4GTAA

T. maritima fdts with fad, dump, and folinic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
215
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 79
structure length 215
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtaA00
3AH5A 4GTCA 1O27A 4FZBA 4GTLA 2CFAA 5IOSA 1O2AA 3N3YA 4GTDA 3G4CA 4KASA 1O28A 4KATA 5CHPA 5IOQA 4P5AA 4GTEA 5JFEA 1O29A 3G4AA 5IOTA 1KQ4A 4GTBA 1O25A 2CFAB 4GTFA 1O2BA 5IORA 4GT9A 1O26A 4GTAA 4P5BA 1O24A 4KARA 3N0BA 3N0CA
chains in the Genus database with same CATH superfamily
1EFWA 1O27A 3CQZA 3T00A 2BE5A 4FZBA 4GTLA 1B4AA 3PO2C 1YNNA 4RMFA 4J3NA 2B63K 1O28A 3AQOA 3CQZC 2V6SA 1F9NA 2CW0A 5C4JC 4BY1C 3GTPC 1XZQA 3TFJA 4OIQA 3GTGC 1I50K 5IP7C 4GTEA 5JFEA 3ADAC 2JA7C 4KB4A 5IOTA 1PJ7A 2NVYK 4A3BC 2Y3PA 4A3IK 5IORA 3PO3C 1J98A 2XCRB 1TWGK 4GTCA 1SMYA 2D6FC 5FLMC 2JA6A 2FQOA 1VGXA 1WORA 2JH3A 5M5WK 4A3LK 1Y1VA 3VA7A 3EQLA 2R92A 2JA5K 5C3EK 3GTMA 4A3DK 2W7VA 2YU9A 1KQ4A 3GTKA 5C4XK 1USMA 1WCMA 3S1NC 1V5VA 4BY7C 2PHCB 4BY1K 3GTJC 1ZVUA 1YCLA 2O5JA 1O2AA 4GTDA 1I3QA 1TWFA 4A3BK 3AD9C 3S16K 4KATA 4MEYA 3S17K 3A8KA 2KWAA 4KN7A 4A3LC 4XLNA 3HOWC 1XXBA 3K7AC 4P5BA 4C2MK 2JA6C 4KARA 1DCHA 3GTLC 4A3CC 2P5MA 4GFQA 1ZXOA 2YU9K 3FKIK 4Y7NC 4A3JK 4C3IK 5IYDK 4PAAA 4BBSC 4XSXA 3I4MK 2XCOA 1J6VA 4Q5SA 1TWGA 3H3VD 2R93K 5IP9C 3L4JA 4G0WA 5L46A 1GE9A 5EGEA 5JVOA 5M5XK 2NVXA 4BLBA 4QJVB 1K83A 5C44C 2VUMK 4KM9A 4C45A 3HOVC 3S2DK 3RZOC 4NOIA 4QJVA 4C3HK 3S15C 1RU0A 4ZH4A 1TWAK 4G0UA 1I3QK 1TWFK 2WAQL 3M4OC 3SZYA 1XZPA 3OPFA 3M3YC 2YU9C 4KN4A 1JOEA 2CFAB 4AYBL 3GIRA 3H3VL 4C3IC 5IYCK 4WILA 1IE0A 1XXCA 3HXAA 1WOOA 1SFOC 3GTKK 1I50C 1DCOA 1F93A 4KDDA 3LAPA 2R92K 3AD8C 4BXXC 4JK1A 3FKIA 3PO3K 2GSUA 4MEXA 1Y1WC 2A6HA 1TWHC 4PABA 1O2FB 1PJ6A 5C4JK 1EQRA 4G7HA 4LQYA 4G7OA 4KC6A 5IP7K 3HOUK 2WB1D 3RZOK 2NVYA 2Y0SD 2NVQK 2WB1L 3GEIA 1UV7A 3GDZA 3S15K 1WSRA 4WJ3M 3H0GK 1TWAC 5C3EC 1HI9A 4A3DC 4A3GK 2E2IC 5FLMK 1AB4A 3CAGA 4KASA 4OIOA 5FJ8K 2RGRA 3OEPA 4QIWL 4BBRC 4KM8A 3T01A 4LK1A 4KMUA 2PA8L 3S2HK 3S1QC 4ILDA 2PA8D 1X31C 1ZQ1C 2PPBA 3HOYK 1SFOA 3HOZC 1F7UA 4Y52C 4X6AK 2Y0SL 2GSOA 4C3JK 1BDFA 4BY7K 3G4CA 1WOPA 2FQTA 4G0VA 2JA8K 1Y1WA 4A3MK 2JA6K 4KMDA 2E2HC 3G4AA 4A3KC 4O2DA 2ZUEA 1F7VA 3I4NK 1ZYRA 4XSZA 1EK8A 4GT9A 4G7ZA 4GTAA 5IYDC 1Y1VC 1WSVA 3I4MC 3GTLK 2R7ZK 1IQ0A 3GTOK 2B63A 3S1QK 3PO2K 3GTLA 1IS1A 3FOFA 3CQZK 1O29A 1XPPA 3FHZA 4AYBD 2WAQD 1BS2A 1K83K 3V4GA 1INNA 2JA7A 4GTFA 2NVXK 3S14C 3BP3A 5E68A 3RZDC 3BP8C 5IP9K 3QX3A 1I3QC 1TWFC 2CFAA 3M4OK 1TWGC 4GZYA 1XXAA 2V6TA 3I4NC 4YFXA 3S2DC 5CHPA 3S1RC 3GTGA 5IYCC 5IYBK 4MQ9A 3S1NK 2V6UA 1WQGA 5D4DA 3HOXC 3GSIA 1IW7A 2PMZD 3OREA 1WCMC 3AQPA 1TWHK 4YFKA 1BGWA 4QIWD 1TWAA 1JQWA 4Q4ZA 3DXJA 1VRQC 3S1MK 4A3FK 3IPJA 2E2HA 1R9TC 1XZPB 1B4BA 1J6WA 1J6XA 1TWCK 3L4KA 4KB2A 4BXXK 1YX2A 4BLAA 4OINA 4LOWA 1WQHA 3HKZL 3ERED 2R93A 3GTQK 1JVIA 3S17C 3MMLB 1IL2A 3GTPA 4A3EK 2B63C 3JSTA 2A6EA 4KAWX 4XLPA 3TTGA 2NVTK 2GAGC 3GTGK 3H0GC 5EGHA 1DD5A 3GEHA 4A3GC 2E2IK 5M3FK 5IOQA 2O5IA 1C0AA 4P5AA 4AH6A 4BBRK 4C3JC 3S0XA 2A69A 1WIHA 3FOEA 2ZFZA 3GTPK 2GAHC 5HL8A 1O26A 2VUMC 3GTQA 2JA7K 1R9TK 1XZQB 2RH6A 5TMFA 1YNJA 4YG2A 2E2HK 4WJ4A 4X6AC 1TWCA 4LR2A 4A3IC 2JA5C 1TWHA 3GTQC 4A93C 3M3YK 2VUMA 4OIRA 1R9TA 1L0WA 4C3HC 4A3EC 3LAJA 4YFNA 1I6HK 2R7ZC 3GTJK 1ZBSA 1O2BA 4P9SA 4A3KK 2R92C 3N0BA 3AH5A 1VJEA 1ISEA 2ZUFA 5M3MK 5C4XC 2E2IA 1USOA 3GTMK 3N3YA 1Y1VK 4M1XA 1Y1WK 1K83C 4LLGA 3GTKC 1VH2A 1VLOA 3GTOC 3HOUC 3TFIA 2E2JK 3HOWK 2NVQC 3S16C 1DCPA 3NUHA 1O24A 4LK0A 4A93K 2NVXC 4A3JC 3S14K 1EI6A 3S1RK 1I6VA 5IOSA 3RZDK 2EBBA 4KMAA 4FM9A 2P8TA 1I50A 3K7AK 4C2MC 1I6HC 4A3CK 3S2HC 2XCQA 3GTOA 3AD7C 3FKIC 2R7ZA 4Y7NK 1HQMA 3HOYC 4DDQA 1WCMK 3H0GA 3A8IA 3SZZA 3HOZK 4Y52K 5IYBC 3GTMC 2PMZL 4BBSK 3S1MC 3HOVK 4A3FC 3N0CA 1WQFA 4BKWA 3HOXK 3TFHA 4OIPA 1WOSA 2NVYC 1TWCC 3WODA 2JA5A 1IBAA 2R93C 5CJ9A 3T02A 3LPXA 2E2JC 1BJTA 5TMCA 1PJ5A 5TJ3A 5C44K 3HKZD 4KMHA 3BUEA 2GSNA 1G51A 3GEEA 4XCHA 5M5YK 2JA8C 4GTBA 4A3MC 3Q3QA 3A8JA 4LJZA 1O25A 2NVTC 1EH1A 1SFOK 2A68A 3GTJA
chains in the Genus database with same CATH topology
1O27A 3CQZA 1K83A 4FZBA 4GTLA 2RH6A 1B4AA 4KM9A 1TWCA 4LR2A 4J3NA 2B63A 1O28A 3AQOA 1F9NA 3GTLA 1TWHA 2VUMA 4G0UA 1R9TA 1IS1A 4GTEA 4C3HC 1O29A 5JFEA 3FOFA 4KB4A 5IOTA 3FHZA 3LAJA 3OPFA 3V4GA 2JA7A 1ZBSA 2CFAB 2Y3PA 4GTFA 1O2BA 5IORA 4C3IC 2XCRB 3N0BA 3AH5A 4GTCA 1XXCA 2JA6A 3QX3A 1ISEA 4KDDA 3LAPA 2CFAA 2E2IA 2JH3A 3N3YA 4M1XA 1XXAA 1Y1VA 3VA7A 5CHPA 2R92A 3FKIA 2GSUA 3GTGA 3GTMA 4LQYA 1KQ4A 2YU9A 3GTKA 4KC6A 1WQGA 3NUHA 1WCMA 2NVYA 1O24A 2PHCB 1ZVUA 3OREA 3AQPA 5IOSA 1O2AA 4KMAA 1BGWA 4GTDA 4FM9A 1AB4A 1TWFA 3CAGA 1TWAA 4KASA 1I3QA 1I50A 4C2MC 2RGRA 4KATA 3OEPA 2E2HA 2XCQA 3L4KA 1B4BA 3GTOA 4KM8A 4KB2A 2R7ZA 4BLAA 4DDQA 3H0GA 1WQHA 4ILDA 3ERED 2R93A 2KWAA 1XXBA 3MMLB 4P5BA 1SFOA 3GTPA 4KARA 3N0CA 1WQFA 4BKWA 2P5MA 4GFQA 2GSOA 1ZXOA 4KAWX 2JA5A 5CJ9A 3LPXA 3G4CA 1BJTA 5EGHA 3GTJA 1DD5A 4G0VA 5TJ3A 5IOQA 1Y1WA 4KMHA 3BUEA 2GSNA 4P5AA 4KMDA 3G4AA 2XCOA 4GTBA 3FOEA 4C3JC 3S0XA 1WIHA 1TWGA 3Q3QA 1O25A 1EH1A 2ZFZA 3L4JA 4G0WA 1GE9A 1EK8A 4GT9A 1O26A 5EGEA 5JVOA 4GTAA 3GTQA 2NVXA 4BLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH5 A;  4GTC A;  1O27 A;  4FZB A;  4GTL A;  2CFA A;  5IOS A;  1O2A A;  3N3Y A;  4GTD A;  3G4C A;  4KAS A;  1O28 A;  4KAT A;  5CHP A;  5IOQ A;  4P5A A;  4GTE A;  5JFE A;  1O29 A;  3G4A A;  5IOT A;  1KQ4 A;  4GTB A;  1O25 A;  2CFA B;  4GTF A;  1O2B A;  5IOR A;  4GT9 A;  1O26 A;  4GTA A;  4P5B A;  1O24 A;  4KAR A;  3N0B A;  3N0C A; 
#chains in the Genus database with same CATH topology
 1EFW A;  1O27 A;  3CQZ A;  3T00 A;  2BE5 A;  4FZB A;  4GTL A;  1B4A A;  3PO2 C;  1YNN A;  4RMF A;  4J3N A;  2B63 K;  1O28 A;  3AQO A;  3CQZ C;  2V6S A;  1F9N A;  2CW0 A;  5C4J C;  4BY1 C;  3GTP C;  1XZQ A;  3TFJ A;  4OIQ A;  3GTG C;  1I50 K;  5IP7 C;  4GTE A;  5JFE A;  3ADA C;  2JA7 C;  4KB4 A;  5IOT A;  1PJ7 A;  2NVY K;  4A3B C;  2Y3P A;  4A3I K;  5IOR A;  3PO3 C;  1J98 A;  2XCR B;  1TWG K;  4GTC A;  1SMY A;  2D6F C;  5FLM C;  2JA6 A;  2FQO A;  1VGX A;  1WOR A;  2JH3 A;  5M5W K;  4A3L K;  1Y1V A;  3VA7 A;  3EQL A;  2R92 A;  2JA5 K;  5C3E K;  3GTM A;  4A3D K;  2W7V A;  2YU9 A;  1KQ4 A;  3GTK A;  5C4X K;  1USM A;  1WCM A;  3S1N C;  1V5V A;  4BY7 C;  2PHC B;  4BY1 K;  3GTJ C;  1ZVU A;  1YCL A;  2O5J A;  1O2A A;  4GTD A;  1I3Q A;  1TWF A;  4A3B K;  3AD9 C;  3S16 K;  4KAT A;  4MEY A;  3S17 K;  3A8K A;  2KWA A;  4KN7 A;  4A3L C;  4XLN A;  3HOW C;  1XXB A;  3K7A C;  4P5B A;  4C2M K;  2JA6 C;  4KAR A;  1DCH A;  3GTL C;  4A3C C;  2P5M A;  4GFQ A;  1ZXO A;  2YU9 K;  3FKI K;  4Y7N C;  4A3J K;  4C3I K;  5IYD K;  4PAA A;  4BBS C;  4XSX A;  3I4M K;  2XCO A;  1J6V A;  4Q5S A;  1TWG A;  3H3V D;  2R93 K;  5IP9 C;  3L4J A;  4G0W A;  5L46 A;  1GE9 A;  5EGE A;  5JVO A;  5M5X K;  2NVX A;  4BLB A;  4QJV B;  1K83 A;  5C44 C;  2VUM K;  4KM9 A;  4C45 A;  3HOV C;  3S2D K;  3RZO C;  4NOI A;  4QJV A;  4C3H K;  3S15 C;  1RU0 A;  4ZH4 A;  1TWA K;  4G0U A;  1I3Q K;  1TWF K;  2WAQ L;  3M4O C;  3SZY A;  1XZP A;  3OPF A;  3M3Y C;  2YU9 C;  4KN4 A;  1JOE A;  2CFA B;  4AYB L;  3GIR A;  3H3V L;  4C3I C;  5IYC K;  4WIL A;  1IE0 A;  1XXC A;  3HXA A;  1WOO A;  1SFO C;  3GTK K;  1I50 C;  1DCO A;  1F93 A;  4KDD A;  3LAP A;  2R92 K;  3AD8 C;  4BXX C;  4JK1 A;  3FKI A;  3PO3 K;  2GSU A;  4MEX A;  1Y1W C;  2A6H A;  1TWH C;  4PAB A;  1O2F B;  1PJ6 A;  5C4J K;  1EQR A;  4G7H A;  4LQY A;  4G7O A;  4KC6 A;  5IP7 K;  3HOU K;  2WB1 D;  3RZO K;  2NVY A;  2Y0S D;  2NVQ K;  2WB1 L;  3GEI A;  1UV7 A;  3GDZ A;  3S15 K;  1WSR A;  4WJ3 M;  3H0G K;  1TWA C;  5C3E C;  1HI9 A;  4A3D C;  4A3G K;  2E2I C;  5FLM K;  1AB4 A;  3CAG A;  4KAS A;  4OIO A;  5FJ8 K;  2RGR A;  3OEP A;  4QIW L;  4BBR C;  4KM8 A;  3T01 A;  4LK1 A;  4KMU A;  2PA8 L;  3S2H K;  3S1Q C;  4ILD A;  2PA8 D;  1X31 C;  1ZQ1 C;  2PPB A;  3HOY K;  1SFO A;  3HOZ C;  1F7U A;  4Y52 C;  4X6A K;  2Y0S L;  2GSO A;  4C3J K;  1BDF A;  4BY7 K;  3G4C A;  1WOP A;  2FQT A;  4G0V A;  2JA8 K;  1Y1W A;  4A3M K;  2JA6 K;  4KMD A;  2E2H C;  3G4A A;  4A3K C;  4O2D A;  2ZUE A;  1F7V A;  3I4N K;  1ZYR A;  4XSZ A;  1EK8 A;  4GT9 A;  4G7Z A;  4GTA A;  5IYD C;  1Y1V C;  1WSV A;  3I4M C;  3GTL K;  2R7Z K;  1IQ0 A;  3GTO K;  2B63 A;  3S1Q K;  3PO2 K;  3GTL A;  1IS1 A;  3FOF A;  3CQZ K;  1O29 A;  1XPP A;  3FHZ A;  4AYB D;  2WAQ D;  1BS2 A;  1K83 K;  3V4G A;  1INN A;  2JA7 A;  4GTF A;  2NVX K;  3S14 C;  3BP3 A;  5E68 A;  3RZD C;  3BP8 C;  5IP9 K;  3QX3 A;  1I3Q C;  1TWF C;  2CFA A;  3M4O K;  1TWG C;  4GZY A;  1XXA A;  2V6T A;  3I4N C;  4YFX A;  3S2D C;  5CHP A;  3S1R C;  3GTG A;  5IYC C;  5IYB K;  4MQ9 A;  3S1N K;  2V6U A;  1WQG A;  5D4D A;  3HOX C;  3GSI A;  1IW7 A;  2PMZ D;  3ORE A;  1WCM C;  3AQP A;  1TWH K;  4YFK A;  1BGW A;  4QIW D;  1TWA A;  1JQW A;  4Q4Z A;  3DXJ A;  1VRQ C;  3S1M K;  4A3F K;  3IPJ A;  2E2H A;  1R9T C;  1XZP B;  1B4B A;  1J6W A;  1J6X A;  1TWC K;  3L4K A;  4KB2 A;  4BXX K;  1YX2 A;  4BLA A;  4OIN A;  4LOW A;  1WQH A;  3HKZ L;  3ERE D;  2R93 A;  3GTQ K;  1JVI A;  3S17 C;  3MML B;  1IL2 A;  3GTP A;  4A3E K;  2B63 C;  3JST A;  2A6E A;  4KAW X;  4XLP A;  3TTG A;  2NVT K;  2GAG C;  3GTG K;  3H0G C;  5EGH A;  1DD5 A;  3GEH A;  4A3G C;  2E2I K;  5M3F K;  5IOQ A;  2O5I A;  1C0A A;  4P5A A;  4AH6 A;  4BBR K;  4C3J C;  3S0X A;  2A69 A;  1WIH A;  3FOE A;  2ZFZ A;  3GTP K;  2GAH C;  5HL8 A;  1O26 A;  2VUM C;  3GTQ A;  2JA7 K;  1R9T K;  1XZQ B;  2RH6 A;  5TMF A;  1YNJ A;  4YG2 A;  2E2H K;  4WJ4 A;  4X6A C;  1TWC A;  4LR2 A;  4A3I C;  2JA5 C;  1TWH A;  3GTQ C;  4A93 C;  3M3Y K;  2VUM A;  4OIR A;  1R9T A;  1L0W A;  4C3H C;  4A3E C;  3LAJ A;  4YFN A;  1I6H K;  2R7Z C;  3GTJ K;  1ZBS A;  1O2B A;  4P9S A;  4A3K K;  2R92 C;  3N0B A;  3AH5 A;  1VJE A;  1ISE A;  2ZUF A;  5M3M K;  5C4X C;  2E2I A;  1USO A;  3GTM K;  3N3Y A;  1Y1V K;  4M1X A;  1Y1W K;  1K83 C;  4LLG A;  3GTK C;  1VH2 A;  1VLO A;  3GTO C;  3HOU C;  3TFI A;  2E2J K;  3HOW K;  2NVQ C;  3S16 C;  1DCP A;  3NUH A;  1O24 A;  4LK0 A;  4A93 K;  2NVX C;  4A3J C;  3S14 K;  1EI6 A;  3S1R K;  1I6V A;  5IOS A;  3RZD K;  2EBB A;  4KMA A;  4FM9 A;  2P8T A;  1I50 A;  3K7A K;  4C2M C;  1I6H C;  4A3C K;  3S2H C;  2XCQ A;  3GTO A;  3AD7 C;  3FKI C;  2R7Z A;  4Y7N K;  1HQM A;  3HOY C;  4DDQ A;  1WCM K;  3H0G A;  3A8I A;  3SZZ A;  3HOZ K;  4Y52 K;  5IYB C;  3GTM C;  2PMZ L;  4BBS K;  3S1M C;  3HOV K;  4A3F C;  3N0C A;  1WQF A;  4BKW A;  3HOX K;  3TFH A;  4OIP A;  1WOS A;  2NVY C;  1TWC C;  3WOD A;  2JA5 A;  1IBA A;  2R93 C;  5CJ9 A;  3T02 A;  3LPX A;  2E2J C;  1BJT A;  5TMC A;  1PJ5 A;  5TJ3 A;  5C44 K;  3HKZ D;  4KMH A;  3BUE A;  2GSN A;  1G51 A;  3GEE A;  4XCH A;  5M5Y K;  2JA8 C;  4GTB A;  4A3M C;  3Q3Q A;  3A8J A;  4LJZ A;  1O25 A;  2NVT C;  1EH1 A;  1SFO K;  2A68 A;  3GTJ A; 
#chains in the Genus database with same CATH homology
 1O27 A;  3CQZ A;  1K83 A;  4FZB A;  4GTL A;  2RH6 A;  1B4A A;  4KM9 A;  1TWC A;  4LR2 A;  4J3N A;  2B63 A;  1O28 A;  3AQO A;  1F9N A;  3GTL A;  1TWH A;  2VUM A;  4G0U A;  1R9T A;  1IS1 A;  4GTE A;  4C3H C;  1O29 A;  5JFE A;  3FOF A;  4KB4 A;  5IOT A;  3FHZ A;  3LAJ A;  3OPF A;  3V4G A;  2JA7 A;  1ZBS A;  2CFA B;  2Y3P A;  4GTF A;  1O2B A;  5IOR A;  4C3I C;  2XCR B;  3N0B A;  3AH5 A;  4GTC A;  1XXC A;  2JA6 A;  3QX3 A;  1ISE A;  4KDD A;  3LAP A;  2CFA A;  2E2I A;  2JH3 A;  3N3Y A;  4M1X A;  1XXA A;  1Y1V A;  3VA7 A;  5CHP A;  2R92 A;  3FKI A;  2GSU A;  3GTG A;  3GTM A;  4LQY A;  1KQ4 A;  2YU9 A;  3GTK A;  4KC6 A;  1WQG A;  3NUH A;  1WCM A;  2NVY A;  1O24 A;  2PHC B;  1ZVU A;  3ORE A;  3AQP A;  5IOS A;  1O2A A;  4KMA A;  1BGW A;  4GTD A;  4FM9 A;  1AB4 A;  1TWF A;  3CAG A;  1TWA A;  4KAS A;  1I3Q A;  1I50 A;  4C2M C;  2RGR A;  4KAT A;  3OEP A;  2E2H A;  2XCQ A;  3L4K A;  1B4B A;  3GTO A;  4KM8 A;  4KB2 A;  2R7Z A;  4BLA A;  4DDQ A;  3H0G A;  1WQH A;  4ILD A;  3ERE D;  2R93 A;  2KWA A;  1XXB A;  3MML B;  4P5B A;  1SFO A;  3GTP A;  4KAR A;  3N0C A;  1WQF A;  4BKW A;  2P5M A;  4GFQ A;  2GSO A;  1ZXO A;  4KAW X;  2JA5 A;  5CJ9 A;  3LPX A;  3G4C A;  1BJT A;  5EGH A;  3GTJ A;  1DD5 A;  4G0V A;  5TJ3 A;  5IOQ A;  1Y1W A;  4KMH A;  3BUE A;  2GSN A;  4P5A A;  4KMD A;  3G4A A;  2XCO A;  4GTB A;  3FOE A;  4C3J C;  3S0X A;  1WIH A;  1TWG A;  3Q3Q A;  1O25 A;  1EH1 A;  2ZFZ A;  3L4J A;  4G0W A;  1GE9 A;  1EK8 A;  4GT9 A;  1O26 A;  5EGE A;  5JVO A;  4GTA A;  3GTQ A;  2NVX A;  4BLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...