5IOQA

Flavin-dependent thymidylate synthase in complex with fad and deoxyuridine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
210
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 210
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5ioqA00
4P5AA 5IOQA 4GTLA 1O27A 4KARA 1O2BA 5CHPA 1O26A 3N3YA 4GT9A 3N0CA 4GTDA 3G4AA 1O29A 2CFAA 1O24A 4KATA 3N0BA 5IORA 5IOSA 3G4CA 4GTFA 4GTBA 4GTAA 2CFAB 4GTEA 4GTCA 4P5BA 1O25A 1O28A 1KQ4A 4KASA 5JFEA 1O2AA 3AH5A 5IOTA 4FZBA
chains in the Genus database with same CATH superfamily
1WORA 3S14C 5FJ8K 3I4MK 3M4OK 1RU0A 2E2HK 4BBSC 2RGRA 5C3EK 1X31C 3JSTA 5IOSA 1ZBSA 2NVYC 2NVXC 4QIWD 4Q5SA 2JA6K 2R7ZK 2GSOA 3TTGA 3GTJA 1I3QK 4BY7K 2JA7K 4LQYA 3GTGK 1BS2A 1VGXA 2JA5K 3SZZA 4C3JK 3S1QC 2BE5A 1JQWA 4XLPA 4C2MC 3L4KA 2VUMC 3GTKA 3RZDC 2FQOA 1O2BA 2V6UA 1G51A 1PJ5A 5IYBC 1TWFK 1BJTA 2E2HA 1TWCC 3CQZC 3HOUC 4A3KC 3GDZA 5IORA 1I50C 2KWAA 4QJVB 1Y1VK 3GTJC 5IYCK 1VLOA 5IYDC 3HKZL 1HI9A 3S16K 2JA6A 2R7ZA 1SMYA 4P9SA 3IPJA 3OEPA 1IL2A 1O2FB 1I3QA 3S1RC 2JA7A 2PA8D 3GTGA 2XCQA 3GIRA 1R9TK 3GTOK 4A3FK 1EFWA 2JA5A 1F93A 4OIOA 4A3GK 4KB2A 3HOXK 3I4MC 3AD8C 4P5AA 4KARA 4A3CK 3LPXA 4C3IK 1PJ6A 3GEHA 1TWFA 3FOFA 3PO3C 3GTPC 1VJEA 2E2IK 3GTQK 3FKIC 1Y1VA 1EI6A 3GTLK 4YFNA 4GTEA 3H0GK 1AB4A 1O25A 4G0UA 5IP7K 4A3IC 1R9TA 3GTOA 4A3DC 4BXXK 4KASA 4LOWA 4YFXA 3HOWK 5C4JK 3GTMC 3HOYK 1Y1WK 4C3HC 5CHPA 4OIPA 3N3YA 2B63K 5IP9C 5M3MK 3SZYA 3L4JA 4A3JC 3S14K 2E2IA 3GTQA 4BBSK 2WB1L 4YFKA 3EQLA 3GTLA 5CJ9A 4A3FC 3H0GA 3WODA 4A3BC 2NVYK 3ERED 1WCMC 3V4GA 4O2DA 1K83C 5EGEA 2YU9C 1V5VA 4MEXA 1Y1WA 1GE9A 4QJVA 2NVQC 2B63A 4C2MK 2VUMK 3RZDK 3GEIA 1O24A 3HOVC 3T02A 2GSNA 3S0XA 5IYBK 4AH6A 1TWCK 1ZXOA 3ADAC 3CQZK 3HOUK 5IP7C 4A3KK 4GTBA 1USMA 4P5BA 1I50K 1XXAA 2NVXA 2NVYA 1ZQ1C 5IYDK 4Y7NC 4MQ9A 1Y1WC 1WOPA 3AD9C 3AH5A 2W7VA 3S1RK 1ZVUA 4KMUA 1I6HC 5EGHA 4GFQA 5C44C 2V6SA 2Y0SD 1YCLA 4KMAA 2VUMA 4J3NA 4BKWA 3H3VL 4KATA 4PAAA 1TWCA 3CQZA 3PO3K 2RH6A 3AQOA 3GTPK 1XZQB 1I50A 3FKIK 4KN4A 2WAQL 4Y52C 1F9NA 4A3IK 1TWGC 4A3DK 5JVOA 3S17C 4AYBL 4KMDA 1WOOA 1XPPA 3GTMK 4KC6A 4C3HK 4BBRC 1WIHA 1XZPB 5IP9K 4A3JK 5D4DA 4A93C 3GTPA 4YG2A 4KAWX 4OIQA 1XXBA 1JVIA 3FKIA 3MMLB 4RMFA 5C4XK 1EK8A 2Y3PA 3GEEA 1C0AA 4A3BK 5IOQA 1B4AA 1WCMK 3HXAA 1K83K 3H3VD 2YU9K 3GTMA 1WQGA 4LK0A 1HQMA 2A69A 2NVQK 1IW7A 4KM8A 2GSUA 1BDFA 1J6XA 2EBBA 4GTFA 2E2JC 4MEYA 3HOVK 4PABA 5M5WK 1B4BA 4WJ3M 2ZUFA 3I4NC 1IBAA 5JFEA 3CAGA 4Y7NK 1WCMA 1WQFA 3S15C 1K83A 2YU9A 1I6HK 1XZQA 5C44K 3LAPA 1EQRA 3S1NC 3RZOC 3HKZD 2CFAB 5C4XC 5TJ3A 4XSXA 1F7VA 2NVTC 2R92C 1KQ4A 1INNA 4GTLA 3QX3A 4NOIA 1O26A 4Y52K 1TWGK 2PMZL 4KN7A 3S1MC 2ZFZA 3S2HC 3S17K 3N0BA 3FOEA 4QIWL 4BBRK 3PO2C 1IQ0A 4G7HA 1DCOA 1J6WA 4A3EC 4A93K 1L0WA 4BY1C 2R93C 4GT9A 3N0CA 3T00A 3G4AA 1TWGA 1DD5A 3NUHA 1BGWA 3TFJA 3HOZC 4XCHA 2WB1D 4WILA 1PJ7A 1SFOC 2GAGC 1TWHC 4G0VA 1IE0A 2PA8L 2E2JK 4X6AC 5E68A 4LJZA 1TWAC 1VH2A 3T01A 1DCPA 3I4NK 4BLAA 2PMZD 4GTDA 2XCOA 3A8IA 3BP3A 4ILDA 3FHZA 2CFAA 3S15K 3K7AC 4ZH4A 2D6FC 1F7UA 2CW0A 3S1NK 3RZOK 1O28A 3AQPA 4LR2A 1EH1A 2A6EA 4A3MC 2NVTK 1YNJA 2R92K 4OINA 5HL8A 1ZYRA 4XLNA 1DCHA 1ISEA 4DDQA 4KMHA 3M3YC 3S2DC 5L46A 1USOA 3DXJA 2JA8K 3S1MK 3S2HK 4C45A 4A3LC 5M5XK 4OIRA 4M1XA 4G7ZA 5FLMC 1WQHA 2WAQD 3GTKC 4XSZA 4BLBA 1YX2A 3PO2K 3M4OC 1O2AA 2O5JA 2E2HC 4A3EK 1VRQC 1J6VA 1IS1A 2R92A 5C3EC 4AYBD 5M3FK 4BY1K 2R93K 1WSRA 3GSIA 2JA6C 2R7ZC 4FZBA 1XXCA 1I6VA 5TMFA 1I3QC 4BY7C 2JA7C 3GTGC 2XCRB 4G0WA 2JA5C 2V6TA 4C3JC 3A8KA 3HOZK 3LAJA 1SFOK 1TWHK 2P8TA 2A6HA 1TWFC 1YNNA 2A68A 3TFHA 3OREA 3OPFA 4X6AK 2JH3A 1XZPA 3BP8C 1TWAK 1WSVA 1Y1VC 2Y0SL 5IYCC 1O29A 2JA8C 3A8JA 3VA7A 3S16C 2R93A 1JOEA 2PHCB 1R9TC 2O5IA 3GTOC 2NVXK 4A3GC 4KDDA 3K7AK 3HOXC 1SFOA 4A3CC 2P5MA 1TWHA 3TFIA 4C3IC 2GAHC 5M5YK 1O27A 3S1QK 4LK1A 2ZUEA 1J98A 3AD7C 2E2IC 4G7OA 3GTQC 4A3MK 1TWAA 3GTLC 4KM9A 3H0GC 4KB4A 2FQTA 3G4CA 4Q4ZA 4GZYA 3M3YK 3S2DK 4FM9A 5TMCA 4WJ4A 4GTAA 1UV7A 4GTCA 4BXXC 3GTJK 3HOWC 2PPBA 5C4JC 3HOYC 3Q3QA 4JK1A 4A3LK 1WOSA 5FLMK 5IOTA 2B63C 3BUEA 4LLGA 3GTKK
chains in the Genus database with same CATH topology
1Y1WA 1WCMA 1WQFA 1GE9A 2B63A 1ISEA 4DDQA 1K83A 2YU9A 2RGRA 4KMHA 1O24A 3BUEA 3LAPA 2GSNA 1ZBSA 5IOSA 3S0XA 5EGEA 1ZXOA 4GTBA 2CFAB 4P5BA 2GSOA 5TJ3A 4M1XA 1XXAA 3GTJA 2NVXA 2NVYA 1WQHA 4LQYA 1KQ4A 4BLBA 1O2AA 3AH5A 1ZVUA 4C2MC 3L4KA 3GTKA 4GTLA 5EGHA 1IS1A 1O2BA 2R92A 3QX3A 4GFQA 1O26A 4KMAA 1BJTA 2E2HA 2VUMA 2ZFZA 4J3NA 4BKWA 4KATA 3N0BA 5IORA 1XXCA 2KWAA 1TWCA 3CQZA 3FOEA 2RH6A 2XCRB 3AQOA 4G0WA 2R7ZA 2JA6A 4C3JC 3OEPA 1I50A 1I3QA 2JA7A 3GTGA 2XCQA 3LAJA 2JA5A 4KB2A 1F9NA 4P5AA 3OREA 3OPFA 4KARA 2JH3A 5JVOA 4GT9A 3LPXA 3N0CA 4KMDA 1TWFA 3G4AA 1TWGA 4KC6A 3FOFA 1O29A 3VA7A 1DD5A 2R93A 3NUHA 1BGWA 2PHCB 1WIHA 1Y1VA 3GTPA 4GTEA 4KAWX 1XXBA 4KDDA 1AB4A 1O25A 4G0UA 4G0VA 3FKIA 3MMLB 1R9TA 3GTOA 1SFOA 1EK8A 2Y3PA 4KASA 2P5MA 1TWHA 4C3IC 5IOQA 1B4AA 1O27A 4C3HC 5CHPA 3N3YA 4BLAA 4GTDA 2XCOA 1TWAA 4ILDA 3GTMA 1WQGA 3FHZA 3L4JA 2CFAA 4KM9A 4KB4A 2E2IA 3G4CA 4KM8A 2GSUA 3GTQA 4FM9A 4GTFA 3GTLA 4GTAA 5CJ9A 4GTCA 3H0GA 1B4BA 1O28A 3AQPA 4LR2A 3ERED 3Q3QA 1EH1A 3V4GA 5IOTA 5JFEA 3CAGA 4FZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5A A;  5IOQ A;  4GTL A;  1O27 A;  4KAR A;  1O2B A;  5CHP A;  1O26 A;  3N3Y A;  4GT9 A;  3N0C A;  4GTD A;  3G4A A;  1O29 A;  2CFA A;  1O24 A;  4KAT A;  3N0B A;  5IOR A;  5IOS A;  3G4C A;  4GTF A;  4GTB A;  4GTA A;  2CFA B;  4GTE A;  4GTC A;  4P5B A;  1O25 A;  1O28 A;  1KQ4 A;  4KAS A;  5JFE A;  1O2A A;  3AH5 A;  5IOT A;  4FZB A; 
#chains in the Genus database with same CATH topology
 1WOR A;  3S14 C;  5FJ8 K;  3I4M K;  3M4O K;  1RU0 A;  2E2H K;  4BBS C;  2RGR A;  5C3E K;  1X31 C;  3JST A;  5IOS A;  1ZBS A;  2NVY C;  2NVX C;  4QIW D;  4Q5S A;  2JA6 K;  2R7Z K;  2GSO A;  3TTG A;  3GTJ A;  1I3Q K;  4BY7 K;  2JA7 K;  4LQY A;  3GTG K;  1BS2 A;  1VGX A;  2JA5 K;  3SZZ A;  4C3J K;  3S1Q C;  2BE5 A;  1JQW A;  4XLP A;  4C2M C;  3L4K A;  2VUM C;  3GTK A;  3RZD C;  2FQO A;  1O2B A;  2V6U A;  1G51 A;  1PJ5 A;  5IYB C;  1TWF K;  1BJT A;  2E2H A;  1TWC C;  3CQZ C;  3HOU C;  4A3K C;  3GDZ A;  5IOR A;  1I50 C;  2KWA A;  4QJV B;  1Y1V K;  3GTJ C;  5IYC K;  1VLO A;  5IYD C;  3HKZ L;  1HI9 A;  3S16 K;  2JA6 A;  2R7Z A;  1SMY A;  4P9S A;  3IPJ A;  3OEP A;  1IL2 A;  1O2F B;  1I3Q A;  3S1R C;  2JA7 A;  2PA8 D;  3GTG A;  2XCQ A;  3GIR A;  1R9T K;  3GTO K;  4A3F K;  1EFW A;  2JA5 A;  1F93 A;  4OIO A;  4A3G K;  4KB2 A;  3HOX K;  3I4M C;  3AD8 C;  4P5A A;  4KAR A;  4A3C K;  3LPX A;  4C3I K;  1PJ6 A;  3GEH A;  1TWF A;  3FOF A;  3PO3 C;  3GTP C;  1VJE A;  2E2I K;  3GTQ K;  3FKI C;  1Y1V A;  1EI6 A;  3GTL K;  4YFN A;  4GTE A;  3H0G K;  1AB4 A;  1O25 A;  4G0U A;  5IP7 K;  4A3I C;  1R9T A;  3GTO A;  4A3D C;  4BXX K;  4KAS A;  4LOW A;  4YFX A;  3HOW K;  5C4J K;  3GTM C;  3HOY K;  1Y1W K;  4C3H C;  5CHP A;  4OIP A;  3N3Y A;  2B63 K;  5IP9 C;  5M3M K;  3SZY A;  3L4J A;  4A3J C;  3S14 K;  2E2I A;  3GTQ A;  4BBS K;  2WB1 L;  4YFK A;  3EQL A;  3GTL A;  5CJ9 A;  4A3F C;  3H0G A;  3WOD A;  4A3B C;  2NVY K;  3ERE D;  1WCM C;  3V4G A;  4O2D A;  1K83 C;  5EGE A;  2YU9 C;  1V5V A;  4MEX A;  1Y1W A;  1GE9 A;  4QJV A;  2NVQ C;  2B63 A;  4C2M K;  2VUM K;  3RZD K;  3GEI A;  1O24 A;  3HOV C;  3T02 A;  2GSN A;  3S0X A;  5IYB K;  4AH6 A;  1TWC K;  1ZXO A;  3ADA C;  3CQZ K;  3HOU K;  5IP7 C;  4A3K K;  4GTB A;  1USM A;  4P5B A;  1I50 K;  1XXA A;  2NVX A;  2NVY A;  1ZQ1 C;  5IYD K;  4Y7N C;  4MQ9 A;  1Y1W C;  1WOP A;  3AD9 C;  3AH5 A;  2W7V A;  3S1R K;  1ZVU A;  4KMU A;  1I6H C;  5EGH A;  4GFQ A;  5C44 C;  2V6S A;  2Y0S D;  1YCL A;  4KMA A;  2VUM A;  4J3N A;  4BKW A;  3H3V L;  4KAT A;  4PAA A;  1TWC A;  3CQZ A;  3PO3 K;  2RH6 A;  3AQO A;  3GTP K;  1XZQ B;  1I50 A;  3FKI K;  4KN4 A;  2WAQ L;  4Y52 C;  1F9N A;  4A3I K;  1TWG C;  4A3D K;  5JVO A;  3S17 C;  4AYB L;  4KMD A;  1WOO A;  1XPP A;  3GTM K;  4KC6 A;  4C3H K;  4BBR C;  1WIH A;  1XZP B;  5IP9 K;  4A3J K;  5D4D A;  4A93 C;  3GTP A;  4YG2 A;  4KAW X;  4OIQ A;  1XXB A;  1JVI A;  3FKI A;  3MML B;  4RMF A;  5C4X K;  1EK8 A;  2Y3P A;  3GEE A;  1C0A A;  4A3B K;  5IOQ A;  1B4A A;  1WCM K;  3HXA A;  1K83 K;  3H3V D;  2YU9 K;  3GTM A;  1WQG A;  4LK0 A;  1HQM A;  2A69 A;  2NVQ K;  1IW7 A;  4KM8 A;  2GSU A;  1BDF A;  1J6X A;  2EBB A;  4GTF A;  2E2J C;  4MEY A;  3HOV K;  4PAB A;  5M5W K;  1B4B A;  4WJ3 M;  2ZUF A;  3I4N C;  1IBA A;  5JFE A;  3CAG A;  4Y7N K;  1WCM A;  1WQF A;  3S15 C;  1K83 A;  2YU9 A;  1I6H K;  1XZQ A;  5C44 K;  3LAP A;  1EQR A;  3S1N C;  3RZO C;  3HKZ D;  2CFA B;  5C4X C;  5TJ3 A;  4XSX A;  1F7V A;  2NVT C;  2R92 C;  1KQ4 A;  1INN A;  4GTL A;  3QX3 A;  4NOI A;  1O26 A;  4Y52 K;  1TWG K;  2PMZ L;  4KN7 A;  3S1M C;  2ZFZ A;  3S2H C;  3S17 K;  3N0B A;  3FOE A;  4QIW L;  4BBR K;  3PO2 C;  1IQ0 A;  4G7H A;  1DCO A;  1J6W A;  4A3E C;  4A93 K;  1L0W A;  4BY1 C;  2R93 C;  4GT9 A;  3N0C A;  3T00 A;  3G4A A;  1TWG A;  1DD5 A;  3NUH A;  1BGW A;  3TFJ A;  3HOZ C;  4XCH A;  2WB1 D;  4WIL A;  1PJ7 A;  1SFO C;  2GAG C;  1TWH C;  4G0V A;  1IE0 A;  2PA8 L;  2E2J K;  4X6A C;  5E68 A;  4LJZ A;  1TWA C;  1VH2 A;  3T01 A;  1DCP A;  3I4N K;  4BLA A;  2PMZ D;  4GTD A;  2XCO A;  3A8I A;  3BP3 A;  4ILD A;  3FHZ A;  2CFA A;  3S15 K;  3K7A C;  4ZH4 A;  2D6F C;  1F7U A;  2CW0 A;  3S1N K;  3RZO K;  1O28 A;  3AQP A;  4LR2 A;  1EH1 A;  2A6E A;  4A3M C;  2NVT K;  1YNJ A;  2R92 K;  4OIN A;  5HL8 A;  1ZYR A;  4XLN A;  1DCH A;  1ISE A;  4DDQ A;  4KMH A;  3M3Y C;  3S2D C;  5L46 A;  1USO A;  3DXJ A;  2JA8 K;  3S1M K;  3S2H K;  4C45 A;  4A3L C;  5M5X K;  4OIR A;  4M1X A;  4G7Z A;  5FLM C;  1WQH A;  2WAQ D;  3GTK C;  4XSZ A;  4BLB A;  1YX2 A;  3PO2 K;  3M4O C;  1O2A A;  2O5J A;  2E2H C;  4A3E K;  1VRQ C;  1J6V A;  1IS1 A;  2R92 A;  5C3E C;  4AYB D;  5M3F K;  4BY1 K;  2R93 K;  1WSR A;  3GSI A;  2JA6 C;  2R7Z C;  4FZB A;  1XXC A;  1I6V A;  5TMF A;  1I3Q C;  4BY7 C;  2JA7 C;  3GTG C;  2XCR B;  4G0W A;  2JA5 C;  2V6T A;  4C3J C;  3A8K A;  3HOZ K;  3LAJ A;  1SFO K;  1TWH K;  2P8T A;  2A6H A;  1TWF C;  1YNN A;  2A68 A;  3TFH A;  3ORE A;  3OPF A;  4X6A K;  2JH3 A;  1XZP A;  3BP8 C;  1TWA K;  1WSV A;  1Y1V C;  2Y0S L;  5IYC C;  1O29 A;  2JA8 C;  3A8J A;  3VA7 A;  3S16 C;  2R93 A;  1JOE A;  2PHC B;  1R9T C;  2O5I A;  3GTO C;  2NVX K;  4A3G C;  4KDD A;  3K7A K;  3HOX C;  1SFO A;  4A3C C;  2P5M A;  1TWH A;  3TFI A;  4C3I C;  2GAH C;  5M5Y K;  1O27 A;  3S1Q K;  4LK1 A;  2ZUE A;  1J98 A;  3AD7 C;  2E2I C;  4G7O A;  3GTQ C;  4A3M K;  1TWA A;  3GTL C;  4KM9 A;  3H0G C;  4KB4 A;  2FQT A;  3G4C A;  4Q4Z A;  4GZY A;  3M3Y K;  3S2D K;  4FM9 A;  5TMC A;  4WJ4 A;  4GTA A;  1UV7 A;  4GTC A;  4BXX C;  3GTJ K;  3HOW C;  2PPB A;  5C4J C;  3HOY C;  3Q3Q A;  4JK1 A;  4A3L K;  1WOS A;  5FLM K;  5IOT A;  2B63 C;  3BUE A;  4LLG A;  3GTK K; 
#chains in the Genus database with same CATH homology
 1Y1W A;  1WCM A;  1WQF A;  1GE9 A;  2B63 A;  1ISE A;  4DDQ A;  1K83 A;  2YU9 A;  2RGR A;  4KMH A;  1O24 A;  3BUE A;  3LAP A;  2GSN A;  1ZBS A;  5IOS A;  3S0X A;  5EGE A;  1ZXO A;  4GTB A;  2CFA B;  4P5B A;  2GSO A;  5TJ3 A;  4M1X A;  1XXA A;  3GTJ A;  2NVX A;  2NVY A;  1WQH A;  4LQY A;  1KQ4 A;  4BLB A;  1O2A A;  3AH5 A;  1ZVU A;  4C2M C;  3L4K A;  3GTK A;  4GTL A;  5EGH A;  1IS1 A;  1O2B A;  2R92 A;  3QX3 A;  4GFQ A;  1O26 A;  4KMA A;  1BJT A;  2E2H A;  2VUM A;  2ZFZ A;  4J3N A;  4BKW A;  4KAT A;  3N0B A;  5IOR A;  1XXC A;  2KWA A;  1TWC A;  3CQZ A;  3FOE A;  2RH6 A;  2XCR B;  3AQO A;  4G0W A;  2R7Z A;  2JA6 A;  4C3J C;  3OEP A;  1I50 A;  1I3Q A;  2JA7 A;  3GTG A;  2XCQ A;  3LAJ A;  2JA5 A;  4KB2 A;  1F9N A;  4P5A A;  3ORE A;  3OPF A;  4KAR A;  2JH3 A;  5JVO A;  4GT9 A;  3LPX A;  3N0C A;  4KMD A;  1TWF A;  3G4A A;  1TWG A;  4KC6 A;  3FOF A;  1O29 A;  3VA7 A;  1DD5 A;  2R93 A;  3NUH A;  1BGW A;  2PHC B;  1WIH A;  1Y1V A;  3GTP A;  4GTE A;  4KAW X;  1XXB A;  4KDD A;  1AB4 A;  1O25 A;  4G0U A;  4G0V A;  3FKI A;  3MML B;  1R9T A;  3GTO A;  1SFO A;  1EK8 A;  2Y3P A;  4KAS A;  2P5M A;  1TWH A;  4C3I C;  5IOQ A;  1B4A A;  1O27 A;  4C3H C;  5CHP A;  3N3Y A;  4BLA A;  4GTD A;  2XCO A;  1TWA A;  4ILD A;  3GTM A;  1WQG A;  3FHZ A;  3L4J A;  2CFA A;  4KM9 A;  4KB4 A;  2E2I A;  3G4C A;  4KM8 A;  2GSU A;  3GTQ A;  4FM9 A;  4GTF A;  3GTL A;  4GTA A;  5CJ9 A;  4GTC A;  3H0G A;  1B4B A;  1O28 A;  3AQP A;  4LR2 A;  3ERE D;  3Q3Q A;  1EH1 A;  3V4G A;  5IOT A;  5JFE A;  3CAG A;  4FZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...