4GTAA

T. maritima fdts with fad, dump, and folinic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
215
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 79
structure length 215
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtaA00
2CFAB 1O2AA 5IOQA 1O24A 4KASA 3N3YA 5IOSA 4GTCA 3G4CA 5CHPA 1O25A 4GTFA 2CFAA 5IORA 1O27A 4GT9A 4GTEA 1KQ4A 4GTDA 3N0BA 1O2BA 4P5BA 5JFEA 4KATA 4GTLA 4FZBA 1O28A 4KARA 1O29A 4GTAA 3G4AA 4GTBA 3AH5A 1O26A 4P5AA 3N0CA 5IOTA
chains in the Genus database with same CATH superfamily
2WAQD 1TWAC 3DXJA 3S1QC 4A3EK 3GSIA 3GTGC 4KM9A 3CQZC 4OIQA 4Q5SA 1F93A 4RMFA 3I4NC 1XPPA 1YCLA 5IYCK 3GTKC 3HOWK 4C3JK 3H0GC 4G0UA 2E2IC 1O2FB 3BP3A 3S1NC 1K83K 2Y0SD 3I4MC 1SFOC 1Y1VC 4A3CK 3AD7C 1PJ7A 4AH6A 4KMAA 4A3GC 1IS1A 5TMCA 5C4JC 4GTBA 1IBAA 3M3YC 2JA6C 3S14C 2ZUFA 1USOA 4A3MK 4YFNA 4A3JK 5C3EK 4GZYA 1TWAA 2JH3A 4BBRK 1X31C 1R9TC 3GTPA 1GE9A 1I6HK 3PO2C 3VA7A 4KN4A 3S16K 1TWAK 4OIOA 3S1QK 5JVOA 1WQFA 3N0BA 3GTQA 2GSUA 3GTGK 3CQZK 4A3LC 2E2IA 4XCHA 4BY1K 3GTKK 3H0GK 4LK0A 3S1MC 2JA8C 2GSNA 1SFOA 1Y1VA 3K7AC 3S1NK 1HQMA 1YX2A 2EBBA 3M4OC 3CAGA 1I3QA 4C45A 3I4MK 1Y1VK 2PPBA 1BJTA 2JA6A 1DCOA 5TMFA 4A3GK 3A8KA 5C4JK 3M3YK 4A3FC 1PJ5A 2JA6K 3HOUC 3PO3C 4GTDA 1R9TA 4ZH4A 4XLNA 4MEYA 1WORA 2GAHC 4XSZA 1XZPB 1TWGC 1R9TK 3PO2K 1UV7A 1F7UA 1USMA 3FHZA 2P8TA 3LPXA 5EGHA 3TFJA 4A3LK 1RU0A 1XXAA 4A3IC 3AQOA 1WCMC 1O25A 5CHPA 3S1MK 3GTLC 3FKIC 4PAAA 4BLBA 5FLMK 3M4OK 2W7VA 1I6VA 3AQPA 2Y3PA 1I50C 2JA7C 3EQLA 4KARA 2NVTC 4A3FK 2GSOA 4GTAA 4KMUA 4XLPA 5M5YK 3HOUK 3PO3K 3HOWC 1TWGA 1ZBSA 3GTMC 1HI9A 3GDZA 1TWGK 5EGEA 3AD8C 1XZQB 5TJ3A 1WCMA 3MMLB 3FKIA 4KB2A 1B4BA 1Y1WC 2JA5K 3HKZD 1WCMK 1B4AA 3GTLK 1WOPA 4A3JC 5C3EC 3FKIK 2B63C 5IYDC 5M3FK 4A3DC 2PMZD 2XCRB 3V4GA 4AYBD 1F7VA 4G0VA 3S16C 1WQHA 1I50K 2JA7K 1XZPA 2NVTK 4BY1C 3GTMA 3L4JA 2D6FC 4GT9A 5IYBC 1K83A 1C0AA 3GTMK 2PA8D 5C4XC 3TFIA 4GTLA 2V6TA 4FZBA 1TWCC 4QIWD 3RZOC 1ZQ1C 2PHCB 1Y1WA 3HKZL 1J6VA 3OEPA 4KAWX 4Y52K 4ILDA 2B63A 1F9NA 3AD9C 2FQTA 1Y1WK 5IOQA 3QX3A 2B63K 3G4CA 1EQRA 2WAQL 4Y7NC 5IYDK 1WQGA 4A3DK 3GEHA 5IORA 3HOXC 3GTGA 3CQZA 3GTKA 3H0GA 2A69A 5IP7C 4QJVA 3H3VD 1XZQA 4G0WA 2PA8L 2KWAA 3G4AA 5IYBK 1TWCA 2Y0SL 4QIWL 4G7HA 5C4XK 3TTGA 5FLMC 3HOZC 3LAJA 3S2HC 1TWCK 4KASA 3RZOK 2CFAA 4OIPA 1J6WA 4LK1A 1JOEA 5M5XK 1AB4A 3HOVK 1IQ0A 4KATA 4C3IC 1EK8A 4Y7NK 4LR2A 4P9SA 3S0XA 3GTJC 4G7OA 3HOXK 3S2DC 3H3VL 1WSRA 1WIHA 2V6SA 4OINA 5IP7K 4FM9A 2R92K 3S17K 3N3YA 4JK1A 2E2HC 3L4KA 2JA5C 4GTFA 2YU9C 2V6UA 1XXBA 3HOZK 3S2HK 2ZUEA 4X6AK 3T00A 1IE0A 4PABA 5M5WK 1INNA 4A3BC 1V5VA 3GTJA 2R93K 4KB4A 4YFKA 4C3IK 4XSXA 2O5JA 3OPFA 3GTJK 4BXXC 3GEIA 3S2DK 4QJVB 1O27A 1EI6A 2YU9A 2JA5A 4GTEA 1KQ4A 5M3MK 4Y52C 2WB1D 1TWHC 3GTLA 4WJ3M 2GAGC 2E2HK 1VRQC 4LJZA 2YU9K 1O28A 2P5MA 4A93C 3RZDC 4BLAA 3BP8C 1I50A 2JA7A 3N0CA 5IOSA 4KM8A 2NVXC 1WSVA 2CFAB 3GEEA 5FJ8K 3NUHA 1VJEA 4A3KK 3WODA 2NVQK 5C44C 3ADAC 3Q3QA 4A3BK 4KMHA 1VLOA 1DD5A 4DDQA 1O2BA 4WILA 3HOYK 1DCHA 4BXXK 3T02A 2WB1L 4YG2A 3S1RC 1BGWA 4G7ZA 1TWHK 4BBSK 3GTPC 3HOVC 2PMZL 4MQ9A 3SZZA 2VUMC 2NVXA 4MEXA 4YFXA 4A93K 2RH6A 4GFQA 3RZDK 4AYBL 3GTQC 1WOOA 2BE5A 3S15K 2NVXK 1J6XA 2A6EA 3GTOC 4KMDA 1G51A 4LQYA 2R92C 3S17C 4OIRA 5C44K 1I3QC 4C2MC 4LOWA 3IPJA 4KN7A 5HL8A 4KDDA 4C3HK 2E2JK 3S1RK 4X6AC 2R7ZC 1ZXOA 2VUMA 4BY7C 3GTPK 2VUMK 1BDFA 1VH2A 3T01A 2R93C 3I4NK 3GTOA 1EH1A 5E68A 3GTQK 3OREA 2RGRA 2E2IK 2R92A 3GIRA 2NVYC 1SMYA 5IP9C 3AH5A 4P5BA 1O26A 3GTOK 4P5AA 5IOTA 1PJ6A 1YNJA 1SFOK 1JQWA 4KC6A 1I3QK 4J3NA 4C2MK 2A6HA 2FQOA 1L0WA 3ERED 3BUEA 3S14K 2R7ZA 3FOEA 1TWFC 4LLGA 2CW0A 4BKWA 2ZFZA 2R7ZK 1ZYRA 1WOSA 4WJ4A 1JVIA 1O29A 2XCQA 3LAPA 2R93A 4O2DA 1IL2A 1XXCA 4A3KC 4BY7K 2NVQC 3SZYA 2NVYA 2A68A 4GTCA 2JA8K 3HOYC 3K7AK 5IP9K 2NVYK 3FOFA 3A8JA 3HXAA 2E2HA 3A8IA 4A3EC 1YNNA 5L46A 1IW7A 4BBSC 1BS2A 4NOIA 1TWFA 5D4DA 2O5IA 5IYCC 1J98A 4C3JC 1DCPA 1TWFK 3S15C 1O2AA 1ZVUA 1O24A 1K83C 3TFHA 4M1XA 4A3CC 1EFWA 2XCOA 1ISEA 4A3IK 1VGXA 3JSTA 5JFEA 4A3MC 1TWHA 4C3HC 2E2JC 4Q4ZA 4BBRC 1I6HC 5CJ9A
chains in the Genus database with same CATH topology
1WIHA 1ZBSA 4KDDA 4FM9A 3N3YA 4KM9A 3L4KA 4GTFA 5EGEA 1ZXOA 2VUMA 1XXBA 5TJ3A 1WCMA 3MMLB 4G0UA 3FKIA 4KB2A 1B4BA 3GTOA 1EH1A 1B4AA 4KMAA 3OREA 2RGRA 1IS1A 2R92A 4GTBA 3AH5A 4P5BA 1O26A 2XCRB 4P5AA 5IOTA 3V4GA 4G0VA 3GTJA 4KB4A 1WQHA 1TWAA 2JH3A 3OPFA 4KC6A 4J3NA 3GTMA 1Y1WA 3GTPA 1GE9A 1O27A 3L4JA 3VA7A 4GT9A 3ERED 3BUEA 2YU9A 1K83A 2JA5A 2R7ZA 4GTEA 1KQ4A 3FOEA 5JVOA 3GTLA 1WQFA 3N0BA 3GTQA 2GSUA 4BKWA 4GTLA 2E2IA 2ZFZA 4FZBA 1O28A 2P5MA 1O29A 2PHCB 2XCQA 3LAPA 4BLAA 2GSNA 1SFOA 1I50A 2R93A 1XXCA 1Y1VA 3OEPA 4KAWX 4ILDA 2JA7A 2B63A 3N0CA 1F9NA 4KM8A 5IOSA 2CFAB 3CAGA 1I3QA 5IOQA 3NUHA 2NVYA 3QX3A 1BJTA 2JA6A 4GTCA 3G4CA 1WQGA 3FOFA 5IORA 3Q3QA 2E2HA 4KMHA 3GTGA 1DD5A 3CQZA 4DDQA 4GTDA 1R9TA 3GTKA 1O2BA 3H0GA 1TWFA 4G0WA 1BGWA 2KWAA 3G4AA 1TWCA 4C3JC 3FHZA 3LPXA 1O2AA 3LAJA 5EGHA 1ZVUA 1O24A 4KASA 1XXAA 2NVXA 2RH6A 3AQOA 4GFQA 1O25A 4M1XA 5CHPA 2CFAA 4BLBA 2XCOA 1ISEA 3AQPA 2Y3PA 1AB4A 4KMDA 5JFEA 4KATA 4LQYA 4C3IC 1EK8A 1TWHA 4KARA 4LR2A 3S0XA 4C3HC 2GSOA 4GTAA 4C2MC 5CJ9A 1TWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA B;  1O2A A;  5IOQ A;  1O24 A;  4KAS A;  3N3Y A;  5IOS A;  4GTC A;  3G4C A;  5CHP A;  1O25 A;  4GTF A;  2CFA A;  5IOR A;  1O27 A;  4GT9 A;  4GTE A;  1KQ4 A;  4GTD A;  3N0B A;  1O2B A;  4P5B A;  5JFE A;  4KAT A;  4GTL A;  4FZB A;  1O28 A;  4KAR A;  1O29 A;  4GTA A;  3G4A A;  4GTB A;  3AH5 A;  1O26 A;  4P5A A;  3N0C A;  5IOT A; 
#chains in the Genus database with same CATH topology
 2WAQ D;  1TWA C;  3DXJ A;  3S1Q C;  4A3E K;  3GSI A;  3GTG C;  4KM9 A;  3CQZ C;  4OIQ A;  4Q5S A;  1F93 A;  4RMF A;  3I4N C;  1XPP A;  1YCL A;  5IYC K;  3GTK C;  3HOW K;  4C3J K;  3H0G C;  4G0U A;  2E2I C;  1O2F B;  3BP3 A;  3S1N C;  1K83 K;  2Y0S D;  3I4M C;  1SFO C;  1Y1V C;  4A3C K;  3AD7 C;  1PJ7 A;  4AH6 A;  4KMA A;  4A3G C;  1IS1 A;  5TMC A;  5C4J C;  4GTB A;  1IBA A;  3M3Y C;  2JA6 C;  3S14 C;  2ZUF A;  1USO A;  4A3M K;  4YFN A;  4A3J K;  5C3E K;  4GZY A;  1TWA A;  2JH3 A;  4BBR K;  1X31 C;  1R9T C;  3GTP A;  1GE9 A;  1I6H K;  3PO2 C;  3VA7 A;  4KN4 A;  3S16 K;  1TWA K;  4OIO A;  3S1Q K;  5JVO A;  1WQF A;  3N0B A;  3GTQ A;  2GSU A;  3GTG K;  3CQZ K;  4A3L C;  2E2I A;  4XCH A;  4BY1 K;  3GTK K;  3H0G K;  4LK0 A;  3S1M C;  2JA8 C;  2GSN A;  1SFO A;  1Y1V A;  3K7A C;  3S1N K;  1HQM A;  1YX2 A;  2EBB A;  3M4O C;  3CAG A;  1I3Q A;  4C45 A;  3I4M K;  1Y1V K;  2PPB A;  1BJT A;  2JA6 A;  1DCO A;  5TMF A;  4A3G K;  3A8K A;  5C4J K;  3M3Y K;  4A3F C;  1PJ5 A;  2JA6 K;  3HOU C;  3PO3 C;  4GTD A;  1R9T A;  4ZH4 A;  4XLN A;  4MEY A;  1WOR A;  2GAH C;  4XSZ A;  1XZP B;  1TWG C;  1R9T K;  3PO2 K;  1UV7 A;  1F7U A;  1USM A;  3FHZ A;  2P8T A;  3LPX A;  5EGH A;  3TFJ A;  4A3L K;  1RU0 A;  1XXA A;  4A3I C;  3AQO A;  1WCM C;  1O25 A;  5CHP A;  3S1M K;  3GTL C;  3FKI C;  4PAA A;  4BLB A;  5FLM K;  3M4O K;  2W7V A;  1I6V A;  3AQP A;  2Y3P A;  1I50 C;  2JA7 C;  3EQL A;  4KAR A;  2NVT C;  4A3F K;  2GSO A;  4GTA A;  4KMU A;  4XLP A;  5M5Y K;  3HOU K;  3PO3 K;  3HOW C;  1TWG A;  1ZBS A;  3GTM C;  1HI9 A;  3GDZ A;  1TWG K;  5EGE A;  3AD8 C;  1XZQ B;  5TJ3 A;  1WCM A;  3MML B;  3FKI A;  4KB2 A;  1B4B A;  1Y1W C;  2JA5 K;  3HKZ D;  1WCM K;  1B4A A;  3GTL K;  1WOP A;  4A3J C;  5C3E C;  3FKI K;  2B63 C;  5IYD C;  5M3F K;  4A3D C;  2PMZ D;  2XCR B;  3V4G A;  4AYB D;  1F7V A;  4G0V A;  3S16 C;  1WQH A;  1I50 K;  2JA7 K;  1XZP A;  2NVT K;  4BY1 C;  3GTM A;  3L4J A;  2D6F C;  4GT9 A;  5IYB C;  1K83 A;  1C0A A;  3GTM K;  2PA8 D;  5C4X C;  3TFI A;  4GTL A;  2V6T A;  4FZB A;  1TWC C;  4QIW D;  3RZO C;  1ZQ1 C;  2PHC B;  1Y1W A;  3HKZ L;  1J6V A;  3OEP A;  4KAW X;  4Y52 K;  4ILD A;  2B63 A;  1F9N A;  3AD9 C;  2FQT A;  1Y1W K;  5IOQ A;  3QX3 A;  2B63 K;  3G4C A;  1EQR A;  2WAQ L;  4Y7N C;  5IYD K;  1WQG A;  4A3D K;  3GEH A;  5IOR A;  3HOX C;  3GTG A;  3CQZ A;  3GTK A;  3H0G A;  2A69 A;  5IP7 C;  4QJV A;  3H3V D;  1XZQ A;  4G0W A;  2PA8 L;  2KWA A;  3G4A A;  5IYB K;  1TWC A;  2Y0S L;  4QIW L;  4G7H A;  5C4X K;  3TTG A;  5FLM C;  3HOZ C;  3LAJ A;  3S2H C;  1TWC K;  4KAS A;  3RZO K;  2CFA A;  4OIP A;  1J6W A;  4LK1 A;  1JOE A;  5M5X K;  1AB4 A;  3HOV K;  1IQ0 A;  4KAT A;  4C3I C;  1EK8 A;  4Y7N K;  4LR2 A;  4P9S A;  3S0X A;  3GTJ C;  4G7O A;  3HOX K;  3S2D C;  3H3V L;  1WSR A;  1WIH A;  2V6S A;  4OIN A;  5IP7 K;  4FM9 A;  2R92 K;  3S17 K;  3N3Y A;  4JK1 A;  2E2H C;  3L4K A;  2JA5 C;  4GTF A;  2YU9 C;  2V6U A;  1XXB A;  3HOZ K;  3S2H K;  2ZUE A;  4X6A K;  3T00 A;  1IE0 A;  4PAB A;  5M5W K;  1INN A;  4A3B C;  1V5V A;  3GTJ A;  2R93 K;  4KB4 A;  4YFK A;  4C3I K;  4XSX A;  2O5J A;  3OPF A;  3GTJ K;  4BXX C;  3GEI A;  3S2D K;  4QJV B;  1O27 A;  1EI6 A;  2YU9 A;  2JA5 A;  4GTE A;  1KQ4 A;  5M3M K;  4Y52 C;  2WB1 D;  1TWH C;  3GTL A;  4WJ3 M;  2GAG C;  2E2H K;  1VRQ C;  4LJZ A;  2YU9 K;  1O28 A;  2P5M A;  4A93 C;  3RZD C;  4BLA A;  3BP8 C;  1I50 A;  2JA7 A;  3N0C A;  5IOS A;  4KM8 A;  2NVX C;  1WSV A;  2CFA B;  3GEE A;  5FJ8 K;  3NUH A;  1VJE A;  4A3K K;  3WOD A;  2NVQ K;  5C44 C;  3ADA C;  3Q3Q A;  4A3B K;  4KMH A;  1VLO A;  1DD5 A;  4DDQ A;  1O2B A;  4WIL A;  3HOY K;  1DCH A;  4BXX K;  3T02 A;  2WB1 L;  4YG2 A;  3S1R C;  1BGW A;  4G7Z A;  1TWH K;  4BBS K;  3GTP C;  3HOV C;  2PMZ L;  4MQ9 A;  3SZZ A;  2VUM C;  2NVX A;  4MEX A;  4YFX A;  4A93 K;  2RH6 A;  4GFQ A;  3RZD K;  4AYB L;  3GTQ C;  1WOO A;  2BE5 A;  3S15 K;  2NVX K;  1J6X A;  2A6E A;  3GTO C;  4KMD A;  1G51 A;  4LQY A;  2R92 C;  3S17 C;  4OIR A;  5C44 K;  1I3Q C;  4C2M C;  4LOW A;  3IPJ A;  4KN7 A;  5HL8 A;  4KDD A;  4C3H K;  2E2J K;  3S1R K;  4X6A C;  2R7Z C;  1ZXO A;  2VUM A;  4BY7 C;  3GTP K;  2VUM K;  1BDF A;  1VH2 A;  3T01 A;  2R93 C;  3I4N K;  3GTO A;  1EH1 A;  5E68 A;  3GTQ K;  3ORE A;  2RGR A;  2E2I K;  2R92 A;  3GIR A;  2NVY C;  1SMY A;  5IP9 C;  3AH5 A;  4P5B A;  1O26 A;  3GTO K;  4P5A A;  5IOT A;  1PJ6 A;  1YNJ A;  1SFO K;  1JQW A;  4KC6 A;  1I3Q K;  4J3N A;  4C2M K;  2A6H A;  2FQO A;  1L0W A;  3ERE D;  3BUE A;  3S14 K;  2R7Z A;  3FOE A;  1TWF C;  4LLG A;  2CW0 A;  4BKW A;  2ZFZ A;  2R7Z K;  1ZYR A;  1WOS A;  4WJ4 A;  1JVI A;  1O29 A;  2XCQ A;  3LAP A;  2R93 A;  4O2D A;  1IL2 A;  1XXC A;  4A3K C;  4BY7 K;  2NVQ C;  3SZY A;  2NVY A;  2A68 A;  4GTC A;  2JA8 K;  3HOY C;  3K7A K;  5IP9 K;  2NVY K;  3FOF A;  3A8J A;  3HXA A;  2E2H A;  3A8I A;  4A3E C;  1YNN A;  5L46 A;  1IW7 A;  4BBS C;  1BS2 A;  4NOI A;  1TWF A;  5D4D A;  2O5I A;  5IYC C;  1J98 A;  4C3J C;  1DCP A;  1TWF K;  3S15 C;  1O2A A;  1ZVU A;  1O24 A;  1K83 C;  3TFH A;  4M1X A;  4A3C C;  1EFW A;  2XCO A;  1ISE A;  4A3I K;  1VGX A;  3JST A;  5JFE A;  4A3M C;  1TWH A;  4C3H C;  2E2J C;  4Q4Z A;  4BBR C;  1I6H C;  5CJ9 A; 
#chains in the Genus database with same CATH homology
 1WIH A;  1ZBS A;  4KDD A;  4FM9 A;  3N3Y A;  4KM9 A;  3L4K A;  4GTF A;  5EGE A;  1ZXO A;  2VUM A;  1XXB A;  5TJ3 A;  1WCM A;  3MML B;  4G0U A;  3FKI A;  4KB2 A;  1B4B A;  3GTO A;  1EH1 A;  1B4A A;  4KMA A;  3ORE A;  2RGR A;  1IS1 A;  2R92 A;  4GTB A;  3AH5 A;  4P5B A;  1O26 A;  2XCR B;  4P5A A;  5IOT A;  3V4G A;  4G0V A;  3GTJ A;  4KB4 A;  1WQH A;  1TWA A;  2JH3 A;  3OPF A;  4KC6 A;  4J3N A;  3GTM A;  1Y1W A;  3GTP A;  1GE9 A;  1O27 A;  3L4J A;  3VA7 A;  4GT9 A;  3ERE D;  3BUE A;  2YU9 A;  1K83 A;  2JA5 A;  2R7Z A;  4GTE A;  1KQ4 A;  3FOE A;  5JVO A;  3GTL A;  1WQF A;  3N0B A;  3GTQ A;  2GSU A;  4BKW A;  4GTL A;  2E2I A;  2ZFZ A;  4FZB A;  1O28 A;  2P5M A;  1O29 A;  2PHC B;  2XCQ A;  3LAP A;  4BLA A;  2GSN A;  1SFO A;  1I50 A;  2R93 A;  1XXC A;  1Y1V A;  3OEP A;  4KAW X;  4ILD A;  2JA7 A;  2B63 A;  3N0C A;  1F9N A;  4KM8 A;  5IOS A;  2CFA B;  3CAG A;  1I3Q A;  5IOQ A;  3NUH A;  2NVY A;  3QX3 A;  1BJT A;  2JA6 A;  4GTC A;  3G4C A;  1WQG A;  3FOF A;  5IOR A;  3Q3Q A;  2E2H A;  4KMH A;  3GTG A;  1DD5 A;  3CQZ A;  4DDQ A;  4GTD A;  1R9T A;  3GTK A;  1O2B A;  3H0G A;  1TWF A;  4G0W A;  1BGW A;  2KWA A;  3G4A A;  1TWC A;  4C3J C;  3FHZ A;  3LPX A;  1O2A A;  3LAJ A;  5EGH A;  1ZVU A;  1O24 A;  4KAS A;  1XXA A;  2NVX A;  2RH6 A;  3AQO A;  4GFQ A;  1O25 A;  4M1X A;  5CHP A;  2CFA A;  4BLB A;  2XCO A;  1ISE A;  3AQP A;  2Y3P A;  1AB4 A;  4KMD A;  5JFE A;  4KAT A;  4LQY A;  4C3I C;  1EK8 A;  1TWH A;  4KAR A;  4LR2 A;  3S0X A;  4C3H C;  2GSO A;  4GTA A;  4C2M C;  5CJ9 A;  1TWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...