5IOQA

Flavin-dependent thymidylate synthase in complex with fad and deoxyuridine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
210
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 210
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5ioqA00
4GTFA 3N0CA 4GTLA 5IOTA 1O2BA 4GTDA 5CHPA 4GTBA 4KARA 1O25A 4KATA 4P5BA 1O2AA 4GTCA 3G4CA 1O29A 2CFAA 5IOQA 4KASA 1KQ4A 5JFEA 3N3YA 3G4AA 4P5AA 3AH5A 1O27A 4FZBA 3N0BA 2CFAB 5IORA 1O28A 5IOSA 1O24A 4GT9A 4GTAA 4GTEA 1O26A
chains in the Genus database with same CATH superfamily
3S1MC 1XXCA 2FQOA 3S1NK 1TWCA 1PJ7A 4A3KK 3GTKK 3A8IA 4GTBA 1I3QC 2E2HC 4QIWL 5IYDC 3RZOC 1DCPA 3S1RC 2Y0SL 1BS2A 3CQZA 3H0GK 4BBSC 4P5AA 2R93C 2JA8C 4KB2A 4Y52C 2V6SA 2GAGC 3AQOA 3LPXA 5JVOA 4FM9A 4YFKA 5FJ8K 1ISEA 3S14C 3GTQA 4GTEA 1J6VA 4XCHA 4AH6A 4WILA 5HL8A 3DXJA 4GTDA 5CHPA 3S16C 3M4OK 2XCOA 1WCMK 4A3FC 1DCHA 1EI6A 1WQGA 1WQHA 1EK8A 1BDFA 4LLGA 1TWFC 2R92C 2VUMC 2GSOA 1Y1VA 3AQPA 2Y3PA 1B4BA 1O26A 4C3JC 3LAPA 3GTMA 3NUHA 4A3GC 3SZZA 2NVYK 3HKZL 2NVXA 3S1NC 3CAGA 3GTOA 1WOSA 1YCLA 3K7AK 4A3KC 3GTKC 2XCRB 2CFAA 3AD8C 3A8JA 2KWAA 4C3IK 3OPFA 2PMZL 3HOUK 1TWHA 3M3YK 3H0GC 4A3JK 4Y7NK 3FKIA 1F93A 3I4NK 1J6WA 3PO3K 1R9TA 2CFAB 5IORA 5C4JK 2O5IA 2JA7K 1WQFA 4LJZA 3TFJA 4GTLA 5IP7K 2YU9K 2JA5K 1PJ6A 3OEPA 5M5WK 4KMAA 3M4OC 3GTLK 4A3IK 5M3MK 1Y1WK 4BY7K 4KM8A 4P9SA 5EGEA 4QIWD 1UV7A 2E2IA 2Y0SD 1F7UA 1ZXOA 3TFHA 2WB1D 2NVQK 3S2HK 4A3MK 1WIHA 2BE5A 4A3DK 2NVYC 1IW7A 1YNNA 1SMYA 5C3EK 4JK1A 4GTCA 3T00A 2D6FC 1WORA 3K7AC 1HQMA 4KC6A 3GIRA 4KMUA 1L0WA 3H3VD 3HOUC 3GTGA 3M3YC 4A3JC 4Y7NC 2B63A 4BY1K 1TWGA 3BP8C 3AD9C 4BXXK 3I4NC 3PO3C 3GTPA 5EGHA 5C4JC 4MEXA 2JA7C 4GZYA 1HI9A 4A93K 1Y1VK 1XPPA 4LR2A 5IP7C 3HOXK 2YU9C 1O25A 2JA5C 4ZH4A 2A6HA 1YX2A 3VA7A 3GTLC 2NVXK 4A3IC 1WSVA 1F7VA 1Y1WC 4BY7C 1I3QA 4MQ9A 2E2HA 1O28A 2A6EA 1EQRA 5IOSA 3GEEA 2PHCB 1F9NA 1TWHK 2W7VA 2NVQC 1XZQA 4KMHA 3GTJK 2R93A 3S2HC 4A3MC 2R7ZK 3S2DK 4A3DC 4P5BA 5C4XK 4GFQA 5C3EC 3HOZK 3MMLB 4LQYA 4C3HK 1XZQB 1G51A 2WAQD 5IYCK 2NVTK 4XLNA 3FOEA 5IP9K 4C2MK 4BY1C 4KAWX 3BP3A 4GTAA 4BXXC 1I50A 4OIOA 2PPBA 1O2BA 1TWFA 4BKWA 4A93C 1GE9A 1IBAA 4MEYA 2VUMA 1Y1VC 3IPJA 3JSTA 4AYBD 5M5YK 1O2AA 4YFNA 3HOXC 3GSIA 2FQTA 4OIPA 1K83K 1JOEA 2NVXC 5TJ3A 4M1XA 4G7ZA 4A3CK 2V6UA 1VGXA 4LK0A 1XXBA 3HOVK 1TWHC 3H0GA 2B63K 2JA6A 4WJ4A 3GTJC 3SZYA 4KARA 2R7ZC 2PA8D 3S2DC 5C4XC 5TMFA 1B4AA 1JVIA 1TWCK 5CJ9A 4C3HC 2CW0A 3HOZC 2GSUA 5JFEA 5FLMK 5IYCC 2NVTC 4FZBA 5IP9C 1WCMA 3CQZK 1X31C 1PJ5A 4C2MC 1I6VA 4WJ3M 1TWAA 1EH1A 2P8TA 4A3EK 4A3BC 2ZUFA 4YG2A 3GTQK 1VRQC 4O2DA 4BLAA 5M5XK 1I6HK 1VLOA 3GEHA 4KASA 4Q4ZA 3HXAA 1K83C 3AH5A 3Q3QA 3S17K 3RZDK 2ZFZA 4QJVA 2O5JA 4A3CC 2P5MA 4OIRA 1SFOA 3FHZA 3N0CA 4LK1A 3HOVC 4KM9A 2B63C 4KDDA 4QJVB 1BGWA 1I50K 3G4CA 3GTMK 1ZVUA 2JA7A 3HKZD 4KN7A 4XSXA 1TWCC 3GTOK 3PO2C 4A3LK 3T02A 2YU9A 5FLMC 4XLPA 2V6TA 4OINA 1XXAA 3GTLA 1C0AA 2PMZD 3CQZC 4X6AK 3FKIK 1Y1WA 3S1QK 3HOYK 1R9TK 5D4DA 3LAJA 1V5VA 1IQ0A 3ERED 4A3EC 4PAAA 3GTQC 4KMDA 2WB1L 2JA6K 1ZQ1C 3S15K 1I6HC 1YNJA 3N0BA 3S17C 1ZBSA 3RZDC 2A68A 4YFXA 4J3NA 2E2JK 4Q5SA 5L46A 1WOPA 2E2IK 3H3VL 4A3BK 2R92A 1IL2A 4KATA 1ZYRA 4DDQA 3GEIA 1O29A 1I50C 1TWAK 4ILDA 5C44K 4RMFA 3GTMC 2RGRA 3N3YA 2XCQA 2RH6A 4BLBA 1INNA 1O27A 3EQLA 4BBRK 3GTOC 3I4MK 2EBBA 2ZUEA 4A3LC 3GDZA 4G0WA 4C45A 3GTKA 1DD5A 4G7OA 5TMCA 3GTGK 4KB4A 5IYBK 1WSRA 4X6AC 1XZPA 1TWGK 3L4KA 3FKIC 3AD7C 3S1QC 1USOA 1R9TC 3GTPK 4G7HA 1EFWA 3WODA 1SFOK 3HOWK 3HOYC 4XSZA 3TTGA 4NOIA 5E68A 4G0VA 1XZPB 2JA6C 3G4AA 4G0UA 3GTJA 3S15C 1AB4A 3V4GA 3L4JA 2R7ZA 3PO2K 5M3FK 3S1MK 1VH2A 3S0XA 4GTFA 3ADAC 2E2JC 1I3QK 2WAQL 2E2HK 3RZOK 5IYDK 1WCMC 3S1RK 1IS1A 2E2IC 1VJEA 4BBSK 4LOWA 2R93K 1TWAC 5C44C 2JA8K 4Y52K 3T01A 3FOFA 2NVYA 1RU0A 4PABA 3S14K 4BBRC 3I4MC 1WOOA 2GAHC 4AYBL 4OIQA 5IOTA 4GT9A 5IOQA 3BUEA 3S16K 1K83A 4A3FK 3GTGC 1USMA 5IYBC 2GSNA 3A8KA 1BJTA 1DCOA 1TWGC 1J6XA 1O2FB 3GTPC 3HOWC 1SFOC 2JH3A 4C3IC 1KQ4A 3QX3A 1TWFK 1J98A 1JQWA 2R92K 2A69A 3OREA 2VUMK 4KN4A 1IE0A 2JA5A 4C3JK 4A3GK 3TFIA 1O24A 2PA8L
chains in the Genus database with same CATH topology
1XXBA 1XXCA 4J3NA 1TWCA 3H0GA 1WIHA 1O24A 2JA6A 4GTBA 4KARA 2R92A 4KATA 4DDQA 4GTCA 1O29A 4ILDA 1B4AA 4KC6A 3CQZA 5CJ9A 4C3HC 2GSUA 2RGRA 5JFEA 3N3YA 2XCQA 4P5AA 3GTGA 4BLBA 1O27A 4KB2A 3LPXA 4FZBA 3AQOA 5JVOA 2B63A 1TWGA 4FM9A 1WCMA 4G0WA 3GTKA 1ISEA 3GTQA 3GTPA 1DD5A 4GTEA 5EGHA 4C2MC 4KB4A 1TWAA 1EH1A 4GTDA 5CHPA 3L4KA 2XCOA 4LR2A 1O25A 1WQGA 4BLAA 3VA7A 1WQHA 1EK8A 4KASA 4G0VA 3G4AA 3AH5A 3Q3QA 4G0UA 3GTJA 1I3QA 1AB4A 3V4GA 2GSOA 1Y1VA 3AQPA 3L4JA 2Y3PA 2E2HA 2R7ZA 1O28A 1B4BA 2ZFZA 5IOSA 2PHCB 1F9NA 2P5MA 3S0XA 1O26A 4C3JC 3LAPA 3GTMA 3NUHA 1SFOA 3FHZA 4GTFA 3N0CA 4KMHA 2R93A 2NVXA 3CAGA 3GTOA 4KM9A 4KDDA 4P5BA 1IS1A 1BGWA 3G4CA 2XCRB 4GFQA 2CFAA 3MMLB 4LQYA 1ZVUA 2KWAA 3OPFA 2JA7A 1TWHA 3FOEA 3FOFA 3FKIA 2NVYA 2YU9A 1R9TA 2CFAB 5IORA 1XXAA 3GTLA 4KAWX 5IOTA 4GT9A 4GTAA 1I50A 5IOQA 3BUEA 1WQFA 4GTLA 1K83A 1O2BA 1TWFA 4BKWA 1Y1WA 1GE9A 2GSNA 2VUMA 3OEPA 3LAJA 1BJTA 4KMAA 1O2AA 3ERED 2JH3A 4KMDA 4C3IC 1KQ4A 3QX3A 3OREA 4KM8A 5EGEA 5TJ3A 4M1XA 2E2IA 3N0BA 1ZBSA 2JA5A 1ZXOA 2RH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTF A;  3N0C A;  4GTL A;  5IOT A;  1O2B A;  4GTD A;  5CHP A;  4GTB A;  4KAR A;  1O25 A;  4KAT A;  4P5B A;  1O2A A;  4GTC A;  3G4C A;  1O29 A;  2CFA A;  5IOQ A;  4KAS A;  1KQ4 A;  5JFE A;  3N3Y A;  3G4A A;  4P5A A;  3AH5 A;  1O27 A;  4FZB A;  3N0B A;  2CFA B;  5IOR A;  1O28 A;  5IOS A;  1O24 A;  4GT9 A;  4GTA A;  4GTE A;  1O26 A; 
#chains in the Genus database with same CATH topology
 3S1M C;  1XXC A;  2FQO A;  3S1N K;  1TWC A;  1PJ7 A;  4A3K K;  3GTK K;  3A8I A;  4GTB A;  1I3Q C;  2E2H C;  4QIW L;  5IYD C;  3RZO C;  1DCP A;  3S1R C;  2Y0S L;  1BS2 A;  3CQZ A;  3H0G K;  4BBS C;  4P5A A;  2R93 C;  2JA8 C;  4KB2 A;  4Y52 C;  2V6S A;  2GAG C;  3AQO A;  3LPX A;  5JVO A;  4FM9 A;  4YFK A;  5FJ8 K;  1ISE A;  3S14 C;  3GTQ A;  4GTE A;  1J6V A;  4XCH A;  4AH6 A;  4WIL A;  5HL8 A;  3DXJ A;  4GTD A;  5CHP A;  3S16 C;  3M4O K;  2XCO A;  1WCM K;  4A3F C;  1DCH A;  1EI6 A;  1WQG A;  1WQH A;  1EK8 A;  1BDF A;  4LLG A;  1TWF C;  2R92 C;  2VUM C;  2GSO A;  1Y1V A;  3AQP A;  2Y3P A;  1B4B A;  1O26 A;  4C3J C;  3LAP A;  3GTM A;  3NUH A;  4A3G C;  3SZZ A;  2NVY K;  3HKZ L;  2NVX A;  3S1N C;  3CAG A;  3GTO A;  1WOS A;  1YCL A;  3K7A K;  4A3K C;  3GTK C;  2XCR B;  2CFA A;  3AD8 C;  3A8J A;  2KWA A;  4C3I K;  3OPF A;  2PMZ L;  3HOU K;  1TWH A;  3M3Y K;  3H0G C;  4A3J K;  4Y7N K;  3FKI A;  1F93 A;  3I4N K;  1J6W A;  3PO3 K;  1R9T A;  2CFA B;  5IOR A;  5C4J K;  2O5I A;  2JA7 K;  1WQF A;  4LJZ A;  3TFJ A;  4GTL A;  5IP7 K;  2YU9 K;  2JA5 K;  1PJ6 A;  3OEP A;  5M5W K;  4KMA A;  3M4O C;  3GTL K;  4A3I K;  5M3M K;  1Y1W K;  4BY7 K;  4KM8 A;  4P9S A;  5EGE A;  4QIW D;  1UV7 A;  2E2I A;  2Y0S D;  1F7U A;  1ZXO A;  3TFH A;  2WB1 D;  2NVQ K;  3S2H K;  4A3M K;  1WIH A;  2BE5 A;  4A3D K;  2NVY C;  1IW7 A;  1YNN A;  1SMY A;  5C3E K;  4JK1 A;  4GTC A;  3T00 A;  2D6F C;  1WOR A;  3K7A C;  1HQM A;  4KC6 A;  3GIR A;  4KMU A;  1L0W A;  3H3V D;  3HOU C;  3GTG A;  3M3Y C;  4A3J C;  4Y7N C;  2B63 A;  4BY1 K;  1TWG A;  3BP8 C;  3AD9 C;  4BXX K;  3I4N C;  3PO3 C;  3GTP A;  5EGH A;  5C4J C;  4MEX A;  2JA7 C;  4GZY A;  1HI9 A;  4A93 K;  1Y1V K;  1XPP A;  4LR2 A;  5IP7 C;  3HOX K;  2YU9 C;  1O25 A;  2JA5 C;  4ZH4 A;  2A6H A;  1YX2 A;  3VA7 A;  3GTL C;  2NVX K;  4A3I C;  1WSV A;  1F7V A;  1Y1W C;  4BY7 C;  1I3Q A;  4MQ9 A;  2E2H A;  1O28 A;  2A6E A;  1EQR A;  5IOS A;  3GEE A;  2PHC B;  1F9N A;  1TWH K;  2W7V A;  2NVQ C;  1XZQ A;  4KMH A;  3GTJ K;  2R93 A;  3S2H C;  4A3M C;  2R7Z K;  3S2D K;  4A3D C;  4P5B A;  5C4X K;  4GFQ A;  5C3E C;  3HOZ K;  3MML B;  4LQY A;  4C3H K;  1XZQ B;  1G51 A;  2WAQ D;  5IYC K;  2NVT K;  4XLN A;  3FOE A;  5IP9 K;  4C2M K;  4BY1 C;  4KAW X;  3BP3 A;  4GTA A;  4BXX C;  1I50 A;  4OIO A;  2PPB A;  1O2B A;  1TWF A;  4BKW A;  4A93 C;  1GE9 A;  1IBA A;  4MEY A;  2VUM A;  1Y1V C;  3IPJ A;  3JST A;  4AYB D;  5M5Y K;  1O2A A;  4YFN A;  3HOX C;  3GSI A;  2FQT A;  4OIP A;  1K83 K;  1JOE A;  2NVX C;  5TJ3 A;  4M1X A;  4G7Z A;  4A3C K;  2V6U A;  1VGX A;  4LK0 A;  1XXB A;  3HOV K;  1TWH C;  3H0G A;  2B63 K;  2JA6 A;  4WJ4 A;  3GTJ C;  3SZY A;  4KAR A;  2R7Z C;  2PA8 D;  3S2D C;  5C4X C;  5TMF A;  1B4A A;  1JVI A;  1TWC K;  5CJ9 A;  4C3H C;  2CW0 A;  3HOZ C;  2GSU A;  5JFE A;  5FLM K;  5IYC C;  2NVT C;  4FZB A;  5IP9 C;  1WCM A;  3CQZ K;  1X31 C;  1PJ5 A;  4C2M C;  1I6V A;  4WJ3 M;  1TWA A;  1EH1 A;  2P8T A;  4A3E K;  4A3B C;  2ZUF A;  4YG2 A;  3GTQ K;  1VRQ C;  4O2D A;  4BLA A;  5M5X K;  1I6H K;  1VLO A;  3GEH A;  4KAS A;  4Q4Z A;  3HXA A;  1K83 C;  3AH5 A;  3Q3Q A;  3S17 K;  3RZD K;  2ZFZ A;  4QJV A;  2O5J A;  4A3C C;  2P5M A;  4OIR A;  1SFO A;  3FHZ A;  3N0C A;  4LK1 A;  3HOV C;  4KM9 A;  2B63 C;  4KDD A;  4QJV B;  1BGW A;  1I50 K;  3G4C A;  3GTM K;  1ZVU A;  2JA7 A;  3HKZ D;  4KN7 A;  4XSX A;  1TWC C;  3GTO K;  3PO2 C;  4A3L K;  3T02 A;  2YU9 A;  5FLM C;  4XLP A;  2V6T A;  4OIN A;  1XXA A;  3GTL A;  1C0A A;  2PMZ D;  3CQZ C;  4X6A K;  3FKI K;  1Y1W A;  3S1Q K;  3HOY K;  1R9T K;  5D4D A;  3LAJ A;  1V5V A;  1IQ0 A;  3ERE D;  4A3E C;  4PAA A;  3GTQ C;  4KMD A;  2WB1 L;  2JA6 K;  1ZQ1 C;  3S15 K;  1I6H C;  1YNJ A;  3N0B A;  3S17 C;  1ZBS A;  3RZD C;  2A68 A;  4YFX A;  4J3N A;  2E2J K;  4Q5S A;  5L46 A;  1WOP A;  2E2I K;  3H3V L;  4A3B K;  2R92 A;  1IL2 A;  4KAT A;  1ZYR A;  4DDQ A;  3GEI A;  1O29 A;  1I50 C;  1TWA K;  4ILD A;  5C44 K;  4RMF A;  3GTM C;  2RGR A;  3N3Y A;  2XCQ A;  2RH6 A;  4BLB A;  1INN A;  1O27 A;  3EQL A;  4BBR K;  3GTO C;  3I4M K;  2EBB A;  2ZUE A;  4A3L C;  3GDZ A;  4G0W A;  4C45 A;  3GTK A;  1DD5 A;  4G7O A;  5TMC A;  3GTG K;  4KB4 A;  5IYB K;  1WSR A;  4X6A C;  1XZP A;  1TWG K;  3L4K A;  3FKI C;  3AD7 C;  3S1Q C;  1USO A;  1R9T C;  3GTP K;  4G7H A;  1EFW A;  3WOD A;  1SFO K;  3HOW K;  3HOY C;  4XSZ A;  3TTG A;  4NOI A;  5E68 A;  4G0V A;  1XZP B;  2JA6 C;  3G4A A;  4G0U A;  3GTJ A;  3S15 C;  1AB4 A;  3V4G A;  3L4J A;  2R7Z A;  3PO2 K;  5M3F K;  3S1M K;  1VH2 A;  3S0X A;  4GTF A;  3ADA C;  2E2J C;  1I3Q K;  2WAQ L;  2E2H K;  3RZO K;  5IYD K;  1WCM C;  3S1R K;  1IS1 A;  2E2I C;  1VJE A;  4BBS K;  4LOW A;  2R93 K;  1TWA C;  5C44 C;  2JA8 K;  4Y52 K;  3T01 A;  3FOF A;  2NVY A;  1RU0 A;  4PAB A;  3S14 K;  4BBR C;  3I4M C;  1WOO A;  2GAH C;  4AYB L;  4OIQ A;  5IOT A;  4GT9 A;  5IOQ A;  3BUE A;  3S16 K;  1K83 A;  4A3F K;  3GTG C;  1USM A;  5IYB C;  2GSN A;  3A8K A;  1BJT A;  1DCO A;  1TWG C;  1J6X A;  1O2F B;  3GTP C;  3HOW C;  1SFO C;  2JH3 A;  4C3I C;  1KQ4 A;  3QX3 A;  1TWF K;  1J98 A;  1JQW A;  2R92 K;  2A69 A;  3ORE A;  2VUM K;  4KN4 A;  1IE0 A;  2JA5 A;  4C3J K;  4A3G K;  3TFI A;  1O24 A;  2PA8 L; 
#chains in the Genus database with same CATH homology
 1XXB A;  1XXC A;  4J3N A;  1TWC A;  3H0G A;  1WIH A;  1O24 A;  2JA6 A;  4GTB A;  4KAR A;  2R92 A;  4KAT A;  4DDQ A;  4GTC A;  1O29 A;  4ILD A;  1B4A A;  4KC6 A;  3CQZ A;  5CJ9 A;  4C3H C;  2GSU A;  2RGR A;  5JFE A;  3N3Y A;  2XCQ A;  4P5A A;  3GTG A;  4BLB A;  1O27 A;  4KB2 A;  3LPX A;  4FZB A;  3AQO A;  5JVO A;  2B63 A;  1TWG A;  4FM9 A;  1WCM A;  4G0W A;  3GTK A;  1ISE A;  3GTQ A;  3GTP A;  1DD5 A;  4GTE A;  5EGH A;  4C2M C;  4KB4 A;  1TWA A;  1EH1 A;  4GTD A;  5CHP A;  3L4K A;  2XCO A;  4LR2 A;  1O25 A;  1WQG A;  4BLA A;  3VA7 A;  1WQH A;  1EK8 A;  4KAS A;  4G0V A;  3G4A A;  3AH5 A;  3Q3Q A;  4G0U A;  3GTJ A;  1I3Q A;  1AB4 A;  3V4G A;  2GSO A;  1Y1V A;  3AQP A;  3L4J A;  2Y3P A;  2E2H A;  2R7Z A;  1O28 A;  1B4B A;  2ZFZ A;  5IOS A;  2PHC B;  1F9N A;  2P5M A;  3S0X A;  1O26 A;  4C3J C;  3LAP A;  3GTM A;  3NUH A;  1SFO A;  3FHZ A;  4GTF A;  3N0C A;  4KMH A;  2R93 A;  2NVX A;  3CAG A;  3GTO A;  4KM9 A;  4KDD A;  4P5B A;  1IS1 A;  1BGW A;  3G4C A;  2XCR B;  4GFQ A;  2CFA A;  3MML B;  4LQY A;  1ZVU A;  2KWA A;  3OPF A;  2JA7 A;  1TWH A;  3FOE A;  3FOF A;  3FKI A;  2NVY A;  2YU9 A;  1R9T A;  2CFA B;  5IOR A;  1XXA A;  3GTL A;  4KAW X;  5IOT A;  4GT9 A;  4GTA A;  1I50 A;  5IOQ A;  3BUE A;  1WQF A;  4GTL A;  1K83 A;  1O2B A;  1TWF A;  4BKW A;  1Y1W A;  1GE9 A;  2GSN A;  2VUM A;  3OEP A;  3LAJ A;  1BJT A;  4KMA A;  1O2A A;  3ERE D;  2JH3 A;  4KMD A;  4C3I C;  1KQ4 A;  3QX3 A;  3ORE A;  4KM8 A;  5EGE A;  5TJ3 A;  4M1X A;  2E2I A;  3N0B A;  1ZBS A;  2JA5 A;  1ZXO A;  2RH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...