4GTAA

T. maritima fdts with fad, dump, and folinic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
215
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 79
structure length 215
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtaA00
4GT9A 5JFEA 1O28A 4P5AA 4GTEA 1O25A 1O26A 4FZBA 4GTDA 5IOSA 4KASA 1KQ4A 5IOQA 4KATA 5IORA 4GTLA 4GTBA 4KARA 1O24A 5IOTA 4GTFA 3N3YA 1O2BA 2CFAA 4P5BA 5CHPA 3N0CA 1O29A 1O27A 1O2AA 3AH5A 3N0BA 3G4CA 3G4AA 2CFAB 4GTAA 4GTCA
chains in the Genus database with same CATH superfamily
3GDZA 4YFXA 3VA7A 2NVXK 4BY7C 2Y3PA 1TWGC 1GE9A 5IOSA 2CW0A 4C3JK 1K83C 2E2HK 3K7AK 4KB4A 1DD5A 3S15C 5FJ8K 4P5BA 2PPBA 2CFAA 3TTGA 3JSTA 2B63C 1SFOA 4A3GK 1AB4A 1WCMC 2E2IC 3HKZD 2NVXC 5C4XK 4LJZA 4BKWA 4C3HC 5IP9K 2PMZD 1F7UA 2R93A 1WSVA 3K7AC 3GEHA 4BBSK 3LPXA 5IP7C 1BDFA 5IYBK 2A6HA 4BXXK 3A8KA 4Y52K 1TWFA 5IORA 4GTLA 1WQHA 1R9TA 1J6WA 4GTFA 1O2BA 5IP9C 3GTOK 2Y0SD 4C3IK 2A68A 1I6VA 3AQOA 4BY1K 3S2DK 1USMA 4Q4ZA 1B4AA 4A3DK 4J3NA 4KMDA 4BXXC 3GTMC 3M3YC 1TWAA 3TFIA 4OINA 2RH6A 3H3VD 3S17C 4WJ3M 1PJ7A 2JH3A 4KASA 3HOZC 3S1NC 5IYCK 3GTOC 2R7ZC 4OIQA 3A8JA 4RMFA 4A3FK 1L0WA 1O29A 3GSIA 4LK0A 3BP3A 3HKZL 1R9TK 2PMZL 5HL8A 3GTQA 4YFKA 3S1MC 1INNA 4X6AK 3NUHA 5IYCC 4G0UA 2EBBA 2V6UA 3FKIK 4GT9A 3T02A 5JFEA 2JA6A 4KB2A 4WILA 2JA7K 3IPJA 4LQYA 3I4MK 1Y1WA 1TWHC 5C44C 1TWCC 2Y0SL 4ILDA 4LOWA 5C3EK 3HOUC 4X6AC 1HI9A 5FLMK 3PO3K 3FKIC 1WIHA 4GTAA 1VJEA 2JA7C 3GTKK 3S14K 3MMLB 4MEYA 3AD9C 3I4MC 5M3FK 4BBRC 2ZFZA 4A3MC 2JA6K 4Q5SA 5FLMC 1I6HK 4KM9A 1BJTA 1Y1VA 4Y7NK 3QX3A 2O5IA 2O5JA 3RZOK 3GTKC 4KDDA 1XZPA 3AQPA 3HOVK 1IS1A 4MEXA 3HOYK 1I3QK 1XXBA 2D6FC 1I6HC 2NVQK 2XCOA 5TMCA 4Y7NC 3GTPK 3GTJK 1PJ5A 3RZOC 1BGWA 4PABA 3CQZA 4A3IK 4C45A 3S1QK 4XCHA 1I50K 3HOYC 1I3QC 1UV7A 2VUMK 4NOIA 2YU9K 5JVOA 4KC6A 1WOOA 1XPPA 3GTPC 2E2JK 4C3JC 3GTJC 2E2HC 4A3LK 1J98A 1O28A 1O2FB 1O25A 3LAJA 3S1QC 4MQ9A 1I50C 4GTDA 3M4OK 3GEIA 3OEPA 4A3GC 2VUMC 3V4GA 2YU9C 3N3YA 5EGEA 4LK1A 5C4XC 5IYDK 2ZUFA 4XLPA 3CQZK 1IQ0A 3PO2K 5M3MK 4BBSC 1VRQC 1SFOK 5IYBC 1IW7A 1XXCA 3AD7C 4Y52C 5TMFA 3GTLA 4FZBA 1EQRA 2R93K 2R92A 4KATA 5IYDC 5C4JK 1F93A 1YNJA 4YG2A 2NVTK 4C3IC 3S0XA 3S2DC 4BY1C 4BLBA 4A3DC 3GTGA 1ZQ1C 1SFOC 1TWFK 4A3CK 1EK8A 4KMUA 1G51A 2WAQL 2JA5A 2R93C 3GIRA 1DCPA 2P5MA 5C4JC 4KAWX 3S16K 1XZQB 4P5AA 1HQMA 3EQLA 1ISEA 2NVYA 4A3FC 1JVIA 4G7HA 5IOQA 4QJVB 4WJ4A 1TWAK 1TWFC 4A3CC 3OREA 2P8TA 2XCRB 1R9TC 3S2HK 2R92K 2W7VA 4A3JK 1IL2A 1B4BA 2GAHC 3S16C 3T01A 1XZQA 4QJVA 2GSUA 4A93K 1RU0A 1ZYRA 4A3EK 1TWAC 1WQFA 1XZPB 4KMHA 4QIWD 1TWGA 3GTQK 4LR2A 4GFQA 4G0VA 4LLGA 1K83A 2JA5K 3S2HC 4A3JC 1KQ4A 5C3EC 3I4NK 4KN4A 4OIPA 2GSNA 4GTBA 1JOEA 2NVYK 3HOXK 2FQTA 2B63A 3PO3C 4DDQA 1WCMA 3LAPA 2E2IA 4A93C 4XSZA 3S14C 2NVXA 1Y1WK 1WSRA 3FHZA 3GTQC 4A3KK 3AD8C 2JA5C 4P9SA 4GTCA 5TJ3A 3I4NC 1WOSA 1WOPA 4GTEA 4GZYA 2NVYC 2JA6C 3HOXC 5CJ9A 2RGRA 2BE5A 1YX2A 4G7OA 3ADAC 5E68A 1Y1WC 3HOVC 2WB1D 4A3KC 2PA8D 1YNNA 2V6TA 4JK1A 1USOA 2B63K 1Y1VK 1WCMK 4YFNA 3GTMA 5M5XK 2E2IK 2NVQC 4XLNA 3Q3QA 1ZBSA 4QIWL 1YCLA 2WAQD 4OIRA 4C3HK 3TFJA 4OIOA 4A3IC 1XXAA 3GTOA 2R7ZA 5IP7K 4A3BK 3L4KA 1Y1VC 5D4DA 1DCHA 1VH2A 2E2JC 3G4CA 4A3LC 5EGHA 1WQGA 4A3BC 1JQWA 3M4OC 4FM9A 3GTMK 3M3YK 1ZVUA 1F9NA 2FQOA 2V6SA 4O2DA 1J6VA 1IE0A 1TWHA 3S17K 1F7VA 2WB1L 1O24A 3H0GA 2A69A 1EH1A 1TWCA 3CQZC 3HOZK 3S1NK 2PA8L 4M1XA 2R7ZK 3PO2C 1O27A 1O2AA 4G7ZA 3L4JA 3FKIA 3G4AA 2JA7A 2XCQA 1BS2A 2KWAA 5L46A 1J6XA 3S1MK 3FOFA 2ZUEA 2NVTC 4PAAA 4AYBD 4AH6A 1X31C 3OPFA 1EFWA 3GTLK 3ERED 5CHPA 3N0CA 1VGXA 4KMAA 2GAGC 1ZXOA 3GTKA 1TWHK 3AH5A 5M5YK 1SMYA 5C44K 3H0GK 1IBAA 1TWCK 3FOEA 3HOUK 3SZZA 2JA8K 3GTGK 1WORA 3GTLC 1O26A 3WODA 2PHCB 1DCOA 2R92C 3BUEA 2A6EA 3HOWK 4XSXA 3S1RK 3H0GC 4BBRK 5IOTA 4A3MK 3T00A 2JA8C 3GTGC 1I3QA 3DXJA 3BP8C 1V5VA 1VLOA 3N0BA 4A3EC 3A8IA 3RZDK 4G0WA 3GEEA 4C2MK 3GTPA 3GTJA 3H3VL 2E2HA 3HOWC 4AYBL 3S1RC 1I50A 3TFHA 2VUMA 4BY7K 2YU9A 4KARA 3SZYA 1PJ6A 1TWGK 3RZDC 1C0AA 4ZH4A 1K83K 4BLAA 5M5WK 4C2MC 3CAGA 3S15K 4KM8A 2CFAB 4KN7A 3HXAA 2GSOA 1EI6A
chains in the Genus database with same CATH topology
4KAWX 3VA7A 4P5AA 2Y3PA 1ISEA 2NVYA 1GE9A 4FM9A 5IOSA 2ZFZA 1ZVUA 5IOQA 1F9NA 4KB4A 1DD5A 1TWHA 1O24A 3H0GA 3OREA 2XCRB 1EH1A 1TWCA 4KM9A 2CFAA 4P5BA 1BJTA 1Y1VA 4M1XA 1SFOA 3QX3A 1AB4A 1O27A 1O2AA 4KDDA 1B4BA 3L4JA 3AQPA 3FKIA 3G4AA 4BKWA 1IS1A 4C3HC 2R93A 2JA7A 2XCQA 2GSUA 1XXBA 2KWAA 1WQFA 3LPXA 4KMHA 1TWGA 3FOFA 4LR2A 4GFQA 4G0VA 2XCOA 1K83A 1KQ4A 1TWFA 5IORA 4GTLA 3OPFA 1WQHA 2GSNA 1BGWA 4GTBA 1R9TA 3CQZA 4GTFA 1O2BA 3ERED 2B63A 5CHPA 3N0CA 4KMAA 4DDQA 1WCMA 1ZXOA 3LAPA 3GTKA 2E2IA 3AH5A 3AQOA 5JVOA 2NVXA 1B4AA 4KC6A 4J3NA 3FHZA 3FOEA 4KMDA 1TWAA 4GTCA 4C3JC 5TJ3A 2RH6A 1O28A 4GTEA 1O25A 1O26A 3LAJA 2JH3A 4GTDA 2PHCB 4KASA 5CJ9A 2RGRA 3BUEA 3OEPA 3V4GA 5IOTA 3N3YA 5EGEA 1O29A 1I3QA 3N0BA 3GTQA 4G0WA 3GTMA 3NUHA 1XXCA 3GTPA 3GTJA 3Q3QA 1ZBSA 2E2HA 4G0UA 4GT9A 5JFEA 3GTLA 2JA6A 4KB2A 1I50A 4FZBA 1XXAA 3GTOA 2R92A 4LQYA 2R7ZA 4KATA 2VUMA 2YU9A 4KARA 1Y1WA 4C3IC 3S0XA 4ILDA 4BLBA 3L4KA 3GTGA 4BLAA 4C2MC 3CAGA 4KM8A 1EK8A 3G4CA 2CFAB 1WIHA 5EGHA 4GTAA 1WQGA 2JA5A 2GSOA 3MMLB 2P5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT9 A;  5JFE A;  1O28 A;  4P5A A;  4GTE A;  1O25 A;  1O26 A;  4FZB A;  4GTD A;  5IOS A;  4KAS A;  1KQ4 A;  5IOQ A;  4KAT A;  5IOR A;  4GTL A;  4GTB A;  4KAR A;  1O24 A;  5IOT A;  4GTF A;  3N3Y A;  1O2B A;  2CFA A;  4P5B A;  5CHP A;  3N0C A;  1O29 A;  1O27 A;  1O2A A;  3AH5 A;  3N0B A;  3G4C A;  3G4A A;  2CFA B;  4GTA A;  4GTC A; 
#chains in the Genus database with same CATH topology
 3GDZ A;  4YFX A;  3VA7 A;  2NVX K;  4BY7 C;  2Y3P A;  1TWG C;  1GE9 A;  5IOS A;  2CW0 A;  4C3J K;  1K83 C;  2E2H K;  3K7A K;  4KB4 A;  1DD5 A;  3S15 C;  5FJ8 K;  4P5B A;  2PPB A;  2CFA A;  3TTG A;  3JST A;  2B63 C;  1SFO A;  4A3G K;  1AB4 A;  1WCM C;  2E2I C;  3HKZ D;  2NVX C;  5C4X K;  4LJZ A;  4BKW A;  4C3H C;  5IP9 K;  2PMZ D;  1F7U A;  2R93 A;  1WSV A;  3K7A C;  3GEH A;  4BBS K;  3LPX A;  5IP7 C;  1BDF A;  5IYB K;  2A6H A;  4BXX K;  3A8K A;  4Y52 K;  1TWF A;  5IOR A;  4GTL A;  1WQH A;  1R9T A;  1J6W A;  4GTF A;  1O2B A;  5IP9 C;  3GTO K;  2Y0S D;  4C3I K;  2A68 A;  1I6V A;  3AQO A;  4BY1 K;  3S2D K;  1USM A;  4Q4Z A;  1B4A A;  4A3D K;  4J3N A;  4KMD A;  4BXX C;  3GTM C;  3M3Y C;  1TWA A;  3TFI A;  4OIN A;  2RH6 A;  3H3V D;  3S17 C;  4WJ3 M;  1PJ7 A;  2JH3 A;  4KAS A;  3HOZ C;  3S1N C;  5IYC K;  3GTO C;  2R7Z C;  4OIQ A;  3A8J A;  4RMF A;  4A3F K;  1L0W A;  1O29 A;  3GSI A;  4LK0 A;  3BP3 A;  3HKZ L;  1R9T K;  2PMZ L;  5HL8 A;  3GTQ A;  4YFK A;  3S1M C;  1INN A;  4X6A K;  3NUH A;  5IYC C;  4G0U A;  2EBB A;  2V6U A;  3FKI K;  4GT9 A;  3T02 A;  5JFE A;  2JA6 A;  4KB2 A;  4WIL A;  2JA7 K;  3IPJ A;  4LQY A;  3I4M K;  1Y1W A;  1TWH C;  5C44 C;  1TWC C;  2Y0S L;  4ILD A;  4LOW A;  5C3E K;  3HOU C;  4X6A C;  1HI9 A;  5FLM K;  3PO3 K;  3FKI C;  1WIH A;  4GTA A;  1VJE A;  2JA7 C;  3GTK K;  3S14 K;  3MML B;  4MEY A;  3AD9 C;  3I4M C;  5M3F K;  4BBR C;  2ZFZ A;  4A3M C;  2JA6 K;  4Q5S A;  5FLM C;  1I6H K;  4KM9 A;  1BJT A;  1Y1V A;  4Y7N K;  3QX3 A;  2O5I A;  2O5J A;  3RZO K;  3GTK C;  4KDD A;  1XZP A;  3AQP A;  3HOV K;  1IS1 A;  4MEX A;  3HOY K;  1I3Q K;  1XXB A;  2D6F C;  1I6H C;  2NVQ K;  2XCO A;  5TMC A;  4Y7N C;  3GTP K;  3GTJ K;  1PJ5 A;  3RZO C;  1BGW A;  4PAB A;  3CQZ A;  4A3I K;  4C45 A;  3S1Q K;  4XCH A;  1I50 K;  3HOY C;  1I3Q C;  1UV7 A;  2VUM K;  4NOI A;  2YU9 K;  5JVO A;  4KC6 A;  1WOO A;  1XPP A;  3GTP C;  2E2J K;  4C3J C;  3GTJ C;  2E2H C;  4A3L K;  1J98 A;  1O28 A;  1O2F B;  1O25 A;  3LAJ A;  3S1Q C;  4MQ9 A;  1I50 C;  4GTD A;  3M4O K;  3GEI A;  3OEP A;  4A3G C;  2VUM C;  3V4G A;  2YU9 C;  3N3Y A;  5EGE A;  4LK1 A;  5C4X C;  5IYD K;  2ZUF A;  4XLP A;  3CQZ K;  1IQ0 A;  3PO2 K;  5M3M K;  4BBS C;  1VRQ C;  1SFO K;  5IYB C;  1IW7 A;  1XXC A;  3AD7 C;  4Y52 C;  5TMF A;  3GTL A;  4FZB A;  1EQR A;  2R93 K;  2R92 A;  4KAT A;  5IYD C;  5C4J K;  1F93 A;  1YNJ A;  4YG2 A;  2NVT K;  4C3I C;  3S0X A;  3S2D C;  4BY1 C;  4BLB A;  4A3D C;  3GTG A;  1ZQ1 C;  1SFO C;  1TWF K;  4A3C K;  1EK8 A;  4KMU A;  1G51 A;  2WAQ L;  2JA5 A;  2R93 C;  3GIR A;  1DCP A;  2P5M A;  5C4J C;  4KAW X;  3S16 K;  1XZQ B;  4P5A A;  1HQM A;  3EQL A;  1ISE A;  2NVY A;  4A3F C;  1JVI A;  4G7H A;  5IOQ A;  4QJV B;  4WJ4 A;  1TWA K;  1TWF C;  4A3C C;  3ORE A;  2P8T A;  2XCR B;  1R9T C;  3S2H K;  2R92 K;  2W7V A;  4A3J K;  1IL2 A;  1B4B A;  2GAH C;  3S16 C;  3T01 A;  1XZQ A;  4QJV A;  2GSU A;  4A93 K;  1RU0 A;  1ZYR A;  4A3E K;  1TWA C;  1WQF A;  1XZP B;  4KMH A;  4QIW D;  1TWG A;  3GTQ K;  4LR2 A;  4GFQ A;  4G0V A;  4LLG A;  1K83 A;  2JA5 K;  3S2H C;  4A3J C;  1KQ4 A;  5C3E C;  3I4N K;  4KN4 A;  4OIP A;  2GSN A;  4GTB A;  1JOE A;  2NVY K;  3HOX K;  2FQT A;  2B63 A;  3PO3 C;  4DDQ A;  1WCM A;  3LAP A;  2E2I A;  4A93 C;  4XSZ A;  3S14 C;  2NVX A;  1Y1W K;  1WSR A;  3FHZ A;  3GTQ C;  4A3K K;  3AD8 C;  2JA5 C;  4P9S A;  4GTC A;  5TJ3 A;  3I4N C;  1WOS A;  1WOP A;  4GTE A;  4GZY A;  2NVY C;  2JA6 C;  3HOX C;  5CJ9 A;  2RGR A;  2BE5 A;  1YX2 A;  4G7O A;  3ADA C;  5E68 A;  1Y1W C;  3HOV C;  2WB1 D;  4A3K C;  2PA8 D;  1YNN A;  2V6T A;  4JK1 A;  1USO A;  2B63 K;  1Y1V K;  1WCM K;  4YFN A;  3GTM A;  5M5X K;  2E2I K;  2NVQ C;  4XLN A;  3Q3Q A;  1ZBS A;  4QIW L;  1YCL A;  2WAQ D;  4OIR A;  4C3H K;  3TFJ A;  4OIO A;  4A3I C;  1XXA A;  3GTO A;  2R7Z A;  5IP7 K;  4A3B K;  3L4K A;  1Y1V C;  5D4D A;  1DCH A;  1VH2 A;  2E2J C;  3G4C A;  4A3L C;  5EGH A;  1WQG A;  4A3B C;  1JQW A;  3M4O C;  4FM9 A;  3GTM K;  3M3Y K;  1ZVU A;  1F9N A;  2FQO A;  2V6S A;  4O2D A;  1J6V A;  1IE0 A;  1TWH A;  3S17 K;  1F7V A;  2WB1 L;  1O24 A;  3H0G A;  2A69 A;  1EH1 A;  1TWC A;  3CQZ C;  3HOZ K;  3S1N K;  2PA8 L;  4M1X A;  2R7Z K;  3PO2 C;  1O27 A;  1O2A A;  4G7Z A;  3L4J A;  3FKI A;  3G4A A;  2JA7 A;  2XCQ A;  1BS2 A;  2KWA A;  5L46 A;  1J6X A;  3S1M K;  3FOF A;  2ZUE A;  2NVT C;  4PAA A;  4AYB D;  4AH6 A;  1X31 C;  3OPF A;  1EFW A;  3GTL K;  3ERE D;  5CHP A;  3N0C A;  1VGX A;  4KMA A;  2GAG C;  1ZXO A;  3GTK A;  1TWH K;  3AH5 A;  5M5Y K;  1SMY A;  5C44 K;  3H0G K;  1IBA A;  1TWC K;  3FOE A;  3HOU K;  3SZZ A;  2JA8 K;  3GTG K;  1WOR A;  3GTL C;  1O26 A;  3WOD A;  2PHC B;  1DCO A;  2R92 C;  3BUE A;  2A6E A;  3HOW K;  4XSX A;  3S1R K;  3H0G C;  4BBR K;  5IOT A;  4A3M K;  3T00 A;  2JA8 C;  3GTG C;  1I3Q A;  3DXJ A;  3BP8 C;  1V5V A;  1VLO A;  3N0B A;  4A3E C;  3A8I A;  3RZD K;  4G0W A;  3GEE A;  4C2M K;  3GTP A;  3GTJ A;  3H3V L;  2E2H A;  3HOW C;  4AYB L;  3S1R C;  1I50 A;  3TFH A;  2VUM A;  4BY7 K;  2YU9 A;  4KAR A;  3SZY A;  1PJ6 A;  1TWG K;  3RZD C;  1C0A A;  4ZH4 A;  1K83 K;  4BLA A;  5M5W K;  4C2M C;  3CAG A;  3S15 K;  4KM8 A;  2CFA B;  4KN7 A;  3HXA A;  2GSO A;  1EI6 A; 
#chains in the Genus database with same CATH homology
 4KAW X;  3VA7 A;  4P5A A;  2Y3P A;  1ISE A;  2NVY A;  1GE9 A;  4FM9 A;  5IOS A;  2ZFZ A;  1ZVU A;  5IOQ A;  1F9N A;  4KB4 A;  1DD5 A;  1TWH A;  1O24 A;  3H0G A;  3ORE A;  2XCR B;  1EH1 A;  1TWC A;  4KM9 A;  2CFA A;  4P5B A;  1BJT A;  1Y1V A;  4M1X A;  1SFO A;  3QX3 A;  1AB4 A;  1O27 A;  1O2A A;  4KDD A;  1B4B A;  3L4J A;  3AQP A;  3FKI A;  3G4A A;  4BKW A;  1IS1 A;  4C3H C;  2R93 A;  2JA7 A;  2XCQ A;  2GSU A;  1XXB A;  2KWA A;  1WQF A;  3LPX A;  4KMH A;  1TWG A;  3FOF A;  4LR2 A;  4GFQ A;  4G0V A;  2XCO A;  1K83 A;  1KQ4 A;  1TWF A;  5IOR A;  4GTL A;  3OPF A;  1WQH A;  2GSN A;  1BGW A;  4GTB A;  1R9T A;  3CQZ A;  4GTF A;  1O2B A;  3ERE D;  2B63 A;  5CHP A;  3N0C A;  4KMA A;  4DDQ A;  1WCM A;  1ZXO A;  3LAP A;  3GTK A;  2E2I A;  3AH5 A;  3AQO A;  5JVO A;  2NVX A;  1B4A A;  4KC6 A;  4J3N A;  3FHZ A;  3FOE A;  4KMD A;  1TWA A;  4GTC A;  4C3J C;  5TJ3 A;  2RH6 A;  1O28 A;  4GTE A;  1O25 A;  1O26 A;  3LAJ A;  2JH3 A;  4GTD A;  2PHC B;  4KAS A;  5CJ9 A;  2RGR A;  3BUE A;  3OEP A;  3V4G A;  5IOT A;  3N3Y A;  5EGE A;  1O29 A;  1I3Q A;  3N0B A;  3GTQ A;  4G0W A;  3GTM A;  3NUH A;  1XXC A;  3GTP A;  3GTJ A;  3Q3Q A;  1ZBS A;  2E2H A;  4G0U A;  4GT9 A;  5JFE A;  3GTL A;  2JA6 A;  4KB2 A;  1I50 A;  4FZB A;  1XXA A;  3GTO A;  2R92 A;  4LQY A;  2R7Z A;  4KAT A;  2VUM A;  2YU9 A;  4KAR A;  1Y1W A;  4C3I C;  3S0X A;  4ILD A;  4BLB A;  3L4K A;  3GTG A;  4BLA A;  4C2M C;  3CAG A;  4KM8 A;  1EK8 A;  3G4C A;  2CFA B;  1WIH A;  5EGH A;  4GTA A;  1WQG A;  2JA5 A;  2GSO A;  3MML B;  2P5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...