQ A;  2YU9 A;  4WJ4 A;  3HXA A;  3M4O C;  4A3E C;  4G7O A;  4ILD A;  4BLA A;  2WB1 L;  1HI9 A;  1RU0 A;  1TWH A;  3S2D C;  4AH6 A;  2RGR A;  5TJ3 A;  4A3B C;  3PO3 K;  2EBB A;  2A6H A;  5M3F K;  1YNJ A;  3BP3 A;  5D4D A;  4YFX A;  3I4N K;  3AQO A;  4KAS A;  5IOS A;  2R92 K;  1WSR A;  1EQR A;  2ZFZ A;  3S1N C;  4C2M C;  4LQY A;  3GTM K;  4KDD A;  5M5W K;  2VUM C;  4BY1 K;  3SZZ A;  4KAR A;  3V4G A;  3AH5 A;  4KMD A;  3HOY K;  3OEP A;  3PO3 C;  1INN A;  3K7A K;  1BGW A;  2CW0 A;  3GTQ K;  3S14 K;  1F7U A;  2R92 C;  2NVX A;  5IOQ A;  2KWA A;  3GTL A;  4Q5S A;  3GTM C;  3GTP A;  4G0U A;  3PO2 C;  3GTO A;  5E68 A;  4GTE A;  4BY1 C;  1O25 A;  4BXX K;  1SFO K;  3HOU K;  5IYB K;  3HOY C;  1EFW A;  4MEY A;  3T00 A;  3K7A C;  5FJ8 K;  3GTQ C; 
#chains in the Genus database with same CATH homology
 3GTO C;  3GTK K;  3S14 C;  2NVT C;  4A93 K;  2JA5 K;  3EQL A;  2NVY K;  1I50 K;  5IYC K;  3HOX K;  4G7Z A;  1Y1W C;  2O5J A;  4YFK A;  3GTJ K;  4BBS K;  3I4N C;  1R9T K;  1Y1V K;  4ZH4 A;  5FLM K;  4Q4Z A;  4LK1 A;  4A3F K;  2JA6 C;  4QIW D;  1K83 C;  2E2I C;  2YU9 K;  4BBR K;  4JK1 A;  4A3M K;  1HQM A;  3FKI C;  4A3J K;  2Y0S D;  1I3Q C;  1TWH K;  3H0G K;  1SFO C;  3HOU C;  4BXX C;  2PA8 L;  1I6H K;  5M5Y K;  3I4M C;  5IYB C;  3S1Q K;  3S1R K;  2B63 K;  5IYD K;  3CQZ K;  2VUM K;  2WB1 D;  5TMF A;  3S1M C;  3M3Y K;  4A93 C;  2JA5 C;  2NVY C;  1I50 C;  5IYC C;  4XLN A;  3HOX C;  4A3E K;  3HOW K;  4BBS C;  3GTJ C;  1R9T C;  1Y1V C;  5FLM C;  1IW7 A;  4A3F C;  4OIR A;  2A69 A;  4BBR C;  2YU9 C;  2JA7 K;  3S2D K;  2A6E A;  4A3C K;  4A3M C;  4A3J C;  4QIW L;  5C3E K;  5TMC A;  1TWH C;  4KMU A;  3H0G C;  4NOI A;  3H3V D;  4A3B K;  4Y52 K;  3HOV K;  3S1Q C;  1BDF A;  2Y0S L;  5IYD C;  3S1R C;  2B63 C;  3PO2 K;  4A3G K;  3CQZ C;  3S1N K;  2E2J C;  4YG2 A;  3DXJ A;  3M3Y C;  4C2M K;  4A3D K;  1TWF K;  2A68 A;  5C44 K;  3HOZ K;  4OIO A;  3M4O C;  4A3E C;  3HOW C;  4G7O A;  1I6V A;  2WB1 L;  3GTL K;  4QJV A;  4C3I K;  3GTK C;  3GTP K;  2JA8 K;  2JA7 C;  3S2D C;  3WOD A;  2WAQ D;  3RZD K;  4XSZ A;  1TWA K;  4AYB D;  2E2H K;  5C3E C;  4A3B C;  3PO3 K;  4XLP A;  2A6H A;  5M3F K;  1YNJ A;  4Y52 C;  5D4D A;  4G7H A;  3RZO K;  5IP7 K;  3S15 K;  5C4X K;  4YFX A;  2NVQ K;  3I4N K;  3HOV C;  3HKZ D;  5C4J K;  2R92 K;  3S2H K;  3H3V L;  4A3K K;  2PPB A;  4BY7 K;  4A3I K;  3S1N C;  2PMZ D;  4MEX A;  1TWC K;  4Y7N K;  4MQ9 A;  1SMY A;  4OIN A;  4OIQ A;  3GTM K;  1TWF C;  5C44 C;  4A3D C;  5M5W K;  3HOZ C;  5IP9 K;  4OIP A;  1WCM K;  2VUM C;  4X6A K;  4LJZ A;  4A3L K;  3GTL C;  4BY1 K;  1TWG K;  4LLG A;  3GTP C;  2R7Z K;  3GTG K;  5M3M K;  2NVX K;  3S16 K;  3RZD C;  3S17 K;  1TWA C;  2E2H C;  3HOY K;  3PO3 C;  3S15 C;  1I6H C;  3RZO C;  4A3C C;  3K7A K;  2WAQ L;  5IP7 C;  2CW0 A;  2NVQ C;  3GTQ K;  2R93 K;  5C4X C;  3GTO K;  3S14 K;  4C3H K;  5M5X K;  5C4J C;  4AYB L;  2NVT K;  4KN4 A;  4LK0 A;  1Y1W K;  4A3K C;  2R92 C;  3S2H C;  4BY7 C;  4A3I C;  1TWC C;  4Y7N C;  4Q5S A;  1ZYR A;  3HKZ L;  4C3J K;  1K83 K;  2E2I K;  2JA6 K;  3GTM C;  4GZY A;  3PO2 C;  5IP9 C;  2O5I A;  1WCM C;  3FKI K;  4A3G C;  2PA8 D;  4X6A C;  4A3L C;  2PMZ L;  1YNN A;  1TWG C;  4BY1 C;  1I3Q K;  2R7Z C;  1SFO K;  4BXX K;  3HOU K;  3GTG C;  2NVX C;  3S16 C;  4YFN A;  2E2J K;  4XSX A;  1XPP A;  3S17 C;  4QJV B;  3I4M K;  5IYB K;  3HOY C;  2BE5 A;  4MEY A;  2JA8 C;  3M4O K;  3K7A C;  3S1M K;  4KN7 A;  5FJ8 K;  3GTQ C;  2R93 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...