4GTAA

T. maritima fdts with fad, dump, and folinic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
215
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 79
structure length 215
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtaA00
5IOTA 5CHPA 4P5BA 5IORA 5IOSA 1O28A 4GTCA 5IOQA 3AH5A 4GTLA 4P5AA 4GTDA 1O2AA 2CFAB 3G4CA 2CFAA 4KASA 5JFEA 3N0BA 4GTFA 1O26A 3G4AA 4GT9A 4FZBA 1O29A 1O25A 1O24A 4KARA 4GTAA 3N3YA 4GTEA 1O2BA 3N0CA 4GTBA 4KATA 1KQ4A 1O27A
chains in the Genus database with same CATH superfamily
4OIRA 1IBAA 1BGWA 1F9NA 3GTQC 3HOZK 1VGXA 1VRQC 1EH1A 4AH6A 3IPJA 5IOQA 1YCLA 3RZDK 1HQMA 1WSVA 3JSTA 3N0BA 2R92K 3HOWK 1I50K 3HOWC 3ERED 1WORA 5C3EC 4A3MC 3N3YA 2NVQK 3M3YC 1BS2A 3I4NK 5JVOA 3TFHA 1UV7A 4P5BA 3S1QK 4A3DC 4KMDA 4A3MK 4C3JC 4GTLA 3S16K 3TFIA 5FJ8K 4PAAA 5EGHA 2E2JK 1K83A 1WCMA 4Y52K 4BY1K 4MEXA 4A3GC 4A3FC 2A6HA 1I3QC 4WILA 2BE5A 4WJ4A 4A3CK 3GTMC 1WSRA 3CAGA 3PO3C 4A3KK 3M4OK 4OIOA 1J98A 4KDDA 1DD5A 4A3GK 2JA7C 4C3IK 4A3JK 2E2IA 2XCOA 2WAQL 4A3LK 1J6WA 2CFAA 1R9TC 5IYDC 1WOOA 3ADAC 3OREA 1SFOK 3EQLA 2R7ZK 4KARA 2NVTC 1TWFC 4JK1A 5IP7C 2PHCB 3OEPA 4A3CC 4G7OA 1WOSA 3CQZA 1I50C 2V6UA 1TWAA 5C3EK 3AH5A 4GTDA 5C4JC 4WJ3M 1DCOA 4M1XA 3S17K 4G0UA 2WB1L 5JFEA 4Y7NK 3GTJK 3FHZA 2CW0A 1XZQA 1YNNA 3BP3A 5TJ3A 1Y1WA 3GEIA 5M3MK 1TWCC 1DCHA 2KWAA 1K83K 3GTGA 1AB4A 4BY1C 2WAQD 4P5AA 1DCPA 3CQZC 3LPXA 4O2DA 1TWGA 3S15C 3S0XA 2YU9C 4MQ9A 2R92C 1YX2A 1ZBSA 4KB2A 4KMUA 4A3IC 3T01A 2PMZL 1F7UA 3HOVC 2GAHC 2B63K 4GTBA 5D4DA 3S17C 2NVYC 4A3BC 3GTLC 2FQOA 1PJ7A 2B63C 4GTCA 1EFWA 3S2HC 1TWCK 1IS1A 4YFXA 4A93C 3K7AC 1EQRA 4C45A 4GTFA 1I6VA 3CQZK 4LQYA 4XLPA 1Y1VK 1B4BA 3AD8C 4ILDA 4PABA 2ZUFA 1TWAK 5C44K 4A3KC 3M4OC 1Y1VC 4Q5SA 1WQHA 4A3EC 4G7HA 1G51A 4A3FK 4XCHA 1K83C 5L46A 5M3FK 4RMFA 4KN7A 1TWGK 1ISEA 3GTOK 4BXXK 2JH3A 4J3NA 1WQGA 2NVTK 3GTGK 2B63A 2NVYK 4A3BK 3GTLA 2PA8D 1USOA 3S14K 1WOPA 3SZZA 1IW7A 4A3IK 1GE9A 1XZQB 3H3VL 4BXXC 3S1RC 4QJVA 2VUMA 3HKZD 1ZQ1C 5TMFA 4BBRC 1XZPA 1JVIA 1TWHA 5C4XC 1B4AA 1TWFA 3S2DC 2A69A 4A3JC 1IQ0A 1WQFA 5IYCK 2YU9K 1R9TK 3H0GC 3FKIK 1Y1WC 1TWCA 1EI6A 3HOYC 3I4MC 3GTKA 2GSOA 3BUEA 3AQPA 1VJEA 4GTEA 1XZPB 4KM8A 2JA6A 2JA5A 1WCMK 4KB4A 4OINA 4A3EK 1SMYA 3GTPA 1TWAC 5C44C 1I3QA 2JA7K 5IP9C 2P8TA 4BLAA 2O5JA 4KMAA 2R7ZA 1PJ6A 1TWHC 3HXAA 1WCMC 4XSZA 4QJVB 3GTJC 5IYDK 3BP8C 2PPBA 3S2DK 3S15K 2E2HA 4BBSC 3LAJA 4ZH4A 5C4JK 3A8JA 1VLOA 3TTGA 2NVYA 2Y0SL 4Q4ZA 5M5YK 4LOWA 3S1NC 1PJ5A 2E2IC 1R9TA 3GTJA 5IOSA 3S14C 2V6TA 1SFOC 4C3IC 1USMA 3GSIA 2NVXC 3GTKK 3GTMA 2XCQA 4C2MK 4FM9A 3S1NK 1X31C 1O2FB 3FKIC 2XCRB 3HOXK 2RGRA 2RH6A 3HOUC 3RZDC 4MEYA 4NOIA 1J6XA 1O2BA 3N0CA 1JQWA 4LK1A 3FOFA 2ZUEA 1KQ4A 3GTQA 3H0GA 2Y0SD 1JOEA 5C4XK 4QIWD 1BDFA 3HOYK 4C3JK 3I4MK 3S16C 3LAPA 4KAWX 4BBRK 4C2MC 3GEEA 4A3DK 4Y52C 1I6HK 3OPFA 1BJTA 5IP9K 1F93A 2GSUA 2R92A 4KN4A 5IYCC 1F7VA 2JA8K 5CJ9A 3AD7C 4YFKA 2E2HK 3M3YK 3QX3A 3GTMK 3A8IA 5TMCA 5HL8A 4BBSK 2GSNA 1O2AA 2D6FC 2CFAB 4A3LC 1C0AA 2NVQC 2R93A 4LJZA 4YG2A 2W7VA 3AQOA 2ZFZA 3H0GK 4GT9A 1O25A 3HKZL 4KMHA 3GTPC 1IL2A 1ZYRA 1Y1VA 3RZOK 2E2IK 1WIHA 5IYBC 4KATA 4OIQA 3PO2C 3I4NC 5CHPA 3HOUK 3GTLK 5FLMK 3HOXC 2JA6C 3H3VD 4XSXA 2A68A 3S2HK 3FOEA 3SZYA 1V5VA 1SFOA 4KM9A 4A93K 3G4CA 4QIWL 4KASA 3PO2K 4BY7C 3GTOA 4LK0A 3S1RK 2GAGC 3A8KA 2YU9A 2R93K 2VUMC 3GDZA 1TWGC 5IORA 3AD9C 2VUMK 2V6SA 4X6AK 3GTOC 1VH2A 1TWHK 3GTGC 4GZYA 3VA7A 4BLBA 2JA5C 2O5IA 3S1MK 2E2HC 1ZVUA 4OIPA 1TWFK 5IP7K 2JA5K 3NUHA 2JA6K 3RZOC 3S1MC 4FZBA 5EGEA 1O24A 4G0VA 3HOVK 3GTPK 1I3QK 2P5MA 2JA7A 4C3HK 3DXJA 3FKIA 3T00A 5IOTA 5M5WK 4YFNA 1Y1WK 5E68A 1O28A 3Q3QA 1I50A 2NVXA 2PMZD 2FQTA 2Y3PA 3GTKC 3WODA 3GIRA 2R93C 4Y7NC 3T02A 4KC6A 3V4GA 1L0WA 4LLGA 3S1QC 3G4AA 1O29A 2EBBA 4GTAA 3K7AK 1IE0A 1EK8A 4DDQA 4GFQA 4G7ZA 4XLNA 3TFJA 2JA8C 1XXAA 1XPPA 5FLMC 4AYBD 4P9SA 3L4JA 4LR2A 3PO3K 4BY7K 1INNA 2R7ZC 1XXBA 1J6VA 2WB1D 3L4KA 1YNJA 5IYBK 1HI9A 5M5XK 4BKWA 1O26A 1RU0A 2E2JC 3GTQK 3HOZC 2A6EA 1ZXOA 3GEHA 1I6HC 1XXCA 4X6AC 4AYBL 2NVXK 4C3HC 4G0WA 3MMLB 2PA8L 1O27A
chains in the Genus database with same CATH topology
1AB4A 1BGWA 1F9NA 5CHPA 3GTPA 1EH1A 1I3QA 5IOQA 3FOEA 4P5AA 4BLAA 4KMAA 1SFOA 4KM9A 2R7ZA 3G4CA 4KASA 3N0BA 3LPXA 1TWGA 3S0XA 1ZBSA 4KB2A 2E2HA 3GTOA 3LAJA 3ERED 3N3YA 2NVYA 4GTBA 5JVOA 2YU9A 4P5BA 1R9TA 3GTJA 5IORA 5IOSA 4KMDA 4GTCA 4C3IC 4GTLA 4C3JC 1IS1A 3GTMA 2XCQA 3VA7A 4FM9A 4BLBA 4GTFA 1ZVUA 4LQYA 5EGHA 3NUHA 1B4BA 4ILDA 2XCRB 1K83A 1WCMA 4FZBA 2RGRA 1WQHA 2RH6A 5EGEA 1O24A 4G0VA 2P5MA 2JA7A 1O2BA 3N0CA 3FOFA 3FKIA 1KQ4A 3GTQA 3H0GA 3CAGA 5IOTA 4KDDA 1DD5A 1O28A 3Q3QA 1I50A 1ISEA 2NVXA 2JH3A 3LAPA 2E2IA 2Y3PA 1WQGA 2XCOA 4KAWX 4J3NA 2B63A 2CFAA 3GTLA 4KC6A 4C2MC 3V4GA 3G4AA 1GE9A 1O29A 3OREA 4KARA 3OPFA 1BJTA 4GTAA 2VUMA 2GSUA 2R92A 1EK8A 4DDQA 4GFQA 5CJ9A 2PHCB 3QX3A 1TWHA 3OEPA 1XXAA 3GTGA 3L4JA 4LR2A 3CQZA 1B4AA 1TWFA 1TWAA 3AH5A 2GSNA 1XXBA 4GTDA 1WQFA 1O2AA 4M1XA 2CFAB 4G0UA 5JFEA 2R93A 3AQOA 3L4KA 2ZFZA 3FHZA 4BKWA 1O26A 4GT9A 1TWCA 1ZXOA 1O25A 1XXCA 5TJ3A 3GTKA 4KMHA 2GSOA 1Y1WA 3BUEA 3AQPA 4C3HC 4GTEA 4KM8A 4G0WA 2JA6A 2JA5A 1Y1VA 2KWAA 3MMLB 1WIHA 4KATA 1O27A 4KB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOT A;  5CHP A;  4P5B A;  5IOR A;  5IOS A;  1O28 A;  4GTC A;  5IOQ A;  3AH5 A;  4GTL A;  4P5A A;  4GTD A;  1O2A A;  2CFA B;  3G4C A;  2CFA A;  4KAS A;  5JFE A;  3N0B A;  4GTF A;  1O26 A;  3G4A A;  4GT9 A;  4FZB A;  1O29 A;  1O25 A;  1O24 A;  4KAR A;  4GTA A;  3N3Y A;  4GTE A;  1O2B A;  3N0C A;  4GTB A;  4KAT A;  1KQ4 A;  1O27 A; 
#chains in the Genus database with same CATH topology
 4OIR A;  1IBA A;  1BGW A;  1F9N A;  3GTQ C;  3HOZ K;  1VGX A;  1VRQ C;  1EH1 A;  4AH6 A;  3IPJ A;  5IOQ A;  1YCL A;  3RZD K;  1HQM A;  1WSV A;  3JST A;  3N0B A;  2R92 K;  3HOW K;  1I50 K;  3HOW C;  3ERE D;  1WOR A;  5C3E C;  4A3M C;  3N3Y A;  2NVQ K;  3M3Y C;  1BS2 A;  3I4N K;  5JVO A;  3TFH A;  1UV7 A;  4P5B A;  3S1Q K;  4A3D C;  4KMD A;  4A3M K;  4C3J C;  4GTL A;  3S16 K;  3TFI A;  5FJ8 K;  4PAA A;  5EGH A;  2E2J K;  1K83 A;  1WCM A;  4Y52 K;  4BY1 K;  4MEX A;  4A3G C;  4A3F C;  2A6H A;  1I3Q C;  4WIL A;  2BE5 A;  4WJ4 A;  4A3C K;  3GTM C;  1WSR A;  3CAG A;  3PO3 C;  4A3K K;  3M4O K;  4OIO A;  1J98 A;  4KDD A;  1DD5 A;  4A3G K;  2JA7 C;  4C3I K;  4A3J K;  2E2I A;  2XCO A;  2WAQ L;  4A3L K;  1J6W A;  2CFA A;  1R9T C;  5IYD C;  1WOO A;  3ADA C;  3ORE A;  1SFO K;  3EQL A;  2R7Z K;  4KAR A;  2NVT C;  1TWF C;  4JK1 A;  5IP7 C;  2PHC B;  3OEP A;  4A3C C;  4G7O A;  1WOS A;  3CQZ A;  1I50 C;  2V6U A;  1TWA A;  5C3E K;  3AH5 A;  4GTD A;  5C4J C;  4WJ3 M;  1DCO A;  4M1X A;  3S17 K;  4G0U A;  2WB1 L;  5JFE A;  4Y7N K;  3GTJ K;  3FHZ A;  2CW0 A;  1XZQ A;  1YNN A;  3BP3 A;  5TJ3 A;  1Y1W A;  3GEI A;  5M3M K;  1TWC C;  1DCH A;  2KWA A;  1K83 K;  3GTG A;  1AB4 A;  4BY1 C;  2WAQ D;  4P5A A;  1DCP A;  3CQZ C;  3LPX A;  4O2D A;  1TWG A;  3S15 C;  3S0X A;  2YU9 C;  4MQ9 A;  2R92 C;  1YX2 A;  1ZBS A;  4KB2 A;  4KMU A;  4A3I C;  3T01 A;  2PMZ L;  1F7U A;  3HOV C;  2GAH C;  2B63 K;  4GTB A;  5D4D A;  3S17 C;  2NVY C;  4A3B C;  3GTL C;  2FQO A;  1PJ7 A;  2B63 C;  4GTC A;  1EFW A;  3S2H C;  1TWC K;  1IS1 A;  4YFX A;  4A93 C;  3K7A C;  1EQR A;  4C45 A;  4GTF A;  1I6V A;  3CQZ K;  4LQY A;  4XLP A;  1Y1V K;  1B4B A;  3AD8 C;  4ILD A;  4PAB A;  2ZUF A;  1TWA K;  5C44 K;  4A3K C;  3M4O C;  1Y1V C;  4Q5S A;  1WQH A;  4A3E C;  4G7H A;  1G51 A;  4A3F K;  4XCH A;  1K83 C;  5L46 A;  5M3F K;  4RMF A;  4KN7 A;  1TWG K;  1ISE A;  3GTO K;  4BXX K;  2JH3 A;  4J3N A;  1WQG A;  2NVT K;  3GTG K;  2B63 A;  2NVY K;  4A3B K;  3GTL A;  2PA8 D;  1USO A;  3S14 K;  1WOP A;  3SZZ A;  1IW7 A;  4A3I K;  1GE9 A;  1XZQ B;  3H3V L;  4BXX C;  3S1R C;  4QJV A;  2VUM A;  3HKZ D;  1ZQ1 C;  5TMF A;  4BBR C;  1XZP A;  1JVI A;  1TWH A;  5C4X C;  1B4A A;  1TWF A;  3S2D C;  2A69 A;  4A3J C;  1IQ0 A;  1WQF A;  5IYC K;  2YU9 K;  1R9T K;  3H0G C;  3FKI K;  1Y1W C;  1TWC A;  1EI6 A;  3HOY C;  3I4M C;  3GTK A;  2GSO A;  3BUE A;  3AQP A;  1VJE A;  4GTE A;  1XZP B;  4KM8 A;  2JA6 A;  2JA5 A;  1WCM K;  4KB4 A;  4OIN A;  4A3E K;  1SMY A;  3GTP A;  1TWA C;  5C44 C;  1I3Q A;  2JA7 K;  5IP9 C;  2P8T A;  4BLA A;  2O5J A;  4KMA A;  2R7Z A;  1PJ6 A;  1TWH C;  3HXA A;  1WCM C;  4XSZ A;  4QJV B;  3GTJ C;  5IYD K;  3BP8 C;  2PPB A;  3S2D K;  3S15 K;  2E2H A;  4BBS C;  3LAJ A;  4ZH4 A;  5C4J K;  3A8J A;  1VLO A;  3TTG A;  2NVY A;  2Y0S L;  4Q4Z A;  5M5Y K;  4LOW A;  3S1N C;  1PJ5 A;  2E2I C;  1R9T A;  3GTJ A;  5IOS A;  3S14 C;  2V6T A;  1SFO C;  4C3I C;  1USM A;  3GSI A;  2NVX C;  3GTK K;  3GTM A;  2XCQ A;  4C2M K;  4FM9 A;  3S1N K;  1X31 C;  1O2F B;  3FKI C;  2XCR B;  3HOX K;  2RGR A;  2RH6 A;  3HOU C;  3RZD C;  4MEY A;  4NOI A;  1J6X A;  1O2B A;  3N0C A;  1JQW A;  4LK1 A;  3FOF A;  2ZUE A;  1KQ4 A;  3GTQ A;  3H0G A;  2Y0S D;  1JOE A;  5C4X K;  4QIW D;  1BDF A;  3HOY K;  4C3J K;  3I4M K;  3S16 C;  3LAP A;  4KAW X;  4BBR K;  4C2M C;  3GEE A;  4A3D K;  4Y52 C;  1I6H K;  3OPF A;  1BJT A;  5IP9 K;  1F93 A;  2GSU A;  2R92 A;  4KN4 A;  5IYC C;  1F7V A;  2JA8 K;  5CJ9 A;  3AD7 C;  4YFK A;  2E2H K;  3M3Y K;  3QX3 A;  3GTM K;  3A8I A;  5TMC A;  5HL8 A;  4BBS K;  2GSN A;  1O2A A;  2D6F C;  2CFA B;  4A3L C;  1C0A A;  2NVQ C;  2R93 A;  4LJZ A;  4YG2 A;  2W7V A;  3AQO A;  2ZFZ A;  3H0G K;  4GT9 A;  1O25 A;  3HKZ L;  4KMH A;  3GTP C;  1IL2 A;  1ZYR A;  1Y1V A;  3RZO K;  2E2I K;  1WIH A;  5IYB C;  4KAT A;  4OIQ A;  3PO2 C;  3I4N C;  5CHP A;  3HOU K;  3GTL K;  5FLM K;  3HOX C;  2JA6 C;  3H3V D;  4XSX A;  2A68 A;  3S2H K;  3FOE A;  3SZY A;  1V5V A;  1SFO A;  4KM9 A;  4A93 K;  3G4C A;  4QIW L;  4KAS A;  3PO2 K;  4BY7 C;  3GTO A;  4LK0 A;  3S1R K;  2GAG C;  3A8K A;  2YU9 A;  2R93 K;  2VUM C;  3GDZ A;  1TWG C;  5IOR A;  3AD9 C;  2VUM K;  2V6S A;  4X6A K;  3GTO C;  1VH2 A;  1TWH K;  3GTG C;  4GZY A;  3VA7 A;  4BLB A;  2JA5 C;  2O5I A;  3S1M K;  2E2H C;  1ZVU A;  4OIP A;  1TWF K;  5IP7 K;  2JA5 K;  3NUH A;  2JA6 K;  3RZO C;  3S1M C;  4FZB A;  5EGE A;  1O24 A;  4G0V A;  3HOV K;  3GTP K;  1I3Q K;  2P5M A;  2JA7 A;  4C3H K;  3DXJ A;  3FKI A;  3T00 A;  5IOT A;  5M5W K;  4YFN A;  1Y1W K;  5E68 A;  1O28 A;  3Q3Q A;  1I50 A;  2NVX A;  2PMZ D;  2FQT A;  2Y3P A;  3GTK C;  3WOD A;  3GIR A;  2R93 C;  4Y7N C;  3T02 A;  4KC6 A;  3V4G A;  1L0W A;  4LLG A;  3S1Q C;  3G4A A;  1O29 A;  2EBB A;  4GTA A;  3K7A K;  1IE0 A;  1EK8 A;  4DDQ A;  4GFQ A;  4G7Z A;  4XLN A;  3TFJ A;  2JA8 C;  1XXA A;  1XPP A;  5FLM C;  4AYB D;  4P9S A;  3L4J A;  4LR2 A;  3PO3 K;  4BY7 K;  1INN A;  2R7Z C;  1XXB A;  1J6V A;  2WB1 D;  3L4K A;  1YNJ A;  5IYB K;  1HI9 A;  5M5X K;  4BKW A;  1O26 A;  1RU0 A;  2E2J C;  3GTQ K;  3HOZ C;  2A6E A;  1ZXO A;  3GEH A;  1I6H C;  1XXC A;  4X6A C;  4AYB L;  2NVX K;  4C3H C;  4G0W A;  3MML B;  2PA8 L;  1O27 A; 
#chains in the Genus database with same CATH homology
 1AB4 A;  1BGW A;  1F9N A;  5CHP A;  3GTP A;  1EH1 A;  1I3Q A;  5IOQ A;  3FOE A;  4P5A A;  4BLA A;  4KMA A;  1SFO A;  4KM9 A;  2R7Z A;  3G4C A;  4KAS A;  3N0B A;  3LPX A;  1TWG A;  3S0X A;  1ZBS A;  4KB2 A;  2E2H A;  3GTO A;  3LAJ A;  3ERE D;  3N3Y A;  2NVY A;  4GTB A;  5JVO A;  2YU9 A;  4P5B A;  1R9T A;  3GTJ A;  5IOR A;  5IOS A;  4KMD A;  4GTC A;  4C3I C;  4GTL A;  4C3J C;  1IS1 A;  3GTM A;  2XCQ A;  3VA7 A;  4FM9 A;  4BLB A;  4GTF A;  1ZVU A;  4LQY A;  5EGH A;  3NUH A;  1B4B A;  4ILD A;  2XCR B;  1K83 A;  1WCM A;  4FZB A;  2RGR A;  1WQH A;  2RH6 A;  5EGE A;  1O24 A;  4G0V A;  2P5M A;  2JA7 A;  1O2B A;  3N0C A;  3FOF A;  3FKI A;  1KQ4 A;  3GTQ A;  3H0G A;  3CAG A;  5IOT A;  4KDD A;  1DD5 A;  1O28 A;  3Q3Q A;  1I50 A;  1ISE A;  2NVX A;  2JH3 A;  3LAP A;  2E2I A;  2Y3P A;  1WQG A;  2XCO A;  4KAW X;  4J3N A;  2B63 A;  2CFA A;  3GTL A;  4KC6 A;  4C2M C;  3V4G A;  3G4A A;  1GE9 A;  1O29 A;  3ORE A;  4KAR A;  3OPF A;  1BJT A;  4GTA A;  2VUM A;  2GSU A;  2R92 A;  1EK8 A;  4DDQ A;  4GFQ A;  5CJ9 A;  2PHC B;  3QX3 A;  1TWH A;  3OEP A;  1XXA A;  3GTG A;  3L4J A;  4LR2 A;  3CQZ A;  1B4A A;  1TWF A;  1TWA A;  3AH5 A;  2GSN A;  1XXB A;  4GTD A;  1WQF A;  1O2A A;  4M1X A;  2CFA B;  4G0U A;  5JFE A;  2R93 A;  3AQO A;  3L4K A;  2ZFZ A;  3FHZ A;  4BKW A;  1O26 A;  4GT9 A;  1TWC A;  1ZXO A;  1O25 A;  1XXC A;  5TJ3 A;  3GTK A;  4KMH A;  2GSO A;  1Y1W A;  3BUE A;  3AQP A;  4C3H C;  4GTE A;  4KM8 A;  4G0W A;  2JA6 A;  2JA5 A;  1Y1V A;  2KWA A;  3MML B;  1WIH A;  4KAT A;  1O27 A;  4KB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...