5IOQA

Flavin-dependent thymidylate synthase in complex with fad and deoxyuridine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
210
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 77
structure length 210
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5ioqA00
3AH5A 4KATA 4P5BA 4KASA 4GTEA 1O24A 4P5AA 5IOSA 4GTAA 1O29A 3N3YA 5IOTA 5IOQA 5CHPA 1O27A 4GTDA 1KQ4A 1O25A 2CFAA 4KARA 4GTBA 4FZBA 4GTCA 3G4AA 5JFEA 2CFAB 1O2AA 1O28A 3N0BA 4GT9A 3G4CA 4GTLA 1O2BA 4GTFA 3N0CA 5IORA 1O26A
chains in the Genus database with same CATH superfamily
4G0VA 4G0UA 3HOYC 1J6XA 1I3QA 1ZBSA 4C2MC 5C44C 4A3CC 2NVYA 1F9NA 2R92C 4A3KC 4GTDA 2CFAA 4MEYA 4QIWD 4Q5SA 4YG2A 3CQZK 5IYDC 1WCMA 4C3IK 4A93K 3AD8C 3ADAC 3GIRA 4KN7A 1XZQB 2EBBA 1TWAK 3S15C 1PJ6A 4A3FC 5JVOA 2R7ZC 2ZUEA 1ISEA 1EK8A 2WAQL 3CQZC 1IQ0A 4A3CK 3GTPA 2BE5A 5E68A 2JA8K 3S17C 4A3IC 1PJ7A 5FLMK 3M3YK 1J6WA 1UV7A 2CW0A 3GTLC 4A3BC 3N0BA 4C3JK 1WCMK 3SZZA 1Y1WK 3L4JA 3H3VL 4LR2A 5TMFA 5EGHA 3QX3A 2XCQA 4AH6A 1WSVA 5TMCA 4Y7NC 3GTMA 1ZVUA 4OINA 3FKIK 1I3QC 1O24A 2YU9C 1VLOA 4C2MK 4AYBL 3GTPK 5IOQA 3M3YC 4QJVA 1F93A 5TJ3A 2JA6C 4FZBA 3GEEA 2PMZD 2GAGC 4KDDA 3VA7A 2V6UA 3PO3C 1IBAA 1WCMC 2R92K 1XZPA 1JVIA 5FLMC 3A8KA 4GFQA 1AB4A 2A6HA 3RZOK 4XLNA 4WILA 4C3IC 1WQFA 5C4XK 3GTPC 4MQ9A 4OIQA 3GDZA 1HQMA 4A3KK 4KMHA 1L0WA 4GTCA 2D6FC 4A3JC 4Y7NK 3GTLA 1WORA 4KMUA 1TWCC 3GTKC 1USMA 2A68A 2NVTC 4BBSK 1XXCA 1I6HK 3N0CA 1F7UA 1G51A 3MMLB 4RMFA 4LK1A 3AD7C 1Y1VA 2WB1L 2R93A 2JA8C 1O27A 1O25A 4KN4A 4YFXA 3I4NK 4X6AK 1JQWA 3GEIA 1R9TK 1I3QK 3GTGC 1EQRA 5EGEA 5C4XC 4A3EC 1XXBA 2ZFZA 4A3JK 3M4OK 3FKIC 3AQPA 3BP3A 3GSIA 3FOFA 3GTGK 4GTAA 3H0GA 3S1NK 4J3NA 4KARA 2R93K 2O5JA 4XCHA 2KWAA 4X6AC 3S1RC 3GTMC 3RZOC 2RH6A 2JA6K 2P5MA 3TFIA 5IYBC 1BDFA 2E2HA 4BY1C 4LK0A 4A3MK 1WOPA 2PPBA 1I6HC 5C3EC 3AD9C 3S14K 4BY7K 3S1RK 2V6SA 4Q4ZA 3TTGA 3CAGA 2Y0SD 3GTOC 4NOIA 2R93C 4WJ3M 5D4DA 3S0XA 4MEXA 5C3EK 4A3EK 1VH2A 1K83K 3I4NC 3S2HK 4KAWX 4A3GC 4OIPA 1ZXOA 2YU9A 3M4OC 4GT9A 1USOA 3GTGA 1B4BA 1VJEA 3S15K 4PABA 3TFJA 2WAQD 5IP9K 3S1NC 3HKZD 4GZYA 4BLAA 4Y52C 5C4JC 3S1QK 1WIHA 3FKIA 2PHCB 4ILDA 3GTOK 1B4AA 1DD5A 1X31C 3H0GC 5CHPA 3JSTA 3SZYA 2NVQK 2JA7C 3G4AA 4A3DK 3S14C 2PA8D 1SFOC 2CFAB 3H3VD 5M3MK 4YFKA 1WQHA 1R9TC 3S1QC 5M5XK 4G7OA 4ZH4A 4BY1K 4C3HK 5IP9C 1Y1WC 2FQTA 4FM9A 3OREA 1TWGC 3T02A 4C45A 1TWCA 3HOVC 4KMDA 4A3GK 4P5AA 2PMZL 2NVTK 4BBSC 4BXXK 2JA5K 1YX2A 4KB2A 1RU0A 3S2HC 5IYBK 2NVXA 3K7AC 1XZQA 2GSNA 1O2BA 4BBRK 3I4MC 1O26A 1TWGK 4G0WA 3EQLA 4A3DC 3FOEA 1K83A 3HOVK 3Q3QA 1HI9A 3GTJC 4YFNA 3OPFA 3LAPA 1DCOA 3N3YA 3T01A 2W7VA 2FQOA 3S2DK 1WOSA 1J98A 1DCHA 1VRQC 3I4MK 4Y52K 3S1MK 3LPXA 4A3LC 2JA7K 2E2IC 5C4JK 4KC6A 3HOWC 4G7HA 3GTKA 1VGXA 4KM9A 4OIOA 4LJZA 3GTKK 4P9SA 1TWHC 4C3HC 3IPJA 1TWFA 3GTMK 1TWGA 1I50C 3HOXK 2E2IK 4GTEA 2XCOA 2NVYC 3S16C 3BUEA 3H0GK 3PO2K 5FJ8K 1DCPA 5JFEA 3ERED 4LQYA 1XXAA 5IYCK 4BKWA 2JH3A 2B63C 4QIWL 1XZPB 3GTOA 3K7AK 1BS2A 5M5WK 5M5YK 4GTFA 2R7ZK 2R7ZA 4LLGA 1BJTA 1IE0A 1V5VA 5IP7K 3S2DC 2JA5A 2A6EA 4XLPA 4AYBD 2JA7A 4KATA 3FHZA 4WJ4A 1K83C 1I6VA 5M3FK 3S17K 3TFHA 3NUHA 4QJVB 3HOWK 5IOSA 2B63K 4BBRC 3RZDK 1KQ4A 5IYCC 2P8TA 1O2AA 3GTJK 3HOZC 2E2HC 2A69A 4GTLA 3WODA 1PJ5A 2R92A 3RZDC 1F7VA 3OEPA 4KB4A 2V6TA 4A3LK 3S1MC 4BY7C 2NVQC 1SFOA 1YNNA 4P5BA 1SFOK 1R9TA 2O5IA 2NVXC 2E2HK 5IOTA 1TWAA 3V4GA 1EI6A 1Y1WA 4DDQA 3AQOA 4KM8A 3GEHA 2VUMA 3HOXC 3GTQC 2E2JK 3PO3K 4PAAA 1EH1A 2B63A 4OIRA 4XSXA 2GAHC 3T00A 3BP8C 2ZUFA 1TWFK 2VUMK 2RGRA 5IP7C 2WB1D 2JA5C 4G7ZA 2E2JC 2NVXK 1I50K 4M1XA 3LAJA 5L46A 1YNJA 1ZQ1C 2NVYK 2PA8L 4KMAA 3GTQK 3PO2C 5IYDK 1JOEA 1I50A 1BGWA 1TWCK 1WSRA 1SMYA 3HOZK 3HOUC 1Y1VK 5C44K 1O2FB 4A3FK 1XPPA 4XSZA 1ZYRA 2GSUA 3A8IA 2XCRB 2JA6A 2E2IA 4O2DA 1IL2A 4A3IK 1WQGA 4GTBA 3GTLK 4BXXC 1GE9A 2VUMC 3GTQA 3HOYK 4A93C 1O28A 2Y3PA 4JK1A 1IW7A 3DXJA 2GSOA 3S16K 3L4KA 2Y0SL 1INNA 3AH5A 4KASA 3CQZA 2YU9K 3GTJA 3A8JA 1J6VA 1C0AA 1O29A 4LOWA 5HL8A 1YCLA 4A3BK 3HXAA 5CJ9A 4C3JC 1IS1A 3HKZL 1EFWA 4A3MC 3G4CA 3HOUK 1TWHA 1Y1VC 1TWAC 1WOOA 1TWHK 4BLBA 5IORA 1TWFC
chains in the Genus database with same CATH topology
3OREA 4G0VA 1SFOA 4P5BA 4G0UA 3MMLB 1R9TA 1I3QA 1ZBSA 1TWCA 4C2MC 2NVYA 4KMDA 4P5AA 1F9NA 1Y1VA 2R93A 5IOTA 1TWAA 3V4GA 1O27A 4GTDA 1O25A 2CFAA 3AQOA 4DDQA 1Y1WA 4KM8A 2VUMA 4KB2A 1WCMA 2NVXA 1EH1A 2B63A 5EGEA 2GSNA 1O2BA 5JVOA 1O26A 2RGRA 1XXBA 4G0WA 1ISEA 1EK8A 2ZFZA 3FOEA 1K83A 3AQPA 3Q3QA 4M1XA 3LAJA 3GTPA 3OPFA 3LAPA 3FOFA 4GTAA 3H0GA 3N3YA 4J3NA 4KARA 4KMAA 2KWAA 2RH6A 2P5MA 3LPXA 1I50A 4KC6A 1BGWA 3N0BA 3GTKA 2E2HA 4KM9A 3L4JA 4LR2A 4C3HC 5EGHA 3QX3A 2XCQA 2GSUA 3GTMA 2XCRB 2JA6A 1TWFA 1ZVUA 2E2IA 1TWGA 4GTEA 3CAGA 1O24A 2XCOA 3BUEA 5IOQA 1WQGA 5TJ3A 4GTBA 3S0XA 4FZBA 1GE9A 5JFEA 3ERED 4LQYA 3GTQA 1XXAA 4KDDA 4KAWX 3VA7A 4BKWA 1O28A 2JH3A 2Y3PA 1ZXOA 2YU9A 4GT9A 3GTGA 2GSOA 1B4BA 3GTOA 4GTFA 3L4KA 4GFQA 1BJTA 2R7ZA 1AB4A 2JA5A 2JA7A 3AH5A 4BLAA 4KATA 4KASA 3CQZA 3FHZA 4C3IC 3GTJA 1WIHA 3FKIA 2PHCB 4ILDA 1WQFA 3NUHA 5IOSA 1B4AA 1DD5A 1O29A 5CHPA 1KQ4A 4KMHA 4GTCA 3G4AA 3GTLA 2CFAB 1O2AA 5CJ9A 4C3JC 1IS1A 1WQHA 3G4CA 4GTLA 1TWHA 2R92A 1XXCA 4BLBA 3N0CA 3OEPA 5IORA 4KB4A 4FM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH5 A;  4KAT A;  4P5B A;  4KAS A;  4GTE A;  1O24 A;  4P5A A;  5IOS A;  4GTA A;  1O29 A;  3N3Y A;  5IOT A;  5IOQ A;  5CHP A;  1O27 A;  4GTD A;  1KQ4 A;  1O25 A;  2CFA A;  4KAR A;  4GTB A;  4FZB A;  4GTC A;  3G4A A;  5JFE A;  2CFA B;  1O2A A;  1O28 A;  3N0B A;  4GT9 A;  3G4C A;  4GTL A;  1O2B A;  4GTF A;  3N0C A;  5IOR A;  1O26 A; 
#chains in the Genus database with same CATH topology
 4G0V A;  4G0U A;  3HOY C;  1J6X A;  1I3Q A;  1ZBS A;  4C2M C;  5C44 C;  4A3C C;  2NVY A;  1F9N A;  2R92 C;  4A3K C;  4GTD A;  2CFA A;  4MEY A;  4QIW D;  4Q5S A;  4YG2 A;  3CQZ K;  5IYD C;  1WCM A;  4C3I K;  4A93 K;  3AD8 C;  3ADA C;  3GIR A;  4KN7 A;  1XZQ B;  2EBB A;  1TWA K;  3S15 C;  1PJ6 A;  4A3F C;  5JVO A;  2R7Z C;  2ZUE A;  1ISE A;  1EK8 A;  2WAQ L;  3CQZ C;  1IQ0 A;  4A3C K;  3GTP A;  2BE5 A;  5E68 A;  2JA8 K;  3S17 C;  4A3I C;  1PJ7 A;  5FLM K;  3M3Y K;  1J6W A;  1UV7 A;  2CW0 A;  3GTL C;  4A3B C;  3N0B A;  4C3J K;  1WCM K;  3SZZ A;  1Y1W K;  3L4J A;  3H3V L;  4LR2 A;  5TMF A;  5EGH A;  3QX3 A;  2XCQ A;  4AH6 A;  1WSV A;  5TMC A;  4Y7N C;  3GTM A;  1ZVU A;  4OIN A;  3FKI K;  1I3Q C;  1O24 A;  2YU9 C;  1VLO A;  4C2M K;  4AYB L;  3GTP K;  5IOQ A;  3M3Y C;  4QJV A;  1F93 A;  5TJ3 A;  2JA6 C;  4FZB A;  3GEE A;  2PMZ D;  2GAG C;  4KDD A;  3VA7 A;  2V6U A;  3PO3 C;  1IBA A;  1WCM C;  2R92 K;  1XZP A;  1JVI A;  5FLM C;  3A8K A;  4GFQ A;  1AB4 A;  2A6H A;  3RZO K;  4XLN A;  4WIL A;  4C3I C;  1WQF A;  5C4X K;  3GTP C;  4MQ9 A;  4OIQ A;  3GDZ A;  1HQM A;  4A3K K;  4KMH A;  1L0W A;  4GTC A;  2D6F C;  4A3J C;  4Y7N K;  3GTL A;  1WOR A;  4KMU A;  1TWC C;  3GTK C;  1USM A;  2A68 A;  2NVT C;  4BBS K;  1XXC A;  1I6H K;  3N0C A;  1F7U A;  1G51 A;  3MML B;  4RMF A;  4LK1 A;  3AD7 C;  1Y1V A;  2WB1 L;  2R93 A;  2JA8 C;  1O27 A;  1O25 A;  4KN4 A;  4YFX A;  3I4N K;  4X6A K;  1JQW A;  3GEI A;  1R9T K;  1I3Q K;  3GTG C;  1EQR A;  5EGE A;  5C4X C;  4A3E C;  1XXB A;  2ZFZ A;  4A3J K;  3M4O K;  3FKI C;  3AQP A;  3BP3 A;  3GSI A;  3FOF A;  3GTG K;  4GTA A;  3H0G A;  3S1N K;  4J3N A;  4KAR A;  2R93 K;  2O5J A;  4XCH A;  2KWA A;  4X6A C;  3S1R C;  3GTM C;  3RZO C;  2RH6 A;  2JA6 K;  2P5M A;  3TFI A;  5IYB C;  1BDF A;  2E2H A;  4BY1 C;  4LK0 A;  4A3M K;  1WOP A;  2PPB A;  1I6H C;  5C3E C;  3AD9 C;  3S14 K;  4BY7 K;  3S1R K;  2V6S A;  4Q4Z A;  3TTG A;  3CAG A;  2Y0S D;  3GTO C;  4NOI A;  2R93 C;  4WJ3 M;  5D4D A;  3S0X A;  4MEX A;  5C3E K;  4A3E K;  1VH2 A;  1K83 K;  3I4N C;  3S2H K;  4KAW X;  4A3G C;  4OIP A;  1ZXO A;  2YU9 A;  3M4O C;  4GT9 A;  1USO A;  3GTG A;  1B4B A;  1VJE A;  3S15 K;  4PAB A;  3TFJ A;  2WAQ D;  5IP9 K;  3S1N C;  3HKZ D;  4GZY A;  4BLA A;  4Y52 C;  5C4J C;  3S1Q K;  1WIH A;  3FKI A;  2PHC B;  4ILD A;  3GTO K;  1B4A A;  1DD5 A;  1X31 C;  3H0G C;  5CHP A;  3JST A;  3SZY A;  2NVQ K;  2JA7 C;  3G4A A;  4A3D K;  3S14 C;  2PA8 D;  1SFO C;  2CFA B;  3H3V D;  5M3M K;  4YFK A;  1WQH A;  1R9T C;  3S1Q C;  5M5X K;  4G7O A;  4ZH4 A;  4BY1 K;  4C3H K;  5IP9 C;  1Y1W C;  2FQT A;  4FM9 A;  3ORE A;  1TWG C;  3T02 A;  4C45 A;  1TWC A;  3HOV C;  4KMD A;  4A3G K;  4P5A A;  2PMZ L;  2NVT K;  4BBS C;  4BXX K;  2JA5 K;  1YX2 A;  4KB2 A;  1RU0 A;  3S2H C;  5IYB K;  2NVX A;  3K7A C;  1XZQ A;  2GSN A;  1O2B A;  4BBR K;  3I4M C;  1O26 A;  1TWG K;  4G0W A;  3EQL A;  4A3D C;  3FOE A;  1K83 A;  3HOV K;  3Q3Q A;  1HI9 A;  3GTJ C;  4YFN A;  3OPF A;  3LAP A;  1DCO A;  3N3Y A;  3T01 A;  2W7V A;  2FQO A;  3S2D K;  1WOS A;  1J98 A;  1DCH A;  1VRQ C;  3I4M K;  4Y52 K;  3S1M K;  3LPX A;  4A3L C;  2JA7 K;  2E2I C;  5C4J K;  4KC6 A;  3HOW C;  4G7H A;  3GTK A;  1VGX A;  4KM9 A;  4OIO A;  4LJZ A;  3GTK K;  4P9S A;  1TWH C;  4C3H C;  3IPJ A;  1TWF A;  3GTM K;  1TWG A;  1I50 C;  3HOX K;  2E2I K;  4GTE A;  2XCO A;  2NVY C;  3S16 C;  3BUE A;  3H0G K;  3PO2 K;  5FJ8 K;  1DCP A;  5JFE A;  3ERE D;  4LQY A;  1XXA A;  5IYC K;  4BKW A;  2JH3 A;  2B63 C;  4QIW L;  1XZP B;  3GTO A;  3K7A K;  1BS2 A;  5M5W K;  5M5Y K;  4GTF A;  2R7Z K;  2R7Z A;  4LLG A;  1BJT A;  1IE0 A;  1V5V A;  5IP7 K;  3S2D C;  2JA5 A;  2A6E A;  4XLP A;  4AYB D;  2JA7 A;  4KAT A;  3FHZ A;  4WJ4 A;  1K83 C;  1I6V A;  5M3F K;  3S17 K;  3TFH A;  3NUH A;  4QJV B;  3HOW K;  5IOS A;  2B63 K;  4BBR C;  3RZD K;  1KQ4 A;  5IYC C;  2P8T A;  1O2A A;  3GTJ K;  3HOZ C;  2E2H C;  2A69 A;  4GTL A;  3WOD A;  1PJ5 A;  2R92 A;  3RZD C;  1F7V A;  3OEP A;  4KB4 A;  2V6T A;  4A3L K;  3S1M C;  4BY7 C;  2NVQ C;  1SFO A;  1YNN A;  4P5B A;  1SFO K;  1R9T A;  2O5I A;  2NVX C;  2E2H K;  5IOT A;  1TWA A;  3V4G A;  1EI6 A;  1Y1W A;  4DDQ A;  3AQO A;  4KM8 A;  3GEH A;  2VUM A;  3HOX C;  3GTQ C;  2E2J K;  3PO3 K;  4PAA A;  1EH1 A;  2B63 A;  4OIR A;  4XSX A;  2GAH C;  3T00 A;  3BP8 C;  2ZUF A;  1TWF K;  2VUM K;  2RGR A;  5IP7 C;  2WB1 D;  2JA5 C;  4G7Z A;  2E2J C;  2NVX K;  1I50 K;  4M1X A;  3LAJ A;  5L46 A;  1YNJ A;  1ZQ1 C;  2NVY K;  2PA8 L;  4KMA A;  3GTQ K;  3PO2 C;  5IYD K;  1JOE A;  1I50 A;  1BGW A;  1TWC K;  1WSR A;  1SMY A;  3HOZ K;  3HOU C;  1Y1V K;  5C44 K;  1O2F B;  4A3F K;  1XPP A;  4XSZ A;  1ZYR A;  2GSU A;  3A8I A;  2XCR B;  2JA6 A;  2E2I A;  4O2D A;  1IL2 A;  4A3I K;  1WQG A;  4GTB A;  3GTL K;  4BXX C;  1GE9 A;  2VUM C;  3GTQ A;  3HOY K;  4A93 C;  1O28 A;  2Y3P A;  4JK1 A;  1IW7 A;  3DXJ A;  2GSO A;  3S16 K;  3L4K A;  2Y0S L;  1INN A;  3AH5 A;  4KAS A;  3CQZ A;  2YU9 K;  3GTJ A;  3A8J A;  1J6V A;  1C0A A;  1O29 A;  4LOW A;  5HL8 A;  1YCL A;  4A3B K;  3HXA A;  5CJ9 A;  4C3J C;  1IS1 A;  3HKZ L;  1EFW A;  4A3M C;  3G4C A;  3HOU K;  1TWH A;  1Y1V C;  1TWA C;  1WOO A;  1TWH K;  4BLB A;  5IOR A;  1TWF C; 
#chains in the Genus database with same CATH homology
 3ORE A;  4G0V A;  1SFO A;  4P5B A;  4G0U A;  3MML B;  1R9T A;  1I3Q A;  1ZBS A;  1TWC A;  4C2M C;  2NVY A;  4KMD A;  4P5A A;  1F9N A;  1Y1V A;  2R93 A;  5IOT A;  1TWA A;  3V4G A;  1O27 A;  4GTD A;  1O25 A;  2CFA A;  3AQO A;  4DDQ A;  1Y1W A;  4KM8 A;  2VUM A;  4KB2 A;  1WCM A;  2NVX A;  1EH1 A;  2B63 A;  5EGE A;  2GSN A;  1O2B A;  5JVO A;  1O26 A;  2RGR A;  1XXB A;  4G0W A;  1ISE A;  1EK8 A;  2ZFZ A;  3FOE A;  1K83 A;  3AQP A;  3Q3Q A;  4M1X A;  3LAJ A;  3GTP A;  3OPF A;  3LAP A;  3FOF A;  4GTA A;  3H0G A;  3N3Y A;  4J3N A;  4KAR A;  4KMA A;  2KWA A;  2RH6 A;  2P5M A;  3LPX A;  1I50 A;  4KC6 A;  1BGW A;  3N0B A;  3GTK A;  2E2H A;  4KM9 A;  3L4J A;  4LR2 A;  4C3H C;  5EGH A;  3QX3 A;  2XCQ A;  2GSU A;  3GTM A;  2XCR B;  2JA6 A;  1TWF A;  1ZVU A;  2E2I A;  1TWG A;  4GTE A;  3CAG A;  1O24 A;  2XCO A;  3BUE A;  5IOQ A;  1WQG A;  5TJ3 A;  4GTB A;  3S0X A;  4FZB A;  1GE9 A;  5JFE A;  3ERE D;  4LQY A;  3GTQ A;  1XXA A;  4KDD A;  4KAW X;  3VA7 A;  4BKW A;  1O28 A;  2JH3 A;  2Y3P A;  1ZXO A;  2YU9 A;  4GT9 A;  3GTG A;  2GSO A;  1B4B A;  3GTO A;  4GTF A;  3L4K A;  4GFQ A;  1BJT A;  2R7Z A;  1AB4 A;  2JA5 A;  2JA7 A;  3AH5 A;  4BLA A;  4KAT A;  4KAS A;  3CQZ A;  3FHZ A;  4C3I C;  3GTJ A;  1WIH A;  3FKI A;  2PHC B;  4ILD A;  1WQF A;  3NUH A;  5IOS A;  1B4A A;  1DD5 A;  1O29 A;  5CHP A;  1KQ4 A;  4KMH A;  4GTC A;  3G4A A;  3GTL A;  2CFA B;  1O2A A;  5CJ9 A;  4C3J C;  1IS1 A;  1WQH A;  3G4C A;  4GTL A;  1TWH A;  2R92 A;  1XXC A;  4BLB A;  3N0C A;  3OEP A;  5IOR A;  4KB4 A;  4FM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...