5IOQA

Flavin-dependent thymidylate synthase in complex with fad and deoxyuridine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
210
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 77
structure length 210
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5ioqA00
1O2AA 1O29A 3AH5A 4GTFA 3N0CA 1O26A 4KASA 5JFEA 4FZBA 4GTEA 2CFAA 4GTAA 1O28A 4P5AA 4KATA 4P5BA 1O24A 4GTCA 1KQ4A 5IOSA 1O2BA 5IOQA 5IORA 3G4AA 4GTBA 5CHPA 3N3YA 4KARA 5IOTA 4GTDA 4GTLA 3N0BA 1O27A 1O25A 4GT9A 2CFAB 3G4CA
chains in the Genus database with same CATH superfamily
4LR2A 3TFJA 1X31C 3SZYA 3GTJA 2VUMA 3S2DK 4GTEA 5E68A 4BY7C 4KC6A 3GSIA 1O2FB 3HOYK 3BP3A 3LAJA 2GSOA 4QIWL 2E2HK 2YU9K 5IP9K 1TWFK 2JA6K 3RZDK 1XPPA 4C2MC 1XZPA 3K7AK 1Y1WK 2A69A 3AD8C 3HKZL 3HOZC 4X6AK 1F7VA 1VH2A 2B63K 2E2IA 1WCMK 1I3QK 4OIPA 4A3MK 3GTGK 2NVXC 3WODA 3T00A 3CAGA 4AYBD 2D6FC 1XXCA 5IP7C 2JA7K 4KATA 1WQHA 3HOUC 2Y3PA 5IYDC 2GSNA 1VRQC 1HQMA 4KMDA 1YNJA 4KARA 1WOSA 1I3QA 3GTKC 3GTGA 4GTDA 1Y1WA 4WJ4A 4A3BK 1WOPA 1PJ6A 2CFAB 1Y1VC 3GDZA 4PABA 3HOWK 3A8JA 3GTOK 4Y7NK 1XXAA 1JQWA 4QIWD 3L4KA 4A3IC 1I50C 4A93C 3H0GC 2PMZD 1O24A 3TFIA 1DD5A 5IOSA 3H0GA 3L4JA 1VLOA 4BKWA 4A3JK 1ISEA 3S16K 1TWHA 5M3MK 4A3JC 4GZYA 1J98A 2WB1L 2RGRA 3H0GK 4GTLA 5M3FK 1YCLA 2JA8K 4GT9A 3T01A 3BUEA 2PA8D 1PJ5A 1SFOK 2E2JK 4A3IK 4FZBA 2CFAA 1BDFA 4XSXA 5C3EC 4OINA 2Y0SL 3GTKK 2PHCB 4KM9A 2R7ZC 2JA8C 5EGHA 5CHPA 1ZQ1C 4P9SA 4AYBL 5IYCK 4YFKA 2FQTA 4KAWX 3Q3QA 2JA7C 2WAQL 3HOZK 4X6AC 1XZQB 1UV7A 3OEPA 4A3MC 1IBAA 1EH1A 1TWHK 1R9TK 1ZXOA 1WQGA 4A3EK 1XZPB 3GTOC 1JOEA 3HOWC 4LJZA 2JA6C 1TWGA 1TWGC 3T02A 5C4JK 4C45A 4GTCA 2A6HA 3RZDC 5IOQA 1EFWA 2XCRB 3G4AA 3A8KA 4LQYA 5FJ8K 5FLMC 3GTKA 1RU0A 2R93A 3PO3C 1XXBA 4BY7K 3LAPA 1DCPA 3GTLK 5M5WK 1GE9A 3AQOA 2GAGC 3HXAA 3GEEA 4A3DK 2XCQA 2E2IC 3AQPA 1WCMC 4G0WA 1EK8A 4P5AA 1WOOA 1C0AA 3HOVK 3M4OC 4FM9A 4KMAA 1HI9A 5IOTA 3GTQC 1I50A 2A68A 1ZYRA 2GAHC 1AB4A 3RZOK 4C3JC 1TWHC 3AH5A 3DXJA 3GTPK 4G7ZA 1O26A 3OPFA 3GTMK 4BXXK 1TWCK 4C3HC 1WSRA 1BS2A 1USMA 3GTLC 1VGXA 3PO2C 1WORA 1TWAC 1IE0A 3PO3K 3FKIC 4GTBA 3GTMA 5C4XK 2JA5K 4C3IC 1F93A 2R92A 5C3EK 4J3NA 1ZBSA 4KB2A 2JH3A 1O2AA 3S15K 2NVTC 1R9TC 3S1NC 3S14K 2WB1D 4LK0A 4ZH4A 2EBBA 4O2DA 2R93C 4BBRC 4A3FK 3S17K 5IYCC 4G7OA 5IORA 3H3VD 4Q5SA 3HKZD 2B63A 3GTJK 2VUMK 1SMYA 3I4NC 3FKIA 3AD7C 4LOWA 2R92K 5IYBC 2ZFZA 1O28A 4XCHA 5IYBK 3CQZC 2ZUFA 4A3LK 4BY1K 5C4XC 2JA6A 1YNNA 2R7ZA 1USOA 2O5JA 3ADAC 3PO2K 3GTQA 4KDDA 4A3FC 2W7VA 4A3KC 3S17C 4BXXC 3TFHA 3HOXC 4GTAA 4C2MK 3M3YC 3S1NK 2NVTK 1Y1VK 1TWFC 1F9NA 3BP8C 2JA5C 4YFNA 4BBSK 4MQ9A 1J6WA 2O5IA 3S1QK 3IPJA 2PPBA 4C3IK 1TWAK 3HOVC 3MMLB 1K83K 4KMHA 2XCOA 4BLAA 5M5XK 3S1MK 5L46A 1I6HK 3H3VL 3GTMC 1L0WA 2NVQK 1TWAA 1B4BA 3JSTA 3RZOC 4QJVA 2P8TA 1Y1WC 3GTPC 5M5YK 3GEIA 2JA7A 4XSZA 5FLMK 4G7HA 2NVYK 2NVYC 4GFQA 3FOFA 1SFOA 1ZVUA 1O25A 2NVXA 4QJVB 4DDQA 1K83A 1F7UA 4NOIA 4GTFA 4MEYA 4OIQA 4YFXA 4A3DC 2BE5A 4XLPA 1K83C 5HL8A 2RH6A 2GSUA 1O2BA 1WQFA 2R7ZK 4WILA 4LK1A 3GTOA 5TMFA 4Q4ZA 5JVOA 2NVYA 3SZZA 4RMFA 4Y52C 3M3YK 4A3EC 2FQOA 3G4CA 2V6SA 5C44C 1J6XA 3GIRA 3HOXK 3FHZA 3I4MC 1TWGK 5C4JC 3OREA 3AD9C 2E2JC 1WCMA 1XZQA 2NVQC 2KWAA 2P5MA 1Y1VA 4KN4A 4JK1A 3S1RC 1I6HC 4A3KK 1I6VA 4A3CK 1EI6A 3S1MC 4G0UA 2WAQD 2ZUEA 1IS1A 3ERED 3S2HK 5D4DA 1IL2A 4KMUA 4KB4A 4M1XA 3QX3A 3S1QC 3GTPA 4A3LC 4A93K 4BBSC 2V6UA 4A3GK 4YG2A 1JVIA 3S0XA 1IQ0A 3N0CA 1DCHA 1INNA 5JFEA 4WJ3M 1SFOC 4MEXA 3NUHA 4LLGA 4ILDA 2R92C 3EQLA 3GTJC 2VUMC 4PAAA 3S16C 3A8IA 1DCOA 2JA5A 3HOUK 3VA7A 4AH6A 4OIOA 3S1RK 1VJEA 2NVXK 1J6VA 4BY1C 4BBRK 1EQRA 2Y0SD 2R93K 5EGEA 2B63C 3CQZK 4XLNA 3LPXA 1O29A 3S15C 4Y7NC 4BLBA 1V5VA 4KASA 1I50K 3K7AC 3I4MK 5C44K 3FOEA 4KN7A 1WIHA 1IW7A 5IP9C 1WSVA 2V6TA 5CJ9A 5TMCA 3TTGA 4P5BA 4A3GC 1KQ4A 4A3BC 1R9TA 3FKIK 3N3YA 1G51A 3GEHA 3I4NK 1B4AA 1PJ7A 4G0VA 1YX2A 3CQZA 1BGWA 3S2HC 4A3CC 1TWCC 5IP7K 5IYDK 3S2DC 4C3HK 1O27A 1I3QC 3GTGC 3GTLA 3S14C 2CW0A 3V4GA 4C3JK 2PMZL 1TWCA 3GTQK 4Y52K 2E2HC 2YU9C 1BJTA 4OIRA 3M4OK 2YU9A 2E2HA 3N0BA 4KM8A 2A6EA 3HOYC 5TJ3A 2PA8L 2E2IK 1TWFA
chains in the Genus database with same CATH topology
4LR2A 3OREA 2ZFZA 3OEPA 3GTJA 2VUMA 1EH1A 1ZXOA 1WCMA 4GTEA 1WQGA 1O28A 2KWAA 2P5MA 1TWGA 1Y1VA 4GTCA 4KC6A 4G0UA 2JA6A 5IOQA 1IS1A 2XCRB 3G4AA 3ERED 2R7ZA 4LQYA 3LAJA 2GSOA 3GTQA 3GTKA 4KB4A 4M1XA 2R93A 4KDDA 3QX3A 1XXBA 3GTPA 3LAPA 4C2MC 1GE9A 3AQOA 3S0XA 3N0CA 2XCQA 5JFEA 2E2IA 3AQPA 3NUHA 4G0WA 3CAGA 4GTAA 1XXCA 1EK8A 4ILDA 4P5AA 4KATA 1WQHA 1F9NA 2Y3PA 2GSNA 4FM9A 4KMAA 4KMDA 4KARA 5IOTA 1I3QA 3GTGA 4GTDA 1I50A 2JA5A 1Y1WA 3MMLB 3VA7A 4KMHA 1AB4A 2XCOA 4BLAA 4C3JC 5EGEA 2CFAB 3LPXA 3AH5A 1O29A 4BLBA 1O26A 4KASA 1XXAA 3OPFA 1TWAA 3L4KA 1B4BA 3FOEA 1WIHA 4C3HC 5CJ9A 4P5BA 2JA7A 1O24A 1DD5A 1KQ4A 1R9TA 5IOSA 3H0GA 3L4JA 4GTBA 3N3YA 4BKWA 3GTMA 1ISEA 1TWHA 4GFQA 3FOFA 4C3IC 1B4AA 2R92A 1SFOA 4G0VA 2RGRA 3CQZA 1BGWA 4GTLA 4J3NA 1ZBSA 1TWFA 1O25A 1ZVUA 4GT9A 2NVXA 3BUEA 4KB2A 4DDQA 1K83A 1O27A 2JH3A 1O2AA 4GTFA 4FZBA 3GTLA 2CFAA 3V4GA 2RH6A 1TWCA 2GSUA 1O2BA 1BJTA 2PHCB 4KM9A 5IORA 1WQFA 5EGHA 5CHPA 2B63A 3GTOA 2YU9A 2E2HA 5JVOA 2NVYA 3FKIA 3N0BA 4KM8A 5TJ3A 4KAWX 3Q3QA 3G4CA 3FHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2A A;  1O29 A;  3AH5 A;  4GTF A;  3N0C A;  1O26 A;  4KAS A;  5JFE A;  4FZB A;  4GTE A;  2CFA A;  4GTA A;  1O28 A;  4P5A A;  4KAT A;  4P5B A;  1O24 A;  4GTC A;  1KQ4 A;  5IOS A;  1O2B A;  5IOQ A;  5IOR A;  3G4A A;  4GTB A;  5CHP A;  3N3Y A;  4KAR A;  5IOT A;  4GTD A;  4GTL A;  3N0B A;  1O27 A;  1O25 A;  4GT9 A;  2CFA B;  3G4C A; 
#chains in the Genus database with same CATH topology
 4LR2 A;  3TFJ A;  1X31 C;  3SZY A;  3GTJ A;  2VUM A;  3S2D K;  4GTE A;  5E68 A;  4BY7 C;  4KC6 A;  3GSI A;  1O2F B;  3HOY K;  3BP3 A;  3LAJ A;  2GSO A;  4QIW L;  2E2H K;  2YU9 K;  5IP9 K;  1TWF K;  2JA6 K;  3RZD K;  1XPP A;  4C2M C;  1XZP A;  3K7A K;  1Y1W K;  2A69 A;  3AD8 C;  3HKZ L;  3HOZ C;  4X6A K;  1F7V A;  1VH2 A;  2B63 K;  2E2I A;  1WCM K;  1I3Q K;  4OIP A;  4A3M K;  3GTG K;  2NVX C;  3WOD A;  3T00 A;  3CAG A;  4AYB D;  2D6F C;  1XXC A;  5IP7 C;  2JA7 K;  4KAT A;  1WQH A;  3HOU C;  2Y3P A;  5IYD C;  2GSN A;  1VRQ C;  1HQM A;  4KMD A;  1YNJ A;  4KAR A;  1WOS A;  1I3Q A;  3GTK C;  3GTG A;  4GTD A;  1Y1W A;  4WJ4 A;  4A3B K;  1WOP A;  1PJ6 A;  2CFA B;  1Y1V C;  3GDZ A;  4PAB A;  3HOW K;  3A8J A;  3GTO K;  4Y7N K;  1XXA A;  1JQW A;  4QIW D;  3L4K A;  4A3I C;  1I50 C;  4A93 C;  3H0G C;  2PMZ D;  1O24 A;  3TFI A;  1DD5 A;  5IOS A;  3H0G A;  3L4J A;  1VLO A;  4BKW A;  4A3J K;  1ISE A;  3S16 K;  1TWH A;  5M3M K;  4A3J C;  4GZY A;  1J98 A;  2WB1 L;  2RGR A;  3H0G K;  4GTL A;  5M3F K;  1YCL A;  2JA8 K;  4GT9 A;  3T01 A;  3BUE A;  2PA8 D;  1PJ5 A;  1SFO K;  2E2J K;  4A3I K;  4FZB A;  2CFA A;  1BDF A;  4XSX A;  5C3E C;  4OIN A;  2Y0S L;  3GTK K;  2PHC B;  4KM9 A;  2R7Z C;  2JA8 C;  5EGH A;  5CHP A;  1ZQ1 C;  4P9S A;  4AYB L;  5IYC K;  4YFK A;  2FQT A;  4KAW X;  3Q3Q A;  2JA7 C;  2WAQ L;  3HOZ K;  4X6A C;  1XZQ B;  1UV7 A;  3OEP A;  4A3M C;  1IBA A;  1EH1 A;  1TWH K;  1R9T K;  1ZXO A;  1WQG A;  4A3E K;  1XZP B;  3GTO C;  1JOE A;  3HOW C;  4LJZ A;  2JA6 C;  1TWG A;  1TWG C;  3T02 A;  5C4J K;  4C45 A;  4GTC A;  2A6H A;  3RZD C;  5IOQ A;  1EFW A;  2XCR B;  3G4A A;  3A8K A;  4LQY A;  5FJ8 K;  5FLM C;  3GTK A;  1RU0 A;  2R93 A;  3PO3 C;  1XXB A;  4BY7 K;  3LAP A;  1DCP A;  3GTL K;  5M5W K;  1GE9 A;  3AQO A;  2GAG C;  3HXA A;  3GEE A;  4A3D K;  2XCQ A;  2E2I C;  3AQP A;  1WCM C;  4G0W A;  1EK8 A;  4P5A A;  1WOO A;  1C0A A;  3HOV K;  3M4O C;  4FM9 A;  4KMA A;  1HI9 A;  5IOT A;  3GTQ C;  1I50 A;  2A68 A;  1ZYR A;  2GAH C;  1AB4 A;  3RZO K;  4C3J C;  1TWH C;  3AH5 A;  3DXJ A;  3GTP K;  4G7Z A;  1O26 A;  3OPF A;  3GTM K;  4BXX K;  1TWC K;  4C3H C;  1WSR A;  1BS2 A;  1USM A;  3GTL C;  1VGX A;  3PO2 C;  1WOR A;  1TWA C;  1IE0 A;  3PO3 K;  3FKI C;  4GTB A;  3GTM A;  5C4X K;  2JA5 K;  4C3I C;  1F93 A;  2R92 A;  5C3E K;  4J3N A;  1ZBS A;  4KB2 A;  2JH3 A;  1O2A A;  3S15 K;  2NVT C;  1R9T C;  3S1N C;  3S14 K;  2WB1 D;  4LK0 A;  4ZH4 A;  2EBB A;  4O2D A;  2R93 C;  4BBR C;  4A3F K;  3S17 K;  5IYC C;  4G7O A;  5IOR A;  3H3V D;  4Q5S A;  3HKZ D;  2B63 A;  3GTJ K;  2VUM K;  1SMY A;  3I4N C;  3FKI A;  3AD7 C;  4LOW A;  2R92 K;  5IYB C;  2ZFZ A;  1O28 A;  4XCH A;  5IYB K;  3CQZ C;  2ZUF A;  4A3L K;  4BY1 K;  5C4X C;  2JA6 A;  1YNN A;  2R7Z A;  1USO A;  2O5J A;  3ADA C;  3PO2 K;  3GTQ A;  4KDD A;  4A3F C;  2W7V A;  4A3K C;  3S17 C;  4BXX C;  3TFH A;  3HOX C;  4GTA A;  4C2M K;  3M3Y C;  3S1N K;  2NVT K;  1Y1V K;  1TWF C;  1F9N A;  3BP8 C;  2JA5 C;  4YFN A;  4BBS K;  4MQ9 A;  1J6W A;  2O5I A;  3S1Q K;  3IPJ A;  2PPB A;  4C3I K;  1TWA K;  3HOV C;  3MML B;  1K83 K;  4KMH A;  2XCO A;  4BLA A;  5M5X K;  3S1M K;  5L46 A;  1I6H K;  3H3V L;  3GTM C;  1L0W A;  2NVQ K;  1TWA A;  1B4B A;  3JST A;  3RZO C;  4QJV A;  2P8T A;  1Y1W C;  3GTP C;  5M5Y K;  3GEI A;  2JA7 A;  4XSZ A;  5FLM K;  4G7H A;  2NVY K;  2NVY C;  4GFQ A;  3FOF A;  1SFO A;  1ZVU A;  1O25 A;  2NVX A;  4QJV B;  4DDQ A;  1K83 A;  1F7U A;  4NOI A;  4GTF A;  4MEY A;  4OIQ A;  4YFX A;  4A3D C;  2BE5 A;  4XLP A;  1K83 C;  5HL8 A;  2RH6 A;  2GSU A;  1O2B A;  1WQF A;  2R7Z K;  4WIL A;  4LK1 A;  3GTO A;  5TMF A;  4Q4Z A;  5JVO A;  2NVY A;  3SZZ A;  4RMF A;  4Y52 C;  3M3Y K;  4A3E C;  2FQO A;  3G4C A;  2V6S A;  5C44 C;  1J6X A;  3GIR A;  3HOX K;  3FHZ A;  3I4M C;  1TWG K;  5C4J C;  3ORE A;  3AD9 C;  2E2J C;  1WCM A;  1XZQ A;  2NVQ C;  2KWA A;  2P5M A;  1Y1V A;  4KN4 A;  4JK1 A;  3S1R C;  1I6H C;  4A3K K;  1I6V A;  4A3C K;  1EI6 A;  3S1M C;  4G0U A;  2WAQ D;  2ZUE A;  1IS1 A;  3ERE D;  3S2H K;  5D4D A;  1IL2 A;  4KMU A;  4KB4 A;  4M1X A;  3QX3 A;  3S1Q C;  3GTP A;  4A3L C;  4A93 K;  4BBS C;  2V6U A;  4A3G K;  4YG2 A;  1JVI A;  3S0X A;  1IQ0 A;  3N0C A;  1DCH A;  1INN A;  5JFE A;  4WJ3 M;  1SFO C;  4MEX A;  3NUH A;  4LLG A;  4ILD A;  2R92 C;  3EQL A;  3GTJ C;  2VUM C;  4PAA A;  3S16 C;  3A8I A;  1DCO A;  2JA5 A;  3HOU K;  3VA7 A;  4AH6 A;  4OIO A;  3S1R K;  1VJE A;  2NVX K;  1J6V A;  4BY1 C;  4BBR K;  1EQR A;  2Y0S D;  2R93 K;  5EGE A;  2B63 C;  3CQZ K;  4XLN A;  3LPX A;  1O29 A;  3S15 C;  4Y7N C;  4BLB A;  1V5V A;  4KAS A;  1I50 K;  3K7A C;  3I4M K;  5C44 K;  3FOE A;  4KN7 A;  1WIH A;  1IW7 A;  5IP9 C;  1WSV A;  2V6T A;  5CJ9 A;  5TMC A;  3TTG A;  4P5B A;  4A3G C;  1KQ4 A;  4A3B C;  1R9T A;  3FKI K;  3N3Y A;  1G51 A;  3GEH A;  3I4N K;  1B4A A;  1PJ7 A;  4G0V A;  1YX2 A;  3CQZ A;  1BGW A;  3S2H C;  4A3C C;  1TWC C;  5IP7 K;  5IYD K;  3S2D C;  4C3H K;  1O27 A;  1I3Q C;  3GTG C;  3GTL A;  3S14 C;  2CW0 A;  3V4G A;  4C3J K;  2PMZ L;  1TWC A;  3GTQ K;  4Y52 K;  2E2H C;  2YU9 C;  1BJT A;  4OIR A;  3M4O K;  2YU9 A;  2E2H A;  3N0B A;  4KM8 A;  2A6E A;  3HOY C;  5TJ3 A;  2PA8 L;  2E2I K;  1TWF A; 
#chains in the Genus database with same CATH homology
 4LR2 A;  3ORE A;  2ZFZ A;  3OEP A;  3GTJ A;  2VUM A;  1EH1 A;  1ZXO A;  1WCM A;  4GTE A;  1WQG A;  1O28 A;  2KWA A;  2P5M A;  1TWG A;  1Y1V A;  4GTC A;  4KC6 A;  4G0U A;  2JA6 A;  5IOQ A;  1IS1 A;  2XCR B;  3G4A A;  3ERE D;  2R7Z A;  4LQY A;  3LAJ A;  2GSO A;  3GTQ A;  3GTK A;  4KB4 A;  4M1X A;  2R93 A;  4KDD A;  3QX3 A;  1XXB A;  3GTP A;  3LAP A;  4C2M C;  1GE9 A;  3AQO A;  3S0X A;  3N0C A;  2XCQ A;  5JFE A;  2E2I A;  3AQP A;  3NUH A;  4G0W A;  3CAG A;  4GTA A;  1XXC A;  1EK8 A;  4ILD A;  4P5A A;  4KAT A;  1WQH A;  1F9N A;  2Y3P A;  2GSN A;  4FM9 A;  4KMA A;  4KMD A;  4KAR A;  5IOT A;  1I3Q A;  3GTG A;  4GTD A;  1I50 A;  2JA5 A;  1Y1W A;  3MML B;  3VA7 A;  4KMH A;  1AB4 A;  2XCO A;  4BLA A;  4C3J C;  5EGE A;  2CFA B;  3LPX A;  3AH5 A;  1O29 A;  4BLB A;  1O26 A;  4KAS A;  1XXA A;  3OPF A;  1TWA A;  3L4K A;  1B4B A;  3FOE A;  1WIH A;  4C3H C;  5CJ9 A;  4P5B A;  2JA7 A;  1O24 A;  1DD5 A;  1KQ4 A;  1R9T A;  5IOS A;  3H0G A;  3L4J A;  4GTB A;  3N3Y A;  4BKW A;  3GTM A;  1ISE A;  1TWH A;  4GFQ A;  3FOF A;  4C3I C;  1B4A A;  2R92 A;  1SFO A;  4G0V A;  2RGR A;  3CQZ A;  1BGW A;  4GTL A;  4J3N A;  1ZBS A;  1TWF A;  1O25 A;  1ZVU A;  4GT9 A;  2NVX A;  3BUE A;  4KB2 A;  4DDQ A;  1K83 A;  1O27 A;  2JH3 A;  1O2A A;  4GTF A;  4FZB A;  3GTL A;  2CFA A;  3V4G A;  2RH6 A;  1TWC A;  2GSU A;  1O2B A;  1BJT A;  2PHC B;  4KM9 A;  5IOR A;  1WQF A;  5EGH A;  5CHP A;  2B63 A;  3GTO A;  2YU9 A;  2E2H A;  5JVO A;  2NVY A;  3FKI A;  3N0B A;  4KM8 A;  5TJ3 A;  4KAW X;  3Q3Q A;  3G4C A;  3FHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...