5IOQA

Flavin-dependent thymidylate synthase in complex with fad and deoxyuridine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
210
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 210
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5ioqA00
1KQ4A 1O2BA 4FZBA 1O28A 4GTLA 5IORA 4KASA 4GTFA 4P5AA 4GTCA 4KARA 3G4CA 1O26A 5IOTA 3G4AA 2CFAA 1O24A 5CHPA 3N0CA 4P5BA 4GTBA 4GTAA 5IOQA 1O29A 5IOSA 1O27A 3N3YA 2CFAB 5JFEA 1O2AA 3N0BA 4GTDA 4GT9A 4KATA 1O25A 3AH5A 4GTEA
chains in the Genus database with same CATH superfamily
4BY1C 1YNNA 4A3CK 5M5WK 2R92A 4GZYA 2Y0SD 4A3IK 3S2DK 4NOIA 4YFKA 1TWFC 2WAQD 1IE0A 3TFIA 3GTGC 4OINA 3GIRA 1Y1VA 1XZQA 4A3LK 4C3JK 4AH6A 5FLMC 4G7ZA 3SZZA 5EGEA 3PO2C 3V4GA 3GTMC 3I4MK 4C3IC 2EBBA 3AH5A 1WSRA 4C3HC 1Y1WA 1TWAA 4DDQA 1WQHA 1I6HC 3HOYC 4Y52K 1ZVUA 2B63A 3HKZL 1I50C 3H3VD 1XXAA 3OREA 1DD5A 2JH3A 4X6AC 3GEHA 4A3KC 3GTJA 4BY7K 3FKIK 3GSIA 3HOZC 2PPBA 4C2MK 3GTLC 4BXXK 3LAJA 1EI6A 4OIRA 3FOEA 4G0WA 1ISEA 1YX2A 4J3NA 3RZOC 2E2IC 4C45A 1R9TA 1WCMC 1F7VA 4ILDA 4PABA 5M3MK 4O2DA 1TWGK 2NVXA 4OIQA 1O24A 4KAWX 4OIOA 5CHPA 2YU9C 2KWAA 1XPPA 2NVYK 4MEYA 1WQFA 3RZDK 2A68A 3HOUC 1TWHK 4GTDA 2NVQC 1IL2A 1EQRA 3S1NK 5C4XC 2R93A 1WCMA 4G0UA 4KM9A 4P9SA 2W7VA 1UV7A 4KN4A 1K83C 3AD8C 1O2BA 3SZYA 2V6TA 3HKZD 3FHZA 1C0AA 4GTCA 2YU9A 3TFHA 2E2JK 5IOTA 4QJVA 1DCOA 4P5BA 3S15C 1TWCC 4A3EC 4A3JK 5IOSA 5TMCA 4A93K 3CQZC 4YFNA 3HOXK 1J6VA 3S17K 2RGRA 3GTPA 4ZH4A 2JA6C 2XCRB 1WQGA 5IP9K 1K83A 5IYBK 4A3DK 2BE5A 4Y7NC 1VH2A 3OEPA 2R7ZK 3I4NK 1TWCA 3GTOC 2XCOA 3H0GA 5C3EC 2JA5C 3PO3C 2JA8C 4QIWL 2JA6A 1O29A 4BLBA 2R92K 1BS2A 2P5MA 4BBRC 3T01A 1VJEA 3JSTA 3S1MK 4GTLA 1Y1VK 2JA7C 1PJ5A 4GTFA 5C44K 3L4KA 4XCHA 4BBSK 4XSZA 3GDZA 5E68A 3A8IA 1YNJA 3S2HK 4G7OA 5IYCK 3HOVC 1WOSA 1Y1WK 2PMZD 4A3CC 1TWAK 1USOA 4WJ3M 3MMLB 4LQYA 3M4OK 4LK0A 2V6SA 1IBAA 1XZPA 2B63K 3QX3A 3NUHA 1I3QC 3AQOA 1WSVA 1KQ4A 1EK8A 1WIHA 2A6EA 3GTKC 4A3LC 1IW7A 3PO2K 1HQMA 3GTJK 1XZPB 4C3IK 4KARA 1BGWA 1TWFA 3GTGA 4C3HK 2ZFZA 1VRQC 4KC6A 4AYBL 4A3BK 4QIWD 1PJ7A 1I6HK 4G7HA 3HOYK 1SFOC 3GTMA 1YCLA 1L0WA 2CFAB 2GAHC 1I3QA 3K7AC 1R9TK 1VGXA 3IPJA 1O2FB 2FQOA 2NVXK 2ZUEA 4X6AK 4A3KK 3LAPA 3S1RC 4A3MC 1I50A 3HOZK 3TTGA 3GTLK 2Y3PA 3FKIC 5IP7K 3GTQC 1SFOA 1WOPA 4FM9A 5HL8A 2R93K 1WCMK 3S16C 2PA8D 3GTLA 4G0VA 1JVIA 4KMAA 1HI9A 1TWGC 2YU9K 1WOOA 2E2IA 5C4JC 1IS1A 2WB1L 3G4CA 4AYBD 3G4AA 3GTPK 4WJ4A 1K83K 3S1NC 3FOFA 2O5JA 2PMZL 5IYDC 2E2HC 3HOWC 1ZXOA 3VA7A 4KATA 1J6WA 3S15K 3S1QK 1TWCK 4A3EK 2VUMC 3M3YK 4KMHA 3AD7C 3H0GK 4FZBA 1O28A 5IORA 2XCQA 4A93C 2JA6K 3S17C 4YFXA 2NVTC 3LPXA 3BP3A 3GEEA 3S14K 2ZUFA 4A3FK 1F9NA 4Y7NK 3CQZA 4A3GC 1F7UA 4A3DC 3A8KA 2R7ZC 2V6UA 1O2AA 3I4NC 2VUMA 4XSXA 4KMDA 1G51A 3HXAA 4GFQA 1ZYRA 1B4BA 1VLOA 2WB1D 1F93A 3DXJA 4P5AA 3GTOA 1XXCA 3T02A 2R92C 1EFWA 2JA5A 3WODA 4JK1A 3GEIA 4BY1K 5JFEA 4KM8A 4XLNA 2PA8L 5C44C 1DCPA 1RU0A 1TWFK 4A3IC 3GTGK 2P8TA 3S2DC 3HOVK 3S2HC 2RH6A 3AD9C 2JA7A 5JVOA 5FLMK 5IYCC 1Y1WC 1TWAC 4C3JC 3Q3QA 1SMYA 4MEXA 3GTMK 1PJ6A 3M4OC 1I3QK 1ZQ1C 2CFAA 3I4MC 2A6HA 2B63C 4LJZA 3GTKK 4XLPA 2O5IA 4GTBA 4GTAA 3T00A 3GTJC 1I50K 4KN7A 4Y52C 4BKWA 5EGHA 1XZQB 4KMUA 4GTEA 3GTKA 1SFOK 4A3BC 3ERED 3K7AK 4BY7C 1GE9A 1BDFA 1R9TC 1O26A 4KDDA 5M5YK 1J6XA 4C2MC 3S1RK 4A3MK 4BXXC 3TFJA 2NVXC 4M1XA 4LK1A 3RZOK 2A69A 2E2IK 4Q5SA 1O27A 3S0XA 3GTQK 3EQLA 5M3FK 3ADAC 3OPFA 4LOWA 5IP7C 3BUEA 2D6FC 5D4DA 3AQPA 2FQTA 3S16K 2R93C 1B4AA 3FKIA 3GTQA 2NVYC 2GSUA 3HOUK 2NVQK 3RZDC 5C4JK 5C4XK 1TWHC 5TJ3A 1USMA 1DCHA 1TWGA 1ZBSA 1V5VA 3CAGA 1O25A 2E2JC 3GTPC 4LR2A 1IQ0A 2GSNA 2NVYA 4WILA 3L4JA 4KB4A 3CQZK 5L46A 1X31C 2E2HK 5IYDK 3HOWK 1TWHA 4A3JC 5M5XK 4Q4ZA 3HOXC 5FJ8K 2CW0A 1AB4A 2Y0SL 1I6VA 1JOEA 2VUMK 5IP9C 3S1QC 2WAQL 3BP8C 3M3YC 2E2HA 3H0GC 5IOQA 5IYBC 4QJVB 2NVTK 3N0BA 1J98A 1XXBA 3GTOK 4YG2A 3S14C 5C3EK 4A3GK 1WORA 4BLAA 2JA5K 3PO3K 2JA8K 4A3FC 1BJTA 1INNA 4KASA 3A8JA 4LLGA 4PAAA 4BBRK 3H3VL 2PHCB 3N0CA 1EH1A 2R7ZA 1JQWA 2GSOA 4KB2A 4RMFA 4OIPA 2JA7K 5CJ9A 3N3YA 3S1MC 1Y1VC 5TMFA 4GT9A 2GAGC 4MQ9A 4BBSC
chains in the Genus database with same CATH topology
3GTKA 3ERED 3OEPA 2R92A 1IS1A 1GE9A 3G4CA 1O26A 3G4AA 4KDDA 1TWCA 4C2MC 2XCOA 3H0GA 4M1XA 1Y1VA 3FOFA 2JA6A 1O29A 4BLBA 1O27A 3S0XA 5EGEA 3V4GA 3OPFA 4C3IC 1ZXOA 3VA7A 2P5MA 3BUEA 4KATA 3AH5A 4C3HC 1Y1WA 3AQPA 1TWAA 4DDQA 1WQHA 4KMHA 4FZBA 1B4AA 1O28A 4GTLA 3FKIA 5IORA 2XCQA 3GTQA 2GSUA 4GTFA 1ZVUA 2B63A 3L4KA 1XXAA 3LPXA 3OREA 5TJ3A 1F9NA 3CQZA 1DD5A 2JH3A 3GTJA 1TWGA 3MMLB 4LQYA 1O2AA 1ZBSA 2VUMA 3CAGA 3LAJA 4KMDA 3QX3A 1O25A 3NUHA 3FOEA 4LR2A 4G0WA 3AQOA 1ISEA 1KQ4A 2GSNA 2NVYA 4GFQA 1EK8A 4J3NA 3L4JA 4KB4A 1WIHA 1R9TA 1B4BA 1TWHA 4ILDA 4P5AA 4KARA 3GTOA 1BGWA 1XXCA 1TWFA 3GTGA 1AB4A 2NVXA 2JA5A 2ZFZA 4KC6A 1O24A 4KAWX 5CHPA 2KWAA 2E2HA 5IOQA 3GTMA 2CFAB 5JFEA 1I3QA 1WQFA 4KM8A 3N0BA 4GTDA 1XXBA 2R93A 1WCMA 4BLAA 4KM9A 4G0UA 3LAPA 2RH6A 2JA7A 1BJTA 1O2BA 5JVOA 1I50A 4KASA 4C3JC 3FHZA 3Q3QA 4GTCA 2YU9A 2Y3PA 5IOTA 2CFAA 1SFOA 4FM9A 2PHCB 3N0CA 1EH1A 2R7ZA 4P5BA 2GSOA 4KB2A 4GTBA 4GTAA 5IOSA 5CJ9A 3N3YA 3GTLA 4G0VA 2RGRA 3GTPA 4KMAA 4GT9A 2XCRB 1WQGA 1K83A 4BKWA 5EGHA 2E2IA 4GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ4 A;  1O2B A;  4FZB A;  1O28 A;  4GTL A;  5IOR A;  4KAS A;  4GTF A;  4P5A A;  4GTC A;  4KAR A;  3G4C A;  1O26 A;  5IOT A;  3G4A A;  2CFA A;  1O24 A;  5CHP A;  3N0C A;  4P5B A;  4GTB A;  4GTA A;  5IOQ A;  1O29 A;  5IOS A;  1O27 A;  3N3Y A;  2CFA B;  5JFE A;  1O2A A;  3N0B A;  4GTD A;  4GT9 A;  4KAT A;  1O25 A;  3AH5 A;  4GTE A; 
#chains in the Genus database with same CATH topology
 4BY1 C;  1YNN A;  4A3C K;  5M5W K;  2R92 A;  4GZY A;  2Y0S D;  4A3I K;  3S2D K;  4NOI A;  4YFK A;  1TWF C;  2WAQ D;  1IE0 A;  3TFI A;  3GTG C;  4OIN A;  3GIR A;  1Y1V A;  1XZQ A;  4A3L K;  4C3J K;  4AH6 A;  5FLM C;  4G7Z A;  3SZZ A;  5EGE A;  3PO2 C;  3V4G A;  3GTM C;  3I4M K;  4C3I C;  2EBB A;  3AH5 A;  1WSR A;  4C3H C;  1Y1W A;  1TWA A;  4DDQ A;  1WQH A;  1I6H C;  3HOY C;  4Y52 K;  1ZVU A;  2B63 A;  3HKZ L;  1I50 C;  3H3V D;  1XXA A;  3ORE A;  1DD5 A;  2JH3 A;  4X6A C;  3GEH A;  4A3K C;  3GTJ A;  4BY7 K;  3FKI K;  3GSI A;  3HOZ C;  2PPB A;  4C2M K;  3GTL C;  4BXX K;  3LAJ A;  1EI6 A;  4OIR A;  3FOE A;  4G0W A;  1ISE A;  1YX2 A;  4J3N A;  3RZO C;  2E2I C;  4C45 A;  1R9T A;  1WCM C;  1F7V A;  4ILD A;  4PAB A;  5M3M K;  4O2D A;  1TWG K;  2NVX A;  4OIQ A;  1O24 A;  4KAW X;  4OIO A;  5CHP A;  2YU9 C;  2KWA A;  1XPP A;  2NVY K;  4MEY A;  1WQF A;  3RZD K;  2A68 A;  3HOU C;  1TWH K;  4GTD A;  2NVQ C;  1IL2 A;  1EQR A;  3S1N K;  5C4X C;  2R93 A;  1WCM A;  4G0U A;  4KM9 A;  4P9S A;  2W7V A;  1UV7 A;  4KN4 A;  1K83 C;  3AD8 C;  1O2B A;  3SZY A;  2V6T A;  3HKZ D;  3FHZ A;  1C0A A;  4GTC A;  2YU9 A;  3TFH A;  2E2J K;  5IOT A;  4QJV A;  1DCO A;  4P5B A;  3S15 C;  1TWC C;  4A3E C;  4A3J K;  5IOS A;  5TMC A;  4A93 K;  3CQZ C;  4YFN A;  3HOX K;  1J6V A;  3S17 K;  2RGR A;  3GTP A;  4ZH4 A;  2JA6 C;  2XCR B;  1WQG A;  5IP9 K;  1K83 A;  5IYB K;  4A3D K;  2BE5 A;  4Y7N C;  1VH2 A;  3OEP A;  2R7Z K;  3I4N K;  1TWC A;  3GTO C;  2XCO A;  3H0G A;  5C3E C;  2JA5 C;  3PO3 C;  2JA8 C;  4QIW L;  2JA6 A;  1O29 A;  4BLB A;  2R92 K;  1BS2 A;  2P5M A;  4BBR C;  3T01 A;  1VJE A;  3JST A;  3S1M K;  4GTL A;  1Y1V K;  2JA7 C;  1PJ5 A;  4GTF A;  5C44 K;  3L4K A;  4XCH A;  4BBS K;  4XSZ A;  3GDZ A;  5E68 A;  3A8I A;  1YNJ A;  3S2H K;  4G7O A;  5IYC K;  3HOV C;  1WOS A;  1Y1W K;  2PMZ D;  4A3C C;  1TWA K;  1USO A;  4WJ3 M;  3MML B;  4LQY A;  3M4O K;  4LK0 A;  2V6S A;  1IBA A;  1XZP A;  2B63 K;  3QX3 A;  3NUH A;  1I3Q C;  3AQO A;  1WSV A;  1KQ4 A;  1EK8 A;  1WIH A;  2A6E A;  3GTK C;  4A3L C;  1IW7 A;  3PO2 K;  1HQM A;  3GTJ K;  1XZP B;  4C3I K;  4KAR A;  1BGW A;  1TWF A;  3GTG A;  4C3H K;  2ZFZ A;  1VRQ C;  4KC6 A;  4AYB L;  4A3B K;  4QIW D;  1PJ7 A;  1I6H K;  4G7H A;  3HOY K;  1SFO C;  3GTM A;  1YCL A;  1L0W A;  2CFA B;  2GAH C;  1I3Q A;  3K7A C;  1R9T K;  1VGX A;  3IPJ A;  1O2F B;  2FQO A;  2NVX K;  2ZUE A;  4X6A K;  4A3K K;  3LAP A;  3S1R C;  4A3M C;  1I50 A;  3HOZ K;  3TTG A;  3GTL K;  2Y3P A;  3FKI C;  5IP7 K;  3GTQ C;  1SFO A;  1WOP A;  4FM9 A;  5HL8 A;  2R93 K;  1WCM K;  3S16 C;  2PA8 D;  3GTL A;  4G0V A;  1JVI A;  4KMA A;  1HI9 A;  1TWG C;  2YU9 K;  1WOO A;  2E2I A;  5C4J C;  1IS1 A;  2WB1 L;  3G4C A;  4AYB D;  3G4A A;  3GTP K;  4WJ4 A;  1K83 K;  3S1N C;  3FOF A;  2O5J A;  2PMZ L;  5IYD C;  2E2H C;  3HOW C;  1ZXO A;  3VA7 A;  4KAT A;  1J6W A;  3S15 K;  3S1Q K;  1TWC K;  4A3E K;  2VUM C;  3M3Y K;  4KMH A;  3AD7 C;  3H0G K;  4FZB A;  1O28 A;  5IOR A;  2XCQ A;  4A93 C;  2JA6 K;  3S17 C;  4YFX A;  2NVT C;  3LPX A;  3BP3 A;  3GEE A;  3S14 K;  2ZUF A;  4A3F K;  1F9N A;  4Y7N K;  3CQZ A;  4A3G C;  1F7U A;  4A3D C;  3A8K A;  2R7Z C;  2V6U A;  1O2A A;  3I4N C;  2VUM A;  4XSX A;  4KMD A;  1G51 A;  3HXA A;  4GFQ A;  1ZYR A;  1B4B A;  1VLO A;  2WB1 D;  1F93 A;  3DXJ A;  4P5A A;  3GTO A;  1XXC A;  3T02 A;  2R92 C;  1EFW A;  2JA5 A;  3WOD A;  4JK1 A;  3GEI A;  4BY1 K;  5JFE A;  4KM8 A;  4XLN A;  2PA8 L;  5C44 C;  1DCP A;  1RU0 A;  1TWF K;  4A3I C;  3GTG K;  2P8T A;  3S2D C;  3HOV K;  3S2H C;  2RH6 A;  3AD9 C;  2JA7 A;  5JVO A;  5FLM K;  5IYC C;  1Y1W C;  1TWA C;  4C3J C;  3Q3Q A;  1SMY A;  4MEX A;  3GTM K;  1PJ6 A;  3M4O C;  1I3Q K;  1ZQ1 C;  2CFA A;  3I4M C;  2A6H A;  2B63 C;  4LJZ A;  3GTK K;  4XLP A;  2O5I A;  4GTB A;  4GTA A;  3T00 A;  3GTJ C;  1I50 K;  4KN7 A;  4Y52 C;  4BKW A;  5EGH A;  1XZQ B;  4KMU A;  4GTE A;  3GTK A;  1SFO K;  4A3B C;  3ERE D;  3K7A K;  4BY7 C;  1GE9 A;  1BDF A;  1R9T C;  1O26 A;  4KDD A;  5M5Y K;  1J6X A;  4C2M C;  3S1R K;  4A3M K;  4BXX C;  3TFJ A;  2NVX C;  4M1X A;  4LK1 A;  3RZO K;  2A69 A;  2E2I K;  4Q5S A;  1O27 A;  3S0X A;  3GTQ K;  3EQL A;  5M3F K;  3ADA C;  3OPF A;  4LOW A;  5IP7 C;  3BUE A;  2D6F C;  5D4D A;  3AQP A;  2FQT A;  3S16 K;  2R93 C;  1B4A A;  3FKI A;  3GTQ A;  2NVY C;  2GSU A;  3HOU K;  2NVQ K;  3RZD C;  5C4J K;  5C4X K;  1TWH C;  5TJ3 A;  1USM A;  1DCH A;  1TWG A;  1ZBS A;  1V5V A;  3CAG A;  1O25 A;  2E2J C;  3GTP C;  4LR2 A;  1IQ0 A;  2GSN A;  2NVY A;  4WIL A;  3L4J A;  4KB4 A;  3CQZ K;  5L46 A;  1X31 C;  2E2H K;  5IYD K;  3HOW K;  1TWH A;  4A3J C;  5M5X K;  4Q4Z A;  3HOX C;  5FJ8 K;  2CW0 A;  1AB4 A;  2Y0S L;  1I6V A;  1JOE A;  2VUM K;  5IP9 C;  3S1Q C;  2WAQ L;  3BP8 C;  3M3Y C;  2E2H A;  3H0G C;  5IOQ A;  5IYB C;  4QJV B;  2NVT K;  3N0B A;  1J98 A;  1XXB A;  3GTO K;  4YG2 A;  3S14 C;  5C3E K;  4A3G K;  1WOR A;  4BLA A;  2JA5 K;  3PO3 K;  2JA8 K;  4A3F C;  1BJT A;  1INN A;  4KAS A;  3A8J A;  4LLG A;  4PAA A;  4BBR K;  3H3V L;  2PHC B;  3N0C A;  1EH1 A;  2R7Z A;  1JQW A;  2GSO A;  4KB2 A;  4RMF A;  4OIP A;  2JA7 K;  5CJ9 A;  3N3Y A;  3S1M C;  1Y1V C;  5TMF A;  4GT9 A;  2GAG C;  4MQ9 A;  4BBS C; 
#chains in the Genus database with same CATH homology
 3GTK A;  3ERE D;  3OEP A;  2R92 A;  1IS1 A;  1GE9 A;  3G4C A;  1O26 A;  3G4A A;  4KDD A;  1TWC A;  4C2M C;  2XCO A;  3H0G A;  4M1X A;  1Y1V A;  3FOF A;  2JA6 A;  1O29 A;  4BLB A;  1O27 A;  3S0X A;  5EGE A;  3V4G A;  3OPF A;  4C3I C;  1ZXO A;  3VA7 A;  2P5M A;  3BUE A;  4KAT A;  3AH5 A;  4C3H C;  1Y1W A;  3AQP A;  1TWA A;  4DDQ A;  1WQH A;  4KMH A;  4FZB A;  1B4A A;  1O28 A;  4GTL A;  3FKI A;  5IOR A;  2XCQ A;  3GTQ A;  2GSU A;  4GTF A;  1ZVU A;  2B63 A;  3L4K A;  1XXA A;  3LPX A;  3ORE A;  5TJ3 A;  1F9N A;  3CQZ A;  1DD5 A;  2JH3 A;  3GTJ A;  1TWG A;  3MML B;  4LQY A;  1O2A A;  1ZBS A;  2VUM A;  3CAG A;  3LAJ A;  4KMD A;  3QX3 A;  1O25 A;  3NUH A;  3FOE A;  4LR2 A;  4G0W A;  3AQO A;  1ISE A;  1KQ4 A;  2GSN A;  2NVY A;  4GFQ A;  1EK8 A;  4J3N A;  3L4J A;  4KB4 A;  1WIH A;  1R9T A;  1B4B A;  1TWH A;  4ILD A;  4P5A A;  4KAR A;  3GTO A;  1BGW A;  1XXC A;  1TWF A;  3GTG A;  1AB4 A;  2NVX A;  2JA5 A;  2ZFZ A;  4KC6 A;  1O24 A;  4KAW X;  5CHP A;  2KWA A;  2E2H A;  5IOQ A;  3GTM A;  2CFA B;  5JFE A;  1I3Q A;  1WQF A;  4KM8 A;  3N0B A;  4GTD A;  1XXB A;  2R93 A;  1WCM A;  4BLA A;  4KM9 A;  4G0U A;  3LAP A;  2RH6 A;  2JA7 A;  1BJT A;  1O2B A;  5JVO A;  1I50 A;  4KAS A;  4C3J C;  3FHZ A;  3Q3Q A;  4GTC A;  2YU9 A;  2Y3P A;  5IOT A;  2CFA A;  1SFO A;  4FM9 A;  2PHC B;  3N0C A;  1EH1 A;  2R7Z A;  4P5B A;  2GSO A;  4KB2 A;  4GTB A;  4GTA A;  5IOS A;  5CJ9 A;  3N3Y A;  3GTL A;  4G0V A;  2RGR A;  3GTP A;  4KMA A;  4GT9 A;  2XCR B;  1WQG A;  1K83 A;  4BKW A;  5EGH A;  2E2I A;  4GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...