5IOQA

Flavin-dependent thymidylate synthase in complex with fad and deoxyuridine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
210
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 77
structure length 210
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5ioqA00
3N3YA 4GTAA 1O28A 4GTBA 5IOTA 3G4AA 5IORA 1O29A 1O2AA 5CHPA 4GTEA 4FZBA 4KASA 1O2BA 5IOSA 4P5BA 5JFEA 3AH5A 1O25A 3N0CA 5IOQA 2CFAB 3G4CA 1KQ4A 4GTCA 1O26A 3N0BA 1O24A 4KATA 4KARA 4GTLA 4GTDA 4GT9A 4GTFA 1O27A 4P5AA 2CFAA
chains in the Genus database with same CATH superfamily
2WAQD 2R93K 4WJ3M 1EFWA 3OREA 1USMA 4A3MC 1TWCK 4A3KK 3HOUC 4KASA 2B63A 1L0WA 4A3CC 4C2MC 3T02A 5IYCC 4A3JK 2JA7K 4Q5SA 5E68A 5FLMC 1WOSA 3G4CA 1SFOC 3GTJA 3H0GK 1R9TK 4A3LK 4GTDA 3HOWK 1I3QA 3GTMK 3OEPA 3CQZK 1BS2A 1IBAA 2B63C 3S15K 1WSRA 4KC6A 3MMLB 1V5VA 1TWAC 3AQPA 3M4OC 2KWAA 3S2DK 1BGWA 4MEXA 3GTJC 5TMFA 3S2HK 1WSVA 3GTGC 2NVYK 3GEHA 5C3EK 5IP7C 4LQYA 1O24A 1DCPA 3S1QK 3RZOC 4RMFA 3QX3A 1PJ6A 3I4NK 4G7ZA 4OINA 4QIWD 3GTKC 3GTQA 5M5YK 4C45A 2A6HA 2GSNA 4YFKA 2E2JC 5M3MK 1XZPB 4GTBA 5EGHA 3GTPC 4QJVA 5IOTA 1GE9A 3RZDC 3S1MK 1O2AA 4Y52C 2WB1L 1F7VA 3HOYK 5C4JC 3I4MK 4A3DK 5IYDC 3S17K 2VUMA 4NOIA 2NVQK 4KB2A 1DCHA 1RU0A 3IPJA 1F7UA 1YNNA 1VH2A 2NVXA 1VRQC 4P9SA 3GTQC 4G0WA 4G0UA 4G7OA 3N0BA 5C4XK 3HOZC 4KDDA 4LOWA 4YFXA 3L4KA 4O2DA 4KMUA 2VUMC 2BE5A 2PMZD 1F93A 2A68A 1ISEA 1Y1VA 2NVXC 2Y3PA 3S1NC 4WILA 4BBRC 4BLBA 2NVTC 4AYBD 3GEIA 4GTCA 4MEYA 2ZFZA 3SZYA 2YU9K 1JVIA 1TWGA 2R92K 4XSZA 1WCMA 2E2HC 2O5JA 5IYBC 1JQWA 4BKWA 5JVOA 3LAPA 2JA6A 1K83C 5C44C 2R93A 1XXBA 4Y7NK 2JA8K 3GSIA 4BBSC 4LR2A 3AH5A 1TWCA 2P8TA 2PA8L 2CFAB 1JOEA 1TWGC 3GTLK 1WCMC 3DXJA 4KATA 2JH3A 1DCOA 3GIRA 2RH6A 2JA7A 2JA6C 3PO3K 4JK1A 4A3GK 1J6XA 2R93C 2V6TA 3H0GA 1R9TA 1Y1WK 3TTGA 4A3BK 2CW0A 3G4AA 3CQZA 3NUHA 1XZQB 3M3YK 4GTEA 4M1XA 4DDQA 4A3KC 5L46A 4A3JC 3N0CA 2JA7C 1HQMA 2E2IK 3HXAA 3H0GC 1R9TC 4A3LC 1AB4A 3FOFA 1ZQ1C 2A6EA 3HOWC 3OPFA 2NVYA 3CQZC 3H3VD 2Y0SL 4J3NA 2XCQA 2A69A 3S16K 4BXXC 3S2DC 4YFNA 3JSTA 4C2MK 3K7AK 3S14K 1TWHK 2NVYC 5C3EC 1I3QC 3FKIA 3S1QC 1X31C 1SFOK 4ILDA 3I4NC 1XPPA 3S1RC 4GTAA 1ZVUA 3T01A 4C3IC 2XCRB 1INNA 3HOYC 3I4MC 4A3DC 3S17C 3HOXK 2R7ZK 1TWAK 2NVQC 2PHCB 1VLOA 3FKIC 4FZBA 2PPBA 3GTJK 4X6AC 2JA5K 5IP9K 1XXAA 3GTGK 3A8JA 1I6HC 1WOOA 3GTKK 2E2JK 3N3YA 2YU9A 3GTPK 3RZDK 4PABA 2R92A 2V6SA 3HOVK 3LAJA 1TWFK 1VGXA 3EQLA 1ZXOA 4P5BA 4BY1K 5HL8A 1UV7A 4A93C 3A8KA 4LLGA 4C3JC 3CAGA 2YU9C 4GFQA 1YX2A 5CJ9A 2R92C 3GTLA 2VUMK 4LJZA 4A3IK 1EH1A 1Y1VC 2WAQL 2ZUEA 3HKZD 1ZYRA 1Y1WA 2W7VA 5EGEA 4OIOA 2NVXK 4BY7K 2D6FC 2GSOA 1O2BA 3LPXA 4A3EC 4G0VA 1I50K 1IL2A 4BBRK 1IW7A 2GAHC 1C0AA 3GTLC 2P5MA 4PAAA 5M5XK 4GTFA 5M3FK 2E2IA 1HI9A 1J6WA 4A3GC 4A3BC 1Y1WC 4MQ9A 2E2HK 1BDFA 5IYBK 4G7HA 3VA7A 3GTMA 1F9NA 3M3YC 3TFJA 1K83K 1TWCC 1USOA 1XZPA 1XXCA 5D4DA 3GTOK 1O25A 4OIPA 4C3HK 2GSUA 2V6UA 2E2IC 1YNJA 2O5IA 4AH6A 1TWHA 4GTLA 3ERED 3PO2K 4KN7A 3FOEA 3GTMC 3GEEA 1SFOA 4QIWL 4A3FK 3ADAC 3S16C 1B4BA 3S15C 4KAWX 3FHZA 1WQHA 3GDZA 3TFHA 5TMCA 4A3MK 4ZH4A 1B4AA 3HOUK 5IOSA 2R7ZA 1TWAA 2PA8D 3K7AC 3S14C 1TWHC 4A3CK 5IYCK 3S2HC 5FLMK 5FJ8K 2JA5A 3AD9C 2RGRA 3GTGA 2FQTA 1I6VA 1BJTA 1EI6A 1IS1A 2PMZL 3GTKA 3S1MC 2B63K 3HOXC 2R7ZC 4BXXK 4KN4A 3GTPA 3AD8C 3M4OK 2JA5C 5IP9C 4GZYA 1WORA 5IOQA 4FM9A 1TWFA 1I3QK 5IP7K 5C4XC 2FQOA 4AYBL 3AQOA 3RZOK 1IE0A 2Y0SD 3S1RK 4KM9A 2CFAA 4KB4A 1G51A 1J6VA 1VJEA 3S0XA 4C3IK 5TJ3A 3HKZL 5CHPA 3HOVC 4Y52K 5C4JK 5IYDK 1TWFC 4LK1A 3FKIK 5M5WK 4XLPA 3BP8C 4X6AK 4BY1C 3SZZA 2EBBA 1XZQA 1EQRA 1ZBSA 4BLAA 4XLNA 3GTQK 1SMYA 1I6HK 4KM8A 1I50A 1EK8A 3HOZK 1WOPA 3T00A 4XCHA 1IQ0A 3L4JA 4XSXA 4A3IC 3Q3QA 5IORA 4KMAA 2WB1D 4Q4ZA 1DD5A 2E2HA 4BY7C 1O2FB 1WQGA 4Y7NC 3S1NK 4LK0A 2JA8C 4YG2A 1K83A 1I50C 5JFEA 4A93K 3TFIA 1O26A 4C3JK 2NVTK 3GTOA 4KARA 4QJVB 4GT9A 3A8IA 1YCLA 3PO3C 1PJ7A 4P5AA 3H3VL 1O28A 1Y1VK 1O29A 1WQFA 4KMHA 4OIQA 4WJ4A 5C44K 1J98A 4OIRA 3V4GA 3AD7C 3WODA 1PJ5A 1WIHA 3GTOC 4A3EK 3BUEA 2XCOA 4C3HC 4BBSK 2ZUFA 1KQ4A 1TWGK 1WCMK 3BP3A 3PO2C 2JA6K 1O27A 4A3FC 4KMDA 2GAGC
chains in the Genus database with same CATH topology
3N3YA 2YU9A 1BJTA 4BKWA 5JVOA 1IS1A 3GTKA 3LAPA 2JA6A 2R92A 3OREA 2R93A 1XXBA 3LAJA 3GTPA 4KMDA 4KASA 2B63A 1ZXOA 4LR2A 4P5BA 4C2MC 3AH5A 1TWCA 5IOQA 4FM9A 1TWFA 2CFAB 3G4CA 4C3JC 4KATA 3GTJA 3AQOA 3CAGA 2JH3A 4GTDA 2JA7A 2RH6A 4GFQA 1I3QA 5CJ9A 3OEPA 4KM9A 3GTLA 2CFAA 3H0GA 1R9TA 4KB4A 1EH1A 3S0XA 3G4AA 3CQZA 5TJ3A 5CHPA 3NUHA 4KC6A 3MMLB 4GTEA 1Y1WA 4M1XA 4DDQA 5EGEA 2GSOA 3AQPA 1O2BA 2KWAA 1BGWA 3LPXA 4G0VA 3N0CA 1ZBSA 4BLAA 2P5MA 4LQYA 1O24A 4KM8A 1I50A 1AB4A 3FOFA 1EK8A 3QX3A 4GTFA 3OPFA 2NVYA 2E2IA 3L4JA 3GTQA 2GSNA 4J3NA 2XCQA 4GTBA 3Q3QA 5EGHA 1GE9A 5IOTA 5IORA 4KMAA 3VA7A 3GTMA 1F9NA 1O2AA 1DD5A 2E2HA 2VUMA 1WQGA 4KB2A 1XXCA 1K83A 5JFEA 1O25A 2GSUA 2NVXA 3FKIA 4G0WA 4G0UA 1O26A 3N0BA 3GTOA 4KARA 4ILDA 1TWHA 4GTLA 4GT9A 3ERED 4KDDA 3FOEA 3L4KA 4P5AA 1SFOA 4GTAA 1O28A 1ZVUA 1O29A 4C3IC 1B4BA 1WQFA 2XCRB 4KAWX 3FHZA 1WQHA 4KMHA 2PHCB 1ISEA 1Y1VA 2Y3PA 1B4AA 3V4GA 4FZBA 1WIHA 5IOSA 2R7ZA 3BUEA 1TWAA 2XCOA 4C3HC 1XXAA 4BLBA 1KQ4A 4GTCA 2ZFZA 2JA5A 2RGRA 3GTGA 1TWGA 1O27A 1WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3Y A;  4GTA A;  1O28 A;  4GTB A;  5IOT A;  3G4A A;  5IOR A;  1O29 A;  1O2A A;  5CHP A;  4GTE A;  4FZB A;  4KAS A;  1O2B A;  5IOS A;  4P5B A;  5JFE A;  3AH5 A;  1O25 A;  3N0C A;  5IOQ A;  2CFA B;  3G4C A;  1KQ4 A;  4GTC A;  1O26 A;  3N0B A;  1O24 A;  4KAT A;  4KAR A;  4GTL A;  4GTD A;  4GT9 A;  4GTF A;  1O27 A;  4P5A A;  2CFA A; 
#chains in the Genus database with same CATH topology
 2WAQ D;  2R93 K;  4WJ3 M;  1EFW A;  3ORE A;  1USM A;  4A3M C;  1TWC K;  4A3K K;  3HOU C;  4KAS A;  2B63 A;  1L0W A;  4A3C C;  4C2M C;  3T02 A;  5IYC C;  4A3J K;  2JA7 K;  4Q5S A;  5E68 A;  5FLM C;  1WOS A;  3G4C A;  1SFO C;  3GTJ A;  3H0G K;  1R9T K;  4A3L K;  4GTD A;  3HOW K;  1I3Q A;  3GTM K;  3OEP A;  3CQZ K;  1BS2 A;  1IBA A;  2B63 C;  3S15 K;  1WSR A;  4KC6 A;  3MML B;  1V5V A;  1TWA C;  3AQP A;  3M4O C;  2KWA A;  3S2D K;  1BGW A;  4MEX A;  3GTJ C;  5TMF A;  3S2H K;  1WSV A;  3GTG C;  2NVY K;  3GEH A;  5C3E K;  5IP7 C;  4LQY A;  1O24 A;  1DCP A;  3S1Q K;  3RZO C;  4RMF A;  3QX3 A;  1PJ6 A;  3I4N K;  4G7Z A;  4OIN A;  4QIW D;  3GTK C;  3GTQ A;  5M5Y K;  4C45 A;  2A6H A;  2GSN A;  4YFK A;  2E2J C;  5M3M K;  1XZP B;  4GTB A;  5EGH A;  3GTP C;  4QJV A;  5IOT A;  1GE9 A;  3RZD C;  3S1M K;  1O2A A;  4Y52 C;  2WB1 L;  1F7V A;  3HOY K;  5C4J C;  3I4M K;  4A3D K;  5IYD C;  3S17 K;  2VUM A;  4NOI A;  2NVQ K;  4KB2 A;  1DCH A;  1RU0 A;  3IPJ A;  1F7U A;  1YNN A;  1VH2 A;  2NVX A;  1VRQ C;  4P9S A;  3GTQ C;  4G0W A;  4G0U A;  4G7O A;  3N0B A;  5C4X K;  3HOZ C;  4KDD A;  4LOW A;  4YFX A;  3L4K A;  4O2D A;  4KMU A;  2VUM C;  2BE5 A;  2PMZ D;  1F93 A;  2A68 A;  1ISE A;  1Y1V A;  2NVX C;  2Y3P A;  3S1N C;  4WIL A;  4BBR C;  4BLB A;  2NVT C;  4AYB D;  3GEI A;  4GTC A;  4MEY A;  2ZFZ A;  3SZY A;  2YU9 K;  1JVI A;  1TWG A;  2R92 K;  4XSZ A;  1WCM A;  2E2H C;  2O5J A;  5IYB C;  1JQW A;  4BKW A;  5JVO A;  3LAP A;  2JA6 A;  1K83 C;  5C44 C;  2R93 A;  1XXB A;  4Y7N K;  2JA8 K;  3GSI A;  4BBS C;  4LR2 A;  3AH5 A;  1TWC A;  2P8T A;  2PA8 L;  2CFA B;  1JOE A;  1TWG C;  3GTL K;  1WCM C;  3DXJ A;  4KAT A;  2JH3 A;  1DCO A;  3GIR A;  2RH6 A;  2JA7 A;  2JA6 C;  3PO3 K;  4JK1 A;  4A3G K;  1J6X A;  2R93 C;  2V6T A;  3H0G A;  1R9T A;  1Y1W K;  3TTG A;  4A3B K;  2CW0 A;  3G4A A;  3CQZ A;  3NUH A;  1XZQ B;  3M3Y K;  4GTE A;  4M1X A;  4DDQ A;  4A3K C;  5L46 A;  4A3J C;  3N0C A;  2JA7 C;  1HQM A;  2E2I K;  3HXA A;  3H0G C;  1R9T C;  4A3L C;  1AB4 A;  3FOF A;  1ZQ1 C;  2A6E A;  3HOW C;  3OPF A;  2NVY A;  3CQZ C;  3H3V D;  2Y0S L;  4J3N A;  2XCQ A;  2A69 A;  3S16 K;  4BXX C;  3S2D C;  4YFN A;  3JST A;  4C2M K;  3K7A K;  3S14 K;  1TWH K;  2NVY C;  5C3E C;  1I3Q C;  3FKI A;  3S1Q C;  1X31 C;  1SFO K;  4ILD A;  3I4N C;  1XPP A;  3S1R C;  4GTA A;  1ZVU A;  3T01 A;  4C3I C;  2XCR B;  1INN A;  3HOY C;  3I4M C;  4A3D C;  3S17 C;  3HOX K;  2R7Z K;  1TWA K;  2NVQ C;  2PHC B;  1VLO A;  3FKI C;  4FZB A;  2PPB A;  3GTJ K;  4X6A C;  2JA5 K;  5IP9 K;  1XXA A;  3GTG K;  3A8J A;  1I6H C;  1WOO A;  3GTK K;  2E2J K;  3N3Y A;  2YU9 A;  3GTP K;  3RZD K;  4PAB A;  2R92 A;  2V6S A;  3HOV K;  3LAJ A;  1TWF K;  1VGX A;  3EQL A;  1ZXO A;  4P5B A;  4BY1 K;  5HL8 A;  1UV7 A;  4A93 C;  3A8K A;  4LLG A;  4C3J C;  3CAG A;  2YU9 C;  4GFQ A;  1YX2 A;  5CJ9 A;  2R92 C;  3GTL A;  2VUM K;  4LJZ A;  4A3I K;  1EH1 A;  1Y1V C;  2WAQ L;  2ZUE A;  3HKZ D;  1ZYR A;  1Y1W A;  2W7V A;  5EGE A;  4OIO A;  2NVX K;  4BY7 K;  2D6F C;  2GSO A;  1O2B A;  3LPX A;  4A3E C;  4G0V A;  1I50 K;  1IL2 A;  4BBR K;  1IW7 A;  2GAH C;  1C0A A;  3GTL C;  2P5M A;  4PAA A;  5M5X K;  4GTF A;  5M3F K;  2E2I A;  1HI9 A;  1J6W A;  4A3G C;  4A3B C;  1Y1W C;  4MQ9 A;  2E2H K;  1BDF A;  5IYB K;  4G7H A;  3VA7 A;  3GTM A;  1F9N A;  3M3Y C;  3TFJ A;  1K83 K;  1TWC C;  1USO A;  1XZP A;  1XXC A;  5D4D A;  3GTO K;  1O25 A;  4OIP A;  4C3H K;  2GSU A;  2V6U A;  2E2I C;  1YNJ A;  2O5I A;  4AH6 A;  1TWH A;  4GTL A;  3ERE D;  3PO2 K;  4KN7 A;  3FOE A;  3GTM C;  3GEE A;  1SFO A;  4QIW L;  4A3F K;  3ADA C;  3S16 C;  1B4B A;  3S15 C;  4KAW X;  3FHZ A;  1WQH A;  3GDZ A;  3TFH A;  5TMC A;  4A3M K;  4ZH4 A;  1B4A A;  3HOU K;  5IOS A;  2R7Z A;  1TWA A;  2PA8 D;  3K7A C;  3S14 C;  1TWH C;  4A3C K;  5IYC K;  3S2H C;  5FLM K;  5FJ8 K;  2JA5 A;  3AD9 C;  2RGR A;  3GTG A;  2FQT A;  1I6V A;  1BJT A;  1EI6 A;  1IS1 A;  2PMZ L;  3GTK A;  3S1M C;  2B63 K;  3HOX C;  2R7Z C;  4BXX K;  4KN4 A;  3GTP A;  3AD8 C;  3M4O K;  2JA5 C;  5IP9 C;  4GZY A;  1WOR A;  5IOQ A;  4FM9 A;  1TWF A;  1I3Q K;  5IP7 K;  5C4X C;  2FQO A;  4AYB L;  3AQO A;  3RZO K;  1IE0 A;  2Y0S D;  3S1R K;  4KM9 A;  2CFA A;  4KB4 A;  1G51 A;  1J6V A;  1VJE A;  3S0X A;  4C3I K;  5TJ3 A;  3HKZ L;  5CHP A;  3HOV C;  4Y52 K;  5C4J K;  5IYD K;  1TWF C;  4LK1 A;  3FKI K;  5M5W K;  4XLP A;  3BP8 C;  4X6A K;  4BY1 C;  3SZZ A;  2EBB A;  1XZQ A;  1EQR A;  1ZBS A;  4BLA A;  4XLN A;  3GTQ K;  1SMY A;  1I6H K;  4KM8 A;  1I50 A;  1EK8 A;  3HOZ K;  1WOP A;  3T00 A;  4XCH A;  1IQ0 A;  3L4J A;  4XSX A;  4A3I C;  3Q3Q A;  5IOR A;  4KMA A;  2WB1 D;  4Q4Z A;  1DD5 A;  2E2H A;  4BY7 C;  1O2F B;  1WQG A;  4Y7N C;  3S1N K;  4LK0 A;  2JA8 C;  4YG2 A;  1K83 A;  1I50 C;  5JFE A;  4A93 K;  3TFI A;  1O26 A;  4C3J K;  2NVT K;  3GTO A;  4KAR A;  4QJV B;  4GT9 A;  3A8I A;  1YCL A;  3PO3 C;  1PJ7 A;  4P5A A;  3H3V L;  1O28 A;  1Y1V K;  1O29 A;  1WQF A;  4KMH A;  4OIQ A;  4WJ4 A;  5C44 K;  1J98 A;  4OIR A;  3V4G A;  3AD7 C;  3WOD A;  1PJ5 A;  1WIH A;  3GTO C;  4A3E K;  3BUE A;  2XCO A;  4C3H C;  4BBS K;  2ZUF A;  1KQ4 A;  1TWG K;  1WCM K;  3BP3 A;  3PO2 C;  2JA6 K;  1O27 A;  4A3F C;  4KMD A;  2GAG C; 
#chains in the Genus database with same CATH homology
 3N3Y A;  2YU9 A;  1BJT A;  4BKW A;  5JVO A;  1IS1 A;  3GTK A;  3LAP A;  2JA6 A;  2R92 A;  3ORE A;  2R93 A;  1XXB A;  3LAJ A;  3GTP A;  4KMD A;  4KAS A;  2B63 A;  1ZXO A;  4LR2 A;  4P5B A;  4C2M C;  3AH5 A;  1TWC A;  5IOQ A;  4FM9 A;  1TWF A;  2CFA B;  3G4C A;  4C3J C;  4KAT A;  3GTJ A;  3AQO A;  3CAG A;  2JH3 A;  4GTD A;  2JA7 A;  2RH6 A;  4GFQ A;  1I3Q A;  5CJ9 A;  3OEP A;  4KM9 A;  3GTL A;  2CFA A;  3H0G A;  1R9T A;  4KB4 A;  1EH1 A;  3S0X A;  3G4A A;  3CQZ A;  5TJ3 A;  5CHP A;  3NUH A;  4KC6 A;  3MML B;  4GTE A;  1Y1W A;  4M1X A;  4DDQ A;  5EGE A;  2GSO A;  3AQP A;  1O2B A;  2KWA A;  1BGW A;  3LPX A;  4G0V A;  3N0C A;  1ZBS A;  4BLA A;  2P5M A;  4LQY A;  1O24 A;  4KM8 A;  1I50 A;  1AB4 A;  3FOF A;  1EK8 A;  3QX3 A;  4GTF A;  3OPF A;  2NVY A;  2E2I A;  3L4J A;  3GTQ A;  2GSN A;  4J3N A;  2XCQ A;  4GTB A;  3Q3Q A;  5EGH A;  1GE9 A;  5IOT A;  5IOR A;  4KMA A;  3VA7 A;  3GTM A;  1F9N A;  1O2A A;  1DD5 A;  2E2H A;  2VUM A;  1WQG A;  4KB2 A;  1XXC A;  1K83 A;  5JFE A;  1O25 A;  2GSU A;  2NVX A;  3FKI A;  4G0W A;  4G0U A;  1O26 A;  3N0B A;  3GTO A;  4KAR A;  4ILD A;  1TWH A;  4GTL A;  4GT9 A;  3ERE D;  4KDD A;  3FOE A;  3L4K A;  4P5A A;  1SFO A;  4GTA A;  1O28 A;  1ZVU A;  1O29 A;  4C3I C;  1B4B A;  1WQF A;  2XCR B;  4KAW X;  3FHZ A;  1WQH A;  4KMH A;  2PHC B;  1ISE A;  1Y1V A;  2Y3P A;  1B4A A;  3V4G A;  4FZB A;  1WIH A;  5IOS A;  2R7Z A;  3BUE A;  1TWA A;  2XCO A;  4C3H C;  1XXA A;  4BLB A;  1KQ4 A;  4GTC A;  2ZFZ A;  2JA5 A;  2RGR A;  3GTG A;  1TWG A;  1O27 A;  1WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...