1B4AA

Structure of the arginine repressor from bacillus stearothermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
GQRHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYKYSLPSDQRFNPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the arginine repressor from Bacillus stearothermophilus.
pubmed doi rcsb
molecule tags Repressor
molecule keywords ARGININE REPRESSOR
total genus 38
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1b4aA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1b4aA02
3BOQA 4HX7A 2EFOA 2FBIA 1ZGJA 1BC8C 5L3CA 3TO7A 5ILUA 3MFKA 1BIAA 5JHUA 2RV8A 4KIFA 2K86A 1LNWA 3DXJF 5TRDA 3LFKA 1LEBA 2A69F 1ZG5A 4KNYA 1MDMB 4KMFA 4RB1A 3K1NA 1LJ9A 1GXPA 1Z7UA 1JHFA 2KIMA 4OIOF 1LVAA 4A12A 4U7DA 1ULYA 1U5TA 3N97A 4I0AA 2STWA 2JRTA 4WXHA 5K5OA 2F5EA 1R1UA 1GVJA 1QNTA 1IZ1A 3P9CA 1ZARA 1I27A 3MZHA 3F8CA 3FXRA 2JSCA 2D45A 1EH6A 1U5TB 3HSRA 3WTYC 2KIFA 3BY6A 3CUQB 1YTYA 2NYXA 5ICGA 1FX7A 1SFEA 1AOYA 1ZREA 5A2QK 1O3SA 3TGNA 2FE3A 3E6MA 3H92A 1KYZA 4HOBA 1Z6RA 1B4AA 3HHGA 2O61A 1ISEA 4AIJA 2NNNA 1PP7U 5DD8A 2QLZA 2V1UA 3VFZA 4CHUA 2PI0A 1WQ2A 4G7OF 2ESHA 2EFPA 2PG4A 2VOPA 3MQ0A 3GFMA 3KLNA 4HBLA 2FSWA 1BJAA 5E8GA 3FZVA 5D5WB 4WXDA 3T8TA 3JSPA 5D5XB 2Z5UA 3SFZA 5E1WA 2YX7A 4BH9A 3OPFA 4A5MA 2QVOA 2QQAA 4M74A 4Q48A 3GWZA 1WIHA 3DQVC 1D3YA 1ONVA 3KZZA 5E18F 1SD4A 4RB3C 2XASA 5D5UB 5DUIA 3I0TA 2CFXA 4BHPA 2M8EA 4AVPA 1B1BA 2VE9A 3KP5A 4HLYA 2P7VB 4R79A 3TOAA 4WK8F 2ZMEA 2PFBA 2LDUA 4HDVA 2XAQA 2MBFA 3GX4X 3E5QA 2FMYA 2O0YA 1MKMA 2CGPA 3E6CC 1B9MA 4AIKA 3G73A 2UZKA 5LHGA 1Y0UA 3WU0A 4M9SA 4WWCA 2M30A 2XCQA 1ZGAA 1TQMA 5LGTA 3R0AA 3WE2A 1YW9A 1I5ZA 1XXBA 4G0WA 1FY7A 1TNSA 5AONA 1HW5A 3CO7C 5D6FA 3J81Z 4IRHA 2DK5A 2IW5A 2V6CA 1OYWA 2ZCWA 1EK8A 4QLCU 1J5YA 3MCZA 1BM9A 2VXZA 5AIPA 4WX9A 2BBYA 5IT3A 1OMIA 2VE8A 4AWXB 2PMUA 4CDGA 3FHZA 4Y17A 4LG0A 4MEYF 1R23A 1A04A 1K7AA 3RYPA 3S2WA 4EJVA 2WTEA 4I01A 4AIHA 3IKTA 2H94A 1STZA 2OU2A 5ERIA 4P5OA 4CZZA 4U7BA 4I0BA 1BI3A 4ENNA 5JR3A 5CVVA 5ED4A 1IXCA 3F6OA 4KUMA 2WV0A 1T2KA 1BC7C 4ESJA 4Y13A 2XVCA 2QENA 2GXGA 1W4MA 3HRMA 2PQ8A 1ZRFA 1IN4A 4B09A 4GYIA 2ZO4A 4Z2YA 4GXOA 2GA1A 2MC3A 5E1XA 3HTSB 2ZMEB 2OAZA 2ZBKA 2DT5A 1Z91A 3F23A 2QM3A 2XIGA 2LF8A 5H6RA 2OD5A 1SAXA 1O3RA 3C7JA 4UV8A 4M72A 1O7FA 1TBXA 2DO7A 5J6XA 4O3MA 5E8IA 2V1DA 3DPLC 4RAZA 1L0OC 1XCBA 4HV6A 2DI3A 3TDZC 1JGSA 3KP7A 3LSTA 5AIQA 2JPBA 1C0WA 1G3WA 2RQPA 1I1SA 3MMLB 4ENJA 3FXUA 4EMSA 2DBBA 4FX4A 1J75A 4EM0B 3BP8A 4CYDA 1FZPB 4NQWA 4HDUA 1NHAA 1L3LA 1YW7A 1IRFA 3BUEA 3J80K 1KU2A 2L4MA 3RKWA 3HOTA 3GYHX 2QUFA 5HVQC 1MGTA 4G94A 3FF5A 5HDGA 4BAYA 1WSUA 4IF4A 2PN6A 4UV9A 5KK1A 5BQTA 4LLNA 3HHHA 5JVTA 2IRFG 2P5MA 2HTSA 1XSXA 4OIRF 1WI9A 1ZLJA 1ZG1A 3RIRA 1XMAA 2HZTA 2BE5F 3BJOA 1IRGA 3HOSA 1RZ4A 1FSHA 3KP4A 1CGPA 4RGUA 2G9WA 5HOOA 1KQ8A 1S8NA 2EK5A 1Z6TA 2HYFA 3ZP5A 3H3ZA 4PZJA 4CXFA 2O03A 4HYEA 3F6VA 1FPQA 3E97A 4OMZA 2IVMA 3MEXA 4XRFA 2O6GE 3M8FA 4HF1A 4ESBA 4ZYEA 2RDPA 4UXNA 1JXSA 1ODDA 3HRUA 1BN5A 1SMYF 4XLNF 4ESFA 2F5DA 4N0BA 3L2CA 2MH9A 2E1NA 2RC4A 1ZG3A 1IUYA 4LK1F 5DUKA 1AWCA 4U88A 2HR3A 2H09A 3K0LA 3TQNA 2QBYB 1O7LA 3CJNA 4XBFA 3ISPA 1SD7A 3B73A 3V7CA 4QWQA 1IN6A 1RI7A 3SZTA 3BPVA 5E1ZB 3GF2A 4R1HA 1FNNA 2V9VA 4HF0A 4EGYA 2EWNA 4IJAA 2Q8KA 1LQ1A 3CTAA 4BHCA 2D1HA 1IN5A 5FLXK 3F8FA 3J80Z 2K27A 3WGIA 2FA5A 2WWYA 1T6SA 2CSOA 3ZMZA 1MJBA 3O2PE 1MZBA 5IT9K 2GQQA 1XGSA 2DLLA 4I09A 3EDPA 2FMLA 1Z05A 2RN7A 2KJBA 2W57A 3C1DA 3QPTA 1YFHA 4ZYDA 4J3NA 1W5SA 1QZYA 2M45A 4BQAA 1YLFA 3LQQA 3TDUC 4YFXF 5E17F 1H9TA 4CGZA 3RKYA 2PMHA 5D8LB 2XCOA 4KT5C 2K4JA 3DFGA 4EJTA 4N9HA 3IHUA 1DPUA 3V7RA 1KU3A 2HKXA 5EEHA 4MHGA 4XSXF 1TLHB 3VOEA 1WQFA 1B6AA 4L0YB 4JK1X 4RS8A 2HTJA 4G6QA 5ILVA 1OYYA 4UUVA 1BGWA 5D4RA 4FM9A 4L9TA 3ABUA 4PGHA 1FC3A 4GO1A 2WC2A 3ULQB 2DTRA 3WTUC 1RUOA 1PUEE 1ZYRF 1ZLKA 3IKVA 1W7PA 2ETHA 2KJCA 2XKOA 3I71A 1P4XA 3EYYA 4G9YA 3LAPA 1EH8A 4MGRA 2Z99A 4JBAA 3FMRA 4B8XA 3GZ5A 2VBXA 5LGNA 4N9IA 3ZPLA 4L0ZB 3QAHA 4XSZF 4GCVA 1MJ9A 3O3KA 5CLSA 3ZMTA 3M8EA 4HZFA 2P7CB 3LWFA 1XXAA 3F8NA 1FBUA 3I54A 2H6BA 3VA7A 2IA1A 3BDDA 4S04A 3WODF 4GGGA 3GFIA 3LA2A 2R3SA 4G0UA 2CO5A 3E6BA 2RKHA 1S7OA 3FMQA 5CVUA 5L3DA 1IXSB 1OYIA 2PBIA 2VODA 1KU7A 2OZUA 3EQLF 2YSRA 2ISYA 2VT2A 1B59A 2HQNA 1TNTA 5A2QZ 3CO6C 2C6YA 1E17A 5L3EA 1S3JA 4RGRA 4EJUA 4MEXF 3K9TA 3NRVA 4A0YA 1W7PB 4LK0F 3JTGA 4FX0A 2DFIA 2FF4A 2DK8A 4Q4ZF 2Y0MA 4I98B 1FYKA 2EV6A 4KN7X 3B02A 2W84A 1K6OA 3OOPA 2ZNZA 3WG9A 1FOKA 1EH7A 1FSEA 2HFHA 3COAC 1DDNA 1HQCA 4DQ2A 3J7AO 1YS7A 3HRTA 3VB2A 1I6XA 1T38A 3FM5A 1IAWA 2NS0A 1P92A 3KP2A 4U0VA 3TKYA 2MH2A 3OEPA 5D4SA 4GFQA 2HKOA 3CLOA 4F7ZA 2YX4A 2QZ8A 2Z9OA 2OZ6A 1ZRDA 2D2WA 4IHTA 1WWXA 3LA7A 1QZZA 1F4KA 2RNJA 3Q5FA 1BI1A 3U1DA 2XRNA 1X3UA 2M1BA 1D8KA 3IC7A 1BJTA 1OKRA 4Y15A 1KQ0A 5BS6A 1FWZA 4KIGA 2BYVE 2FEZA 4KB4A 3T5XA 4ZH4F 1B9NA 3GVAA 2MLGA 4FT8A 4EJWA 2JT1A 1G3YA 2CW0F 4A6DA 4OINF 1R5GA 4YFNF 1OPCA 3MWMA 4Q47A 1HSJA 3F8BA 2BGCA 3Q9SA 1ZVUA 3DP7A 2H27A 4P55A 2TDXA 3IL2A 4CO8A 3HTUA 3KP6A 2KRFA 3KE2A 5FB2A 3GFJA 2P8TA 1RUNA 2L01A 1HXDA 3C3WA 5LRSA 5CJ9A 3FMSA 4TV7A 4ENMA 3GFLA 1J9IA 3DEUA 5LGUA 4ETSA 2GAUA 2LSOA 2GWRA 1LDJA 4HA8A 1F9NA 3L4KA 4L9VA 2E7XA 3WE3A 2IA0A 1GE9A 5DEQA 4LGWA 5CVRA 3ZMUA 1H0MA 5BOXA 3SZPA 1FLIA 2MLKA 4P9UA 3WTWC 4G7HF 3OV8A 5TJJA 4IHSA 3QU6A 1G3SA 3E3VA 2F5CA 2HOEA 3HYIA 5LLQA 2KWAA 1AB4A 5FFXA 4DDQA 3L4JA 4UNOA 2A07F 1W5TA 4I2OA 2EJRA 3ECHA 1RIOH 5E20A 3M9AA 4EM1A 5LRRA 3IWFA 1IXRC 3SQNA 3WTVC 2FOKA 3D0SA 5DCMA 3RYRA 4OOIA 2A68F 2ZFZA 2OBPA 1KQ9A 2EFNA 4KIBA 3WTZA 2DW4A 2FU4A 4IRIA 3ZMSA 1QGPA 3BZ6A 5LHIA 3GUDA 1KGSA 1LDKB 3P7NA 3VEPA 2O3FA 4CICA 1XSDA 3P9KA 1HBXG 3G3ZA 1XD7A 5BPIA 4KDDA 5D5VB 2LNBA 1HKQA 3T1BA 4EJOA 4ENKA 2A5YB 3WTXC 4ASNA 4KFCA 2FQ3A 4H0EA 1TQIA 2KKOA 5LHHA 4LJZF 3U9GA 1XGOA 1P2FA 2O8XA 2P5LC 1IW7F 2VBZA 2BV6A 2L54A 1MD0A 3EETA 2XV4S 4A5NA 2DAOA 5J8CA 2J5PA 3SXYA 3QPHA 4BXUA 1USTA 2IJLA 3M7GA 2RGRA 1J2XA 5FGMA 5HLIA 2G7UA 1SD5A 2YPRA 2VC1A 2XAJA 2XAFA 2LF7A 2Z33A 1FBQA 4BHBA 2PHCB 5EEGA 1XXCA 2HGCA 3R6SA 2F5FA 1BI0A 3K2ZA 1ON1A 5DCFA 2XCRB 1WQHA 1UHMA 3F72A 1ZH5A 3ECOA 1FP1D 2HYGD 4RGSA 3GZ6A 3WU1B 1YIOA 5HS9A 3ZMVA 2OA4A 2W24A 3F8MA 1P4AA 1FP2A 5DD4A 3WTTC 3T8RA 4FHTA 2RVCA 3WGHA 2K02A 2P6TA 1SD6A 4PCQA 3LAJA 4IPAA 1O3QA 1Z1DA 5ICFA 4A0XA 1K79A 3CAGA 4LMYA 1YW8A 1GHCA 5BPDA 2QYOA 2VN2A 5LBQA 5HDKA 4K2EA 4BNCA 4EVIA 2QQBA 1F5TA 2P4WA 2JTVA 3N4MA 4KB2A 3M1EA 3HSFA 5CVIA 2FBKA 1R22A 2ZJ2A 5JFRA 3TO9A 1J59A 1KYWA 2VBYA 1U3EM 2X0LA 1ZAOA 2CWEA 4YFKF 1T0FA 3FWEA 3EUHA 4UVBA 4A2UA 2LKPA 1XCVA 3TO6A 5K1YA 3RI4A 4YIFA 3GEZA 4EM2A 3CDHA 2EFWA 5JI6A 4Q5SF 3H3UA 4IVNA 2ADUA 1JHHA 2JPCA 2ELHA 1GXQA 5ICCA 1S29A 2AS5F 3RPQA 2A3SA 2VBWA 3RPUA 1YG2A 4OIPF 3LQRA 3L00A 2VOOA 2FBHA 4YG2F 2ISZA 2K7LA 3FOEA 3ABTA 4WF2A 2W85A 3GW2A 2FNPA 1V3FA 2M87A 3JAMZ 3MZYA 4L9NA 1TW2A 3RKXA 2GZWA 5DYMA 1HKSA 1J7KA 5FLXZ 2QBYA 2EA4A 2XKPA 4ZYHA 3I4PA 4EQQA 3ZMDA 1J0RA 5K5RA 2RGVA 1KA8A 1BI2A 1E2XA 3HUGA 2M5WA 5BMZA 1EH1A 1IF1A 1G6NA 3BWGA 1PDNC 2QQ9A 1HSTA 5HLHA 4KAWX 3CUOA 2L02A 4NB5A 3QRFF 4KICA 3C18A 2J5OA 3F3XA 4M9XA 3PFIA 5FD5A 3KZYA 1XB4A 2QWWA 3NQOA 4UVCA 5CVJA 3E6DA 1YQAA 3I5UA 3JSOA 4HQEA 4A6EA 2UXNA 3ZQ7A 3K1MA 1LB2A 2KIUA 2EV0A 1YS6A 3KEOA 5LEJA 3RDIA 2NNYA 2FXAA 1IN7A 4NHJA 3PQKA 3ZN0A 1G4DA 4HQMA 5HS8A 4OIQF 2CYYA 2VONA 3KFWX 1BBYA 3P9IA 1O3TA 3Q9VA 3V8LA 4ZZLA 3V4GA 4L5IA 4ON0A 3FX3A 2Y3PA 5L3FA 1V4RA 1IN8A 2V79A 1TQPA 3DF8A 2K4BA 4HX4A 4HF2A 3GLXA 3NUHA 2DPDA 4EV0A 3V7SA 1P6RA 4OU0A 3IWZA 1WRJA 1RNLA 4M9ZA 3ML6A 1UHWA 3I58A 4LB6B 5IT9Z 3R0JA 3ELKA 1O57A 1U6GA 1KU9A 1G3TA 1PP8F 1XSVA 4KN4X 2GIVA 3MAJA 3PQJA 5F64A 1BOAA 3ERED 2ZXJA 1D5VA 2R7DA 2DQRA 3DV8A 2GA2A 5FO5A 2PEXA 4IRGA 2OQGA 1S7AA 3GO5A 4A0ZA 2Y75A 5D6EA 4G7ZF 1B4BA 3BPXA 2Q0OA 5HDNA 4L9JA 6PAXA 2YR2A 4HV5A 3DPTA 1R36A 1IS1A 2COMA 1F1ZA 2VC0A 2HS5A 3E5UA 1VTNC 1YYVA 4AD9A 1QPMA 4DNCA 3HIFA 1K78B 2E1CA 4P96A 3E5XA 4GYGA 4UVAA 1FYLA 2ZFWA 3KLOA 3V8JA 3WGGA 4LD5A 4PDKA 1XGNA 4UHTA 2L3DA 3JAMK 4M71A 4M6XA 4G0VA 5CYVA 4HAMA 4I02A 3HSEA 2D1VA 1XGMA 2P6SA 1R00A 2ESNA 5F6FA 4MTDA 2A6EF 2DU9A 5HS7A 3J81K 2UXXA 3NEUA 5DCMB 1R58A 4KA4A 1HKTA 2STTA 3AAFA 4MTEA 1XN7A 1MDMA 4EGZA 1FYMA 5H20A 1DD5A 2XAGA 2PLYA 4ZZDA 1MJAA 5ICEA 1OR7A 2ZNYA 4MNUA 5H6QA 3F22A 3TOBA 1YO5C 3QOPA 1SFXA 1T39A 1QBJA 2HEOA 1UCRA 2IPQX 4D0PA 1HW1A 4LG0B 3KEQA 1S6LA 1TTYA 2W25A 2A61A 4JQFA 1DPRA 1Z9CA 3FOFA 1P4WA 1XDSA 2XHKA 1LDDA 3GXOA 4O5VA 2V1XA 4U0YA 3I53A 1JE8A 4KC6A 4G6DA 4HW0A 2UWMA 3HRSA 3O6BB 3VODA 2OQRA 5F1RA 4KMUX 3KETA 4LLGF 4U0WA 3QP5A 4PGGA 3OREA 5ILSA 1XDUA 1U2WA 2B0LA 3CUQA 1WQGA 4R8HA 1LEAA 3L7WA 2NAZA 3LA3A 4WCGA 3T0YA 1U5TC 4MQ9F 3RJPA 4MQVA 2P5VA 5D8KB 5K5QA 2YU3A 3R60A 3IRQA 1ZRCA 2JZYA 5KVRA 2PJPA 3QX3A 5DDGA 1FT9A 4HX8A 1HW2A 3CUQC 4M73A 3ZN1A 1ZN2A 3L9FA 1XMKA 1R5HA 2ACJA 4M6YA 5L3BA 3R61A 3ROUA 4O6JA 2Q2EA 2F2EA 2BEOA 1FBSA 4G8XA 1UB9A 4RB2C 2Z3YA 2EV5A 1USSA 2XGXA 3BJAA 5LEKA 4E70A 1I1GA 4WXCA 2XUBA 3KCCA 4LB5A 3LPXA 1REPC 3QP6A 3JW4A 4L5JA 3W6KB 1CF7A 3EYIA 4RAYA 2ZKZA 4S05A 3F21A 4L18B 3FM3A 2L4AA 1SFUA 2DQLA 2IP2A 5DV5A 4IXAA 2EB7A 3REOA 5J8FA 2MA3A 3K1PA 2GXBA 1QO0D 3BJ6A 2G7HA 4BYYA 4KYWA 1CF7B 5FD6A 1UFMA 5HLGA 2AXLA 3IRRA 3QU3A 1TW3A 1U78A 1BIBA 2IA2A 4P9FA 4LLLA 3SHFA 2FNAA 1WKMA 3I64A 2FRHA 2XAHA 4RGXA 4I7HA 1R1TA 2CQKA 5JVOA 3DKWA 4OMYA 1ZHFA 1EV7A 2VT3A 3BROA 3L09A 3RTRA 3D5LA 4KDPA 1QQIA 2Y48A 2H6CA 1K78A 1D8JA 2DPUA 2IT0A 3U2RA 4RB0A 2HDCA 3WTSC 3FXQA 4ZYGA 2R7FA 2HWVA 4XLPF 2EA2A 2E7WA 3I59A 5FFZA 3JTHA 2HQRA 2A6HF 1H9GA 3K69A 3W6JB 2CG4A 4HLXA 1T98A 2MD5A 2P5KA 4LFUA 1DP7P 1DUXC 1W7PD 3I59B 3V8KA 1R1VA 2EFQA 2XROA 1U8RA 4YIIA 3KP3A 1SMTA 1ON2A 1Q1HA 3R4KA 2NRAC 2X4HA 1R7JA 5L3GA
chains in the Genus database with same CATH superfamily
5EGEA 4E6KG 3GTPK 3BOQA 4HX7A 1K83J 2CH0A 2EFOA 3S14C 2FBIA 4FCYA 1B72A 1KZHA 5E3MA 5HL8A 1JUSA 5DS9A 1TP4A 3MN2A 1ZGJA 1WHUA 1X58A 1BR4A 1BC8C 1GV5A 2DMPA 4I6ZA 5L3CA 3TO7A 4RMFA 1N78A 1R9TC 5D4DA 5ILUA 1UZCA 2PJRA 3MFKA 2JA5C 1BIAA 5JHUA 5IPAA 1O25A 3FXJA 2NVTC 2RV8A 3GTLK 2V6TA 4KIFA 2V6EA 3FKIC 2K86A 1LNWA 3DXJF 5TRDA 3SJMA 3DKXA 3LFKA 3AH5A 4KN7A 1MMGA 2A69F 3ABKH 1ZG5A 1LEBA 4I99C 4A3CJ 1RU0A 3S1RK 1MBJA 4DOZA 2R93C 1Y1VA 2BW3A 2FQ4A 1MDMB 4KNYA 3S16C 4KMFA 3G2BA 3HG9A 5M3MJ 4RB1A 3K1NA 2ICWG 1LJ9A 1F7UA 1OCCH 5DM7F 1GXPA 1Z7UA 1JHFA 2KIMA 1AU7A 2TCTA 1LVAA 4A12A 4OIOF 1ZXOA 1TWFA 3S16K 4U7DA 1OJLA 1ULYA 4BDYA 1G59A 1U5TA 3ZR8X 3JRIA 2BZTA 3N97A 4I0AA 2L9RA 2STWA 2JRTA 3NARA 4WXHA 5K5OA 4BY7C 4BL0B 2F5EA 1R1UA 3M4OC 1GVJA 1QNTA 1H89C 1IZ1A 3OYFA 2BW3B 4RA2A 3P9CA 4P1WA 1ZARA 1I27A 3L1PA 3MZHA 1OLTA 3F8CA 2EPFA 3FXRA 5F27A 3B6CA 2JSCA 2WADA 2D45A 1SC7A 2B63A 2UV1A 4KITB 1T95A 1EH6A 1U5TB 3HSRA 3WTYC 1D5YA 2KIFA 3BY6A 1MMSA 4RDUA 3CUQB 3BG5A 3GIRA 5IORA 1YTYA 2NYXA 1A36A 1SEUA 4F93B 1LFBA 3KPHA 5ICGA 1FX7A 1LUJB 1U9OA 2WB1A 1SFEA 2KRCA 1AOYA 1K61A 1R4MB 1ZREA 2DJIA 5A2QK 1O3SA 3TGNA 3SYTA 2FE3A 2JUCA 1X2MA 3E6MA 3H92A 1KYZA 4YIRX 2VI6A 1TWFK 4HOBA 2X9DA 2CS3A 5FRNA 1Z6RA 2HVSA 1B4AA 4ABZA 3HHGA 1T0FC 2ZFUA 2O61A 4UB6C 3CLQA 1ISEA 4AIJA 2NNNA 1PP7U 5DD8A 2QLZA 3H35A 3VFZA 2K40A 2V1UA 2GOMA 3G1LA 4CHUA 1I3AA 2PI0A 4JYKA 1WQ2A 3DKYA 4G7OF 2L9SA 2FX0A 5IYBJ 3ZQFA 3MKLA 1IL2A 5DM6F 4XKBA 1DU6A 2ESHA 2EFPA 1JKPC 1X31C 2PG4A 2HDDA 2VOPA 3PM1A 4G6TB 3MQ0A 3GTJK 3GFMA 3KLNA 1X1BA 3IH2A 4CYCA 2CV2A 3D1NI 5M3FK 4HBLA 1BJAA 2FSWA 3CJTB 5E8GA 3FZVA 3ZCOA 3T8TA 3HPGA 4WXDA 5D5WB 3JSPA 4GTDA 5D5XB 2Z5UA 4CA0A 3SFZA 5E1WA 2YX7A 4PABA 3LSHA 4BH9A 3OPFA 4A5MA 2QVOA 3GLLA 2QQAA 4M74A 4Q48A 1DP3A 4KMUA 2ZXHA 2ZMEC 4C2TA 3CMYA 3LSRA 2JA2A 4IEJA 4BDZA 3CCVI 1G51A 3GWZA 1WIHA 4HPQA 3DQVC 1PJRA 1B8IB 1D3YA 1ONVA 4PUSA 3KZZA 5E18F 2BY0A 1R4NB 1SD4A 4RB3C 1WJ5A 2XASA 2EBIA 4C3HK 3A8JA 2KZVA 5DUIA 5D5UB 1VQ8I 3I0TA 2CFXA 1TWHC 1IE0A 2ZC2A 1ZQ3P 4BHPA 1OCZH 2M8EA 4PFPA 1B1BA 4AVPA 1VQOI 2VE9A 3KP5A 5GP9A 4NOIA 4W1UA 4HLYA 2P7VB 4R79A 2BE5A 3TOAA 1Z3YA 2W82A 2KLOA 1MBEA 1SAUA 4WK8F 2ZMEA 5M3FJ 2PFBA 4YFNA 4OINA 2BXYA 2LDUA 4HDVA 2XAQA 2MBFA 3GX4X 2F4MB 3RQIA 3E5QA 3CMEI 1IJWC 1ZELA 2FMYA 2O0YA 5F0HA 1MKMA 2CGPA 3A0HC 2EQRA 2VB6A 3E6CC 1B9MA 1OCTC 3S1MK 2JA6J 1S72I 4AIKA 3G73A 2UZKA 1HQMA 5LHGA 1Y0UA 3VSKA 3WU0A 1A6QA 2ECBA 4M9SA 1DQUA 1VQ9I 4WWCA 2M30A 2XCQA 5C44C 2GBYA 2XGCA 2JA6C 1DGWY 1ZGAA 3CMMA 1TQMA 5LGTA 2ME6A 5GAGJ 1FMVA 4IO9F 4D1QA 3IAS2 3HOWJ 1ZBSA 2R7ZA 3R0AA 3WE2A 1YW9A 1I5ZA 1XXBA 3K7AK 4AYBA 4G0WA 2E36A 1FY7A 2MYSA 1TNSA 4S0HB 2DA2A 5AONA 4A3DJ 1HW5A 1Y8QB 3CO7C 4C3IK 2LY2A 5D6FA 5M5YJ 3J81Z 4IRHA 3UKGA 3JRHA 2DK5A 3GEEA 2IW5A 3I4MJ 3CESA 1JJ6C 1APLC 2V6CA 1OYWA 2ZCWA 1EK8A 2XAUA 2ID6A 4QLCU 3SZGA 1J5YA 1ENHA 3MCZA 3GTMC 3GTLC 4OAYA 1BM9A 2VXZA 5AIPA 4WX9A 1T08B 2BBYA 5IT3A 1OMIA 2VE8A 3VYSB 5FROA 4AWXB 2PMUA 4A3MK 3IPJA 1WPKA 4CDGA 4Y3OA 3FHZA 2Z16A 4Y17A 4LG0A 4MEYF 3ZQQA 1I3QC 4LR2A 1R23A 4D7NA 1A04A 1K7AA 3RYPA 3CD6I 3S2WA 5HNHA 4EJVA 2WTEA 2W7VA 4I01A 1NTCA 4AIHA 3IKTA 2H94A 1STZA 2OU2A 5LFAA 3HKZD 5ERIA 3C2HA 4P5OA 4CZZA 4U7BA 1ZK8A 1BI3A 4I0BA 4H4KC 5JR3A 5CVVA 1EA3A 4ENNA 5ED4A 1IXCA 3DBHB 4GZYA 1IC8A 1IGNA 3F6OA 4KUMA 3DTEA 2WV0A 4M6VA 1T2KA 2A6EA 1WCMC 1X4PA 1BC7C 4A3MJ 3S1NK 2NVXJ 4RMNA 3G71I 4ESJA 3RKQA 3GTGC 4A3BJ 4Y13A 2XVCA 2QENA 4LOWA 1VQ6I 2GXGA 3BTLA 1YX3A 4GT9A 2R7WA 1W4MA 3HRMA 4C3IC 2R5YA 2PQ8A 2QCOA 3OYLA 1VQPI 1IN4A 1ZRFA 4B09A 4GYIA 2ZO4A 3AQPA 3L2QA 2DT6A 4Z2YA 4GXOA 2MC3A 2GA1A 2OPTA 5E1XA 2LREA 4QPQA 3HTSB 4B47A 4WILA 1WH5A 2F48A 2ZMEB 3SZZA 2CRGA 2OAZA 4X6AJ 2ZBKA 2DT5A 1ETVA 3SEZA 1UHSA 3VYUB 3WHCA 1Z91A 3F23A 4J19A 2XIGA 2QM3A 3LSGA 2LF8A 5IYDJ 2E1MC 2UUZA 2K9MA 5H6RA 2Y0SD 2OD5A 4BS9A 1SAXA 1O3RA 3C7JA 3JRGA 3AG3H 4UV8A 3RQ4A 4M72A 1O7FA 4DW6A 1TBXA 2DO7A 5J6XA 1MNMC 5JFEA 1SFKA 4O3MA 1IDZA 1WH7A 2EBBA 3H0GC 2QEXI 4YRVA 5E8IA 2V1NA 4BU2A 2VKHA 2V1DA 3DPLC 4Y52K 3OYIA 2DFFA 4C3HC 4BY7K 4RAZA 2CV0A 1L0OC 1XCBA 2MC4A 2VKVA 4HV6A 2DI3A 3TDZC 3HOYJ 1JGSA 3KP7A 5EYRA 3OY9A 3HBLA 3LSTA 5AIQA 3BCBA 4Y33A 4XLAA 2JPBA 3AKZA 3FBNB 1C0WA 4FISA 1RR8C 1G3WA 2RQPA 1I1SA 3A0BC 3MMLB 1X3WB 4ENJA 3AD9C 4B48A 2LKSA 2F4IA 3FXUA 2E5NA 4EMSA 4M1XA 3DBRB 4JK1A 2DBBA 4FX4A 2JRMA 1J75A 4EM0B 1T8IA 1PUFA 4KT6A 1QA6A 1FOXA 1V5VA 3BP8A 4LJZA 3TFIA 4CYDA 1QVUA 1FZPB 3H5RA 2LLKA 4NQWA 1WOSA 4HDUA 2IAIA 4XKVA 3GTLJ 3K70C 3HKZA 3BG6A 1NHAA 1L3LA 1J6XA 2X85A 1YW7A 1FTZA 2G0EA 1IRFA 3BUEA 1CQTA 3A4CA 4QTRA 3J80K 3CQZJ 1P7IA 1KU2A 4RAFA 2O9LA 2L4MA 2R7VA 1O4XA 2E2HA 3RKWA 1VQLI 3HOTA 3TL4X 3GYHX 1J09A 3S1RC 2QUFA 5HVQC 1MGTA 4G94A 1UV7A 3GTJA 4DYRA 3FF5A 5HDGA 4BAYA 1WSUA 4IF4A 2ZUFA 4GTEA 2PN6A 3K2AA 2DDAA 2AHQA 3OYAA 4UV9A 4FETA 3CCUI 2CFOA 5KK1A 3S1QK 5EGOB 4E7HA 2IEKA 2NOJB 4BBSK 1YHQI 1J98A 4IOCF 2IGMA 3E0JB 5BQTA 3KEYA 4XOTA 4PJNA 2LBFB 4LLNA 3HHHA 3J7ZI 1UAAA 5JVTA 2IRFG 5LD2C 1BDFA 4XQFA 2W7NA 2P5MA 4X6AK 2HTSA 4XLFA 4BBSJ 1XSXA 2JA8J 4KMDA 3DU5A 4AYBD 4FE7A 5J3LA 4P5AA 3BLYA 4OIRF 1WI9A 4IHVA 4BQQA 1ZLJA 2JVHA 4A3GK 5IYCJ 3PO2K 4CSWA 1ZG1A 3RIRA 1XMAA 2HZTA 3H0GA 2BE5F 3KIOA 2VUMA 5C3EK 2HQAA 3BJOA 1I50K 4Y7NC 3CCRI 1IRGA 3CCEI 3DEEA 4ANJA 2GM4A 3HOSA 1RZ4A 1FSHA 4KM8A 5K7FA 1WI3A 3KP4A 1CGPA 4RGUA 4KATA 2G9WA 5HOOA 1KQ8A 1S8NA 4XSXA 3IH3A 2EK5A 3OS0A 1PJ5A 1Z6TA 2HYFA 4RBOA 3G4SI 3ZP5A 3H3ZA 4PZJA 4E7SA 2O03A 4CXFA 3JR9A 4QIWD 4HYEA 3F6VA 4IHYA 1FPQA 5CHPA 4UY8I 3E97A 5IP9C 2PA8D 4OMZA 2IVMA 1R9TK 2M4KA 3MEXA 1DGRM 4XRFA 2O6GE 1J6WA 1EFWA 3M8FA 3QPSA 3VSLA 1VQ5I 4AIDA 5GPCA 3QWLA 4ESBA 4ZYEA 4HF1A 2RDPA 2IGKA 3QPLA 4UXNA 2QF7A 2AQFA 1JXSA 1ODDA 3HRUA 3TBIA 1BN5A 1SMYF 4XLNF 2XF7A 3RSNA 4ESFA 2F5DA 4N0BA 2W00A 3L2CA 2MH9A 3HPHA 2E1NA 1VF9A 2RC4A 2M2EA 1WJBA 3VDXA 1ZG3A 1IUYA 4LK1F 5CPRB 3MMYB 5EZGA 5DUKA 3PO3C 4BXXC 1AWCA 4U88A 2QSHX 3HOXJ 2HR3A 2H09A 3K0LA 3TQNA 2QBYB 1LE8A 1O7LA 2O8KA 3OYMA 2QA4I 3CJNA 2XSJC 4XBFA 3BG9A 1HC8A 3ISPA 1SD7A 3B73A 4MO7A 2PJRB 3V7CA 4IHWA 4QWQA 1IN6A 1W0TA 1RI7A 3SZTA 3A01B 4Y7NK 3BPVA 3PFYA 2DA6A 1U0JA 1RR7A 5E1ZB 2PMZA 3CF2A 3GF2A 4R1HA 3ZQHA 3W2VA 2R7OA 1MSEC 1J6VA 3H9GA 3GCMA 1F7VA 3S17J 1FNNA 2V9VA 4HF0A 3JSTA 3A01A 2HDWA 4BKXA 3H36A 3M8JA 4EGYA 2EWNA 2XPUA 2Y2ZA 1O2AA 4IJAA 3DPUA 2Q8KA 4IZZA 1LQ1A 3CTAA 4BHCA 4XIDA 4LQYA 5TISC 2D1HA 5FLMJ 1IN5A 1JT0A 4BEHB 5FLXK 3F8FA 2H8RA 4YELA 3J80Z 4M3GA 4A3FK 2BXZA 4XLHA 2K27A 3TMOA 3WGIA 4JOMA 4BKWA 2FA5A 1HOMA 2WWYA 3HOUC 1T6SA 1IV6A 1ZTRA 1XZQB 2CSOA 3ZMZA 3S1QC 1MJBA 1Z67A 3O2PE 4JX5A 5M3MK 1D0YA 2RNGA 3HJEA 3SZYA 2E2HC 1MZBA 2JA6A 5IT9K 5IOSA 2GQQA 3QODA 3KYLA 2O5RA 2HYJA 1XGSA 3K4KA 1ORKA 1TWFC 2JH3A 2L7FP 3H3VK 3LOCA 4EATA 2DLLA 4I09A 4N4NB 2EH3A 2LG4A 5K7ZA 1D1CA 1SFOA 3EDPA 2FMLA 1YNNA 2LP0A 2E2JJ 1Z05A 2RN7A 2KJBA 2W57A 2JA7A 1TWHK 3C1DA 2M0MA 3QPTA 4A3EJ 3HOUJ 1YFHA 4ZYDA 1EKEA 2R5ZB 4J3NA 2R7XA 1W5SA 3E7LA 1D1AA 1QZYA 2M45A 4X6AC 5DTDA 3DWLE 4BQAA 2IS4A 1YLFA 2LYCA 3LQQA 2YU9J 3HOVK 3TDUC 4CCKA 4YFXF 5E17F 3F0CA 2JA5A 1USMA 2HXOA 1H9TA 4QJVB 1HDDC 4CGZA 1YX2A 3T02A 3RKYA 2PMHA 5D8LB 2XCOA 4KT5C 1IDYA 3TP3A 2K4JA 1BW5A 3DFGA 4EJTA 3TFHA 2KIQA 4N9HA 3IHUA 3BR5A 1DPUA 3V7RA 4OIPA 3PO2J 1KU3A 2HKXA 2NVQJ 5EEHA 1WSRA 5IYCK 4MHGA 3S2HK 4XSXF 2VQCA 2A69A 1TLHB 3VOEA 5HLTA 4DZPA 1WQFA 1IUFA 1B6AA 4I76A 4JK1X 4L0YB 3H1CA 2HTJA 4RS8A 3OYEA 4G6QA 1MBKA 5ILVA 2GSNA 1OYYA 4UUVA 1X1DA 5FKMA 1YE9A 2CU7A 3ZGKA 3GTKC 3JRCA 2O5JA 1BGWA 2Y31A 1X3ZB 5D4RA 4FM9A 3PNVA 3BC8A 4L9TA 4CUGA 2K9SA 4Q5SA 3ABUA 1ZKGA 4OIRA 1I6HC 1BW6A 3S15C 1TT0A 1I50A 2LRDA 3H5AA 2MFZA 3CQZA 2VUMJ 4PGHA 2EZKA 1FC3A 2DA7A 1INNA 2FQTA 1IO2A 2VPRA 4GO1A 2WC2A 3ULQB 5E3NA 1OQYA 4GTAA 2EIMH 2DTRA 3WTUC 1RUOA 1PUEE 4LIUA 1ZYRF 1Y1VJ 1ZLKA 3IKVA 1W7PA 2XC7A 2ETHA 2E19A 2KJCA 1X19A 3HOYK 2KRHA 2XKOA 3I71A 3S14J 1P4XA 1R9TA 2DTZA 1BS2A 3EYYA 4G9YA 3DLAA 1EH8A 3LAPA 1YJWI 4PK4A 1P7JA 1MBHA 4MGRA 2Z99A 2DDBA 5M5WK 4JBAA 3FMRA 4B8XA 3GZ5A 2VBXA 3PL8A 2ZSIB 3CZ6A 5LGNA 4II2A 4N9IA 3HOWC 4L5EA 3DEWA 1ERDA 3ZPLA 3TFJA 1GT0C 3AD8C 3I56I 4L0ZB 4A93J 3QAHA 4XSZF 4GCVA 1MJ9A 3K6GA 3O3KA 3W2WA 2OTLI 3HDDA 4XLPA 3OL3A 4PFOA 2I8DA 2LVSA 5CLSA 1HF0A 3ZMTA 5C4XJ 3O8GA 3M8EA 2E2IA 1I39A 1U8BA 4HZFA 2JA8C 2P7CB 4P5BA 3LWFA 1XXAA 2QKMB 3F8NA 2Y9ZA 1FBUA 3I54A 3K4JA 5C4XC 2H6BA 3VA7A 2IA1A 2V26A 3BDDA 4S04A 3H3VD 3WODF 4GGGA 4IOAF 2WBMA 1MSFC 3A03A 3OWTA 3OYHA 4GTCA 2PMZL 4B44A 3GFIA 1TWCK 3LA2A 2R3SA 4G0UA 2NVXK 2CQQA 5E79C 3S15K 1USOA 2CO5A 3ASNH 3E6BA 2ZJRF 2RKHA 2V9PA 1S7OA 3FMQA 5CVUA 5L3DA 2M7AA 1A35A 1Y56A 1IXSB 1OYIA 4U87A 2E2IK 2DODA 3QOEA 1TWGA 1D1BA 1MH4A 1BJZA 2DMUA 2PBIA 3OL4A 1TWHJ 2VODA 1KU7A 3GBGA 2OZUA 2OTJI 3EQLF 2YSRA 2ISYA 1LPQA 2VT2A 2K3FA 1B59A 2HQNA 1TNTA 5A2QZ 4UUSB 3CO6C 2C6YA 1E17A 5L3EA 5B3SH 2GSOA 2L0KA 1RRJA 1E0EA 1ZR2A 1Y1VC 1S3JA 3JRDA 4RGRA 4EJUA 1D0ZA 3HEFA 4RLFA 2NXNB 3WODA 4MEXF 3K9TA 5IP7C 1NG7A 2WAQA 3NRVA 4CZCA 3VYTB 3KX2A 2VL8A 4A0YA 1W7PB 3RZOK 4LK0F 5GTHC 1ZQ1C 3JTGA 1Y1WK 3HOZC 4FX0A 4ZYAA 1Y1WJ 4C45A 2DFIA 2FF4A 2PA8L 2DK8A 4Q4ZF 2Y0MA 4I98B 4MFEA 3M4OK 3N3YA 1A31A 4IHXA 4LOCA 1TWGJ 3P5JA 1FYKA 2EV6A 4KN7X 3B02A 2V6UA 3S0XA 2W84A 2JA7J 1WGXA 1K6OA 1ZGWA 3AD7C 3OOPA 3J7YJ 1I6HK 4A3LC 2ZNZA 3WG9A 2QQ8A 2CQ7A 2DMTA 1FOKA 1EH7A 1FSEA 4C3HJ 2HFHA 3COAC 1DDNA 3HOWK 1HQCA 4DQ2A 2I5UA 2KDOA 3J7AO 1ITYA 2BY2A 3GTQJ 1YS7A 2VASA 3HRTA 3VB2A 3BQZA 1ETQA 3BR6A 4MEYA 2JN6A 1I6XA 2PPBA 1T38A 3FM5A 4C2MK 2HPMA 4XLEA 2CW7A 3CMAI 1FOWA 1IAWA 1VZ0A 4KMAA 2E2JK 2HOTA 2M4GA 2NS0A 3D5SC 1P92A 3KP2A 4KISA 4U0VA 4PJJA 3TKYA 5J4YA 5IP7K 2MH2A 3K7AJ 1O27A 3OEPA 1MNEA 2R93K 2HZDA 3ERMA 5D4SA 4YEJA 3PIOF 1UJ8A 1TWCC 4GFQA 2HKOA 2OCCH 4HSTA 2B63J 3CLOA 4F7ZA 2YX4A 3IUOA 2KISA 2QZ8A 2Z9OA 1QPIA 4MLOA 2JUGA 2OZ6A 4A3BC 2DA5A 1ZRDA 3S3OA 3I3LA 2D2WA 2DMNA 1WWXA 2XRLA 3IV5A 4IHTA 3LA7A 2B9SA 2NS8A 1QZZA 1WCMJ 4AVZA 1F4KA 2RNJA 1K83K 4XM3A 3MKYB 2ZXIA 3Q5FA 1BI1A 3DBLB 3U1DA 2XRNA 1VRQC 4BACA 2XB5A 1LFPA 1X3UA 2M1BA 1D8KA 3LMMA 5JVGF 3IC7A 5TJ3A 1SFOK 2HU9A 1BJTA 4CYCB 1XZPB 1I3QJ 2PX9A 4ITVA 3BZKA 1KONA 1OKRA 2M7BA 4C3JC 4Y15A 1Y1WC 3HOZK 1KQ0A 5BS6A 5FLMC 1FWZA 4KIGA 1YJ9I 2XB0X 2DXIA 2GOXB 2BYVE 5H2FC 4BLAA 4C2MC 1JKQC 2LOOA 2FEZA 4KB4A 5FKNA 3T5XA 1GLNA 4ZH4F 3WG7H 4BLBA 3UR3C 1B9NA 3GVAA 2MLGA 3GTOK 3S17C 4FT8A 4EJWA 2JT1A 1G3YA 3S2DK 2CW0F 4A6DA 2XGDA 1R5GA 4OINF 1OPCA 4YFNF 4LLGA 4BXXK 3I4MC 2X1CA 3MWMA 4Q47A 3N05A 1HSJA 3F8BA 2BGCA 3Q9SA 1ZVUA 3OSFA 3GTJJ 3DP7A 2H27A 4P55A 3SFIA 2R93J 3OYKA 3H0DA 2TDXA 1YNJA 5KAIC 3IL2A 2A68A 3GTGA 3HTUA 4CO8A 1F36A 3KP6A 4A3CC 1YI2I 2KRFA 3KE2A 1QZEA 3V42A 5FB2A 3GFJA 3Q3QA 2R7ZC 2P8TA 3TP0A 3HOXC 3A2KA 1RUNA 1YIJI 2L01A 2Y9YA 3FKIJ 1AHDP 2R7QA 1HXDA 3C3WA 5LRSA 2LFBA 3FMSA 2MGQA 5CJ9A 2NVTJ 2NVXA 3CDIA 3LL7A 3LSKA 2CFAA 4TV7A 4ENMA 4PSXA 3GFLA 2O7OA 2KZGA 3RZOC 1LVKA 2NVYK 1J9IA 1ETXA 3DEUA 5LGUA 2VJ5A 3CJRB 2KL4A 4ETSA 3X2QH 1O2BA 2GAUA 2LSOA 2GWRA 3OMYA 1LDJA 4HA8A 3RPUD 2ZJPF 1Y8RB 4M3FA 3GTPA 5J4VA 1F9NA 4NBQA 1JUPA 1SFOJ 3IP4B 2WAQD 3L4KA 2FOWA 3GTGK 4L9VA 5E3OA 2E7XA 2HVQA 2KPMA 3WE3A 2LY9A 4KMHA 1QHGA 1ETOA 2IA0A 4OWRB 1Z21A 4A93C 2VXDA 1RKTA 1GE9A 4XK4A 5DEQA 5C3EJ 3JRBA 5IOYA 3G4CA 4A3GC 1V55H 4LGWA 5CVRA 3ZMUA 3S2DC 3S32A 1H0MA 5IOTA 2BY3A 5BOXA 3SZPA 1VQ4I 3T00A 3HB9A 1YX5A 1FLIA 2MLKA 4X0GA 4P9UA 3WTWC 4G7HF 1KQ4A 3BP3A 1MMAA 3OV8A 5IYCC 5TJJA 2E5ZA 4DZJA 2GAGC 2L7KA 4IHSA 3QU6A 4A3KC 3DTKA 3Q0WA 1G3SA 1PYVA 3E3VA 2F5CA 4BBSC 3CCYA 2HOEA 2Q2EB 1K4SA 1X1AA 3HYIA 4D5CA 2NVYA 1WSVA 3SDBA 1FJLA 2MW8A 3K4BA 3NAUA 5LLQA 2KWAA 4C2UA 1AB4A 5FFXA 4DDQA 3PNTA 3L2VA 3L4JA 4UNOA 2E35A 2RH6A 4CCMA 2A07F 1W5TA 3OS2A 2LC2A 2EJRA 4I2OA 3ECHA 1RIOH 3OIQA 5E20A 3M9AA 4EM1A 5LRRA 3MVPA 3IWFA 4QJVA 2Y0SA 4FASD 3S1RJ 3GTJC 2IBDA 1IXRC 2E34A 3SQNA 3WTVC 2FOKA 2ZJQF 3D0SA 5DCMA 1WJFA 3Q0UA 3FXMA 3RYRA 2D6FC 3ABLH 4OOIA 3EUKL 2A68F 2VPLA 2ZFZA 2OBPA 4B3AA 2V4JC 3DCFA 3MKZA 2R92C 4PJMA 3NWTA 1KQ9A 2EFNA 3C2GA 4KIBA 3WTZA 1VQMI 2DW4A 1DCPA 5C4XK 4BGDA 1NH3A 2HOAA 2FU4A 4IRIA 2WAQL 3ZMSA 4O2DA 3BR3A 3S1MC 1MH3A 1QGPA 3BZ6A 5LHIA 3GUDA 1K6YA 1KGSA 2YU9C 5JHFA 4JX4A 4E7LA 1LDKB 3P7NA 3VEPA 2O3FA 4XOPA 4CICA 1XSDA 2NVYJ 3P9KA 2X6XA 3FK6A 4ZJZA 3G3ZA 1HBXG 1F93A 3BTCA 2AO9A 1XD7A 4BEHA 1IRZA 5BPIA 4KDDA 5FLMK 1QVTA 3M07A 5D5VB 2LNBA 4NC6A 3JRFA 2E2JC 1N25A 1HKQA 1WVRA 2FUG2 3T1BA 2IS1A 1TZLA 4LITA 4NC7A 4M3BA 4II3A 1S7EA 1JTYA 1OFCX 1WOPA 3H0GJ 2NOGA 5F0CA 3KYDB 3W6VA 4XKCA 3ZQGA 5IOQA 4XORA 3BCAA 4EJOA 3S1QJ 2KQRA 2P0WA 4ENKA 3BR0A 4A3KK 2L9VA 1WJDA 2A5YB 1IRXA 4B43A 3K7AC 3FXKA 4A3IC 3AFHA 4ASNA 3WTXC 5J47A 2CUEA 5FJ8K 4KFCA 2FQ3A 4H0EA 1TQIA 2KKOA 5LHHA 1C0AA 3S3NA 4LJZF 3U9GA 1XGOA 2HI3A 3GMEA 2OCEA 1W36C 1P2FA 4BY1C 3PUFA 2O8XA 3FXLA 3JRAA 3F9KA 1W5CC 2P5LC 3CF5F 4B3XA 1TWAK 3GTMK 1IW7F 3VWBA 2CUFA 2DA1A 3A02A 4HEA2 2VBZA 3TW6A 2BV6A 2GSUA 2NVQK 2L54A 2PMZN 5JLWA 1MD0A 3M3YJ 3EETA 2XV4S 4A5NA 1EI6A 2KFDA 2DAOA 2NVXC 4XR6A 1V5GA 3GZNB 1VGXA 5J8CA 2J5PA 3SXYA 4FZBA 3QPHA 4BXUA 1HI9A 1USTA 3GEHA 2IJLA 3N0CA 3M7GA 2RGRA 2X6YA 1J2XA 9ANTA 3EPZA 5FGMA 5HLIA 5B5EC 2G7UA 1SD5A 2YPRA 1Z3XA 2VC1A 1DU0A 5KCMA 2XAJA 2ZB9A 2JVGA 2LTPA 2XAFA 3S3MA 1TWAA 2IGNA 3E1SA 3W2AA 3GTMA 1RESA 2NS7A 3Q0VA 2LF7A 1U9NA 3M3YK 2LR8A 2FJ1A 2Z33A 1FBQA 2YS9A 4BHBA 5EGHA 4BBRK 2PHCB 5EEGA 4XN0A 1XXCA 1SVLA 3GTMJ 2HGCA 3R6SA 1TWAJ 1QHHD 2F5FA 4RLQA 1BI0A 3K2ZA 1ON1A 5DCFA 4BJ5C 1A6IA 5C4JJ 4A3KJ 2XCRB 1WQHA 1UHMA 3F72A 3WU2C 1PJ6A 3OYDA 4LK0A 4DIQA 1ZH5A 5IP9J 2WY8Q 3ECOA 3HZJA 2BVLA 4MEXA 4KARA 2R92K 1FP1D 3OYBA 2HYGD 4RGSA 1UG2A 3GZ6A 3GTQK 1W0UA 3SDGA 1XC5A 4A3DC 2WB1L 3TTGA 3WU1B 1YIOA 5HS9A 2K3PA 2WA0A 3ZMVA 4DBRA 1OR7C 3G6EI 2OA4A 2AXTC 2W24A 3F8MA 4Y7NJ 1P4AA 1FP2A 5C3EC 5DD4A 3K4MA 1SVMA 1MBFA 3WTTC 1R71A 2DFHA 4FHTA 3T8RA 1OCRH 4IQ4A 2RVCA 5TMFA 1UG0A 2TRTA 3WGHA 2CW8A 1Y0NA 2K02A 3WHBA 1E3HA 2P6TA 1BR1A 1SD6A 3L2UA 1JVIA 4PCQA 3LAJA 1SFOC 2WAQN 4IPAA 1O3QA 1Z1DA 1XX5A 5ICFA 4A0XA 3PIPF 5IYDK 1K79A 2M34A 5EG0B 5EZHA 2E2HK 3CAGA 2Y0SN 1M1EB 4LMYA 5IY5H 2JMWA 2DMQA 5GADJ 1YW8A 4F52A 1GHCA 3GTPC 5BPDA 1Q1VA 2QYOA 3JCUC 4BE0A 3RZOJ 5FJ8J 2WB1D 5IP9K 4NQWB 2GAHC 2HQ5A 5F08A 4GFBA 2VN2A 3ZRGA 5LBQA 4HNTA 3OR2C 2MD0A 5HDKA 4JP0A 4V2GA 4K2EA 4BNCA 3I9V2 2XGEA 4EVIA 2JSPA 2OF7A 2QQBA 1G8XA 1F5TA 2P4WA 2R7ZJ 2JTVA 3N4MA 3LSMA 4KB2A 2JWTA 3M1EA 3BG7A 3U1KA 3HSFA 4CCJA 3GTQA 3PNYA 1O24A 2B63K 5CVIA 2FBKA 1R22A 3EUHC 3S1NJ 2ZJ2A 5JFRA 2OUMA 3TO9A 5F04A 1J59A 3CJQB 2DFEA 2OC6A 4PAAA 4XRSA 1KYWA 1V5FA 3M1CA 1BL0A 2D5VA 2VBYA 1U3EM 4JX6A 1MIJA 3CDLA 3CCMI 2VUMK 2X0LA 1ZAOA 3K4CA 4BXFA 3MZ8A 4C2MJ 2K9QA 2CWEA 2O5IA 4KN4A 4HG2A 4YFKF 4Z6YA 3OYCA 2VLAA 1T0FA 2OJED 2XDVA 3FWEA 3EUHA 4UVBA 4GTLA 4A2UA 1ETWA 2LKPA 1YJNI 3S15J 2VJ4A 1XCVA 3TO6A 5FKOA 5K1YA 3RI4A 2DCEA 4YIFA 2W4SA 2EZLA 3GEZA 3CC4I 3GTKJ 3AG4H 4EM2A 2EZIA 2DA3A 3CDHA 2EFWA 1YOVB 2L7MP 4DYQA 5JI6A 4Q5SF 3H3UA 4FTHA 4IVNA 2ADUA 2X6WA 1JHHA 2JPCA 2ELHA 1GXQA 5ICCA 1S29A 3OIOA 5M5WJ 3PO2C 1NK2P 3L2WA 1YRNA 2AS5F 1FEXA 3FDYA 3RPQA 2B63C 4YG2A 1BOBA 2A3SA 4E7KA 2VBWA 3RPUA 5IYDC 1YG2A 1VLOA 4OIPF 3LQRA 3G1MA 3L00A 1JOEA 1RKWA 2M3AA 4BY1J 2VOOA 2FBHA 4YG2F 2ISZA 4A3CK 5IYBK 1AKHA 2QSFX 2K7LA 3MD2A 3FOEA 3ABTA 1RPWA 4WF2A 2W85A 3GW2A 2BHZA 4A3IJ 4A3JJ 1PVEA 2FNPA 2E2IC 2N8GA 1V3FA 4XNFA 5GTIC 4J00A 2M87A 3JAMZ 1JI8A 4MQ9A 4A3EC 4BUPA 4B1RA 2VKEA 5CQEA 1SVOA 3MZYA 4L9NA 4F91B 4XICA 1TW2A 3RKXA 2GZWA 1SANA 2ELJA 1W1WE 5DYMA 1HKSA 5F0FA 1J7KA 4D5FA 5FLXZ 1R7JA 3U21A 3GTQC 2QBYA 2EA4A 2GXAA 2XKPA 1MBGA 4ZDPA 4WJ4A 4ZYHA 1TWFJ 3I4PA 3GTGJ 3S8PA 2IGOA 4EQQA 5EF6A 3ZMDA 1J0RA 4A3MC 5K5RA 2RGVA 2R7RA 1KA8A 1BI2A 4CCLA 1E2XA 4HNVA 3H9QA 2GIZA 2KT0A 5B66C 3HUGA 4YFKA 2CQXA 4UB8C 2R92A 2M5WA 5BMZA 1H88C 1Y39A 1EH1A 1IF1A 1G6NA 1N75A 1OCPA 3BWGA 2JK3A 1PDNC 4G7OA 2HOSA 2QQ9A 4KASA 1HSTA 3HOZJ 5HLHA 4KAWX 3CUOA 2L02A 2KDZA 1O26A 4NB5A 4BY7J 2FD5A 2VQLA 1I3QA 3QRFF 4KICA 1HCRA 3C18A 2J5OA 3F3XA 3GTOJ 4M9XA 3PFIA 5FD5A 3KZYA 4CCOA 1XB4A 2QWWA 3NQOA 4UVCA 2CV1A 2JA7K 5CVJA 3E6DA 1S9HA 1YQAA 2X51A 3S1NC 3I5UA 2R5YB 5CQGA 3BTJA 3CC7I 2Z2SB 2F4OB 3JSOA 2A6TA 4HQEA 3S16J 5TMCA 3ASOH 1YRNB 1XTAA 3LSIA 4X1EA 4A6EA 3LFUA 2UXNA 4IL6C 3ZQ7A 2VKDA 3QQAA 4A3BK 3K1MA 3KYCB 1LB2A 2KIUA 4BXXJ 2EV0A 3MKWB 3N0BA 3K4LA 1YS6A 1I3QK 1TT5B 3GDZA 3ABMH 3KEOA 5LEJA 3RDIA 2YUSA 2NNYA 2R7ZK 3DTIA 2WV1A 2FXAA 3BR1A 2CUJA 1IN7A 1Y6IA 1A5JA 3BG3A 2Q1ZB 1R9TJ 3GTPJ 4LK1A 4NHJA 3PQKA 3ZN0A 2DJNA 5EGOA 1G4DA 3CP8A 4HQMA 5HS8A 4OIQF 2CYYA 1SMYA 4XLNA 3FK7A 2HXIA 2VONA 3S93A 3OYJA 1ETYA 3KFWX 3LSJA 1EF4A 2ME0A 3PSFA 2R7TA 2K9NA 1BBYA 3P9IA 5J1YA 1O3TA 2A05A 3FXOA 2I10A 3ZXSA 1I50J 1EJ9A 1GDTA 1XG1A 1NG6A 3Q9VA 2WAEA 3V8LA 5E68A 2IS6A 2MG4A 3CC2I 2VQGA 4A3GJ 1F43A 3I4MK 4P9SA 4ZZLA 3G1OA 2LK2A 3V4GA 4L5IA 2NVUB 4ON0A 4BBRC 2WAFA 3FX3A 2E71A 2Y3PA 2K85A 1MW7A 5L3FA 3DXJA 1V4RA 1IN8A 2PMZD 5J1UA 4HRIA 2V79A 2RAEA 3IH4A 1TQPA 3DF8A 5J40A 2X6OA 5C4JC 1Y1WA 2EIKH 5HODA 2K4BA 1VQ7I 1WJEA 4HX4A 4BJ6C 4HF2A 3GLXA 2E60A 4IQJA 2VQHA 1EQRA 3NUHA 5C4JK 2W1OA 2DPDA 3HGGA 4EV0A 3V7SA 1P6RA 4NDLA 4NUBA 4OU0A 3IWZA 4NC8A 1Z77A 3CCSI 3ONQA 2CJJA 1WRJA 1RNLA 4M9ZA 3ML6A 1I6HJ 1UHWA 3I58A 1W36D 4LB6B 5IT9Z 2QSGX 3A8IA 3R0JA 3ELKA 3H0GK 3GTKA 1O57A 4E7ZA 2EZHA 4ZDLA 1JKOC 4V19K 3PO3K 1U6GA 1KU9A 1G3TA 2HVRA 1IW7A 1PP8F 1XSVA 4F92B 4KN4X 2MSYA 1XMXA 2GIVA 4FQGA 1R5ID 3OYNA 3MAJA 5JLXA 2BOLA 3CQZC 3PQJA 5F1JA 5F64A 1BOAA 2VJJA 1DCOA 3ERED 2ZXJA 3GTOC 1LE8B 3OYGA 1D5VA 4G7ZA 2JA6K 2M8GX 3BQYA 1XS9A 2DA4A 5BNGA 4C9YA 1UMQA 4D9JA 1O29A 2R7DA 2DQRA 3DV8A 4E7IA 2VIXA 2A6HA 2GA2A 3FHNA 2X48A 5FO5A 2PEXA 4IRGA 4J01A 5FKKA 2OQGA 1S7AA 2XSDC 2ELKA 4GTBA 3GO5A 2JA8K 3RZDJ 4A3LK 4A0ZA 2Y75A 2H8WA 3L2RA 4F3QA 5D6EA 4G7ZF 1B4BA 1JQWA 3A8KA 1OCOH 2M0CA 3BPXA 2Q0OA 2EILH 3H9JA 5HDNA 3HOYC 4AUXA 4L9JA 2VJIA 1WORA 2NVTK 5B1AH 6PAXA 3GTKK 2YR2A 4HV5A 3DPTA 4XCHA 4ZDOA 2K5CA 3HXLA 1R36A 2EIJH 3EUAA 1S5LC 3W3CA 1IS1A 4UUTA 2COMA 2E1MB 1F1ZA 2VC0A 5M5XJ 2HS5A 1WFXA 3I55I 3E5UA 4V2FA 1VTNC 1TWCJ 4XL9A 1YYVA 1R49A 4AD9A 1QPMA 4DNCA 3HIFA 4A3EK 1ZR4A 1O28A 2NVYC 1K78B 4KM9A 1L0WA 1QRYA 2E1CA 4P96A 3E5XA 3ZQCA 4GYGA 1V5EA 4D7MA 4UVAA 1GV2A 1UELB 1FYLA 1B8IA 2ZFWA 3KLOA 3V8JA 3WGGA 4LD5A 3S1MJ 4W97A 3M4OJ 1X1PA 4PDKA 1XGNA 5IP6A 4UHTA 3CQZK 3RZDK 1WCMA 2L3DA 3JAMK 3HKZL 2P81A 4M71A 2H1LA 4M6XA 4G0VA 5CYVA 4HAMA 4ZTJA 4I02A 2LMDA 3HSEA 2D1VA 3IAM2 1XGMA 1E3OC 2P6SA 1R00A 2ESNA 3JREA 3HKZN 2JA7C 2E1OA 5F6FA 4MTDA 2A6EF 3K70D 2BY1A 2DU9A 5HS7A 5KNLA 3J81K 2UXXA 3NEUA 4HSRA 5DCMB 1R58A 4KA4A 4PJLA 3OSGA 1FTTA 2STTA 1HKTA 4OIQA 2DYSH 3AAFA 4MTEA 1XN7A 4BJTA 1MDMA 3I4NC 4OAZA 2JA5J 1IV8A 4EGZA 1FYMA 1P9QC 5H20A 1DD5A 2XAGA 2PLYA 4ZZDA 1MJAA 5ICEA 5IP7J 4DYCA 2KMUA 1OR7A 2MABA 3PSIA 2ZNYA 4MNUA 4QIWL 4RM3A 5H6QA 3F22A 4G7HA 3TOBA 1YO5C 1H8AC 3QOPA 1HDPA 1SFXA 1T39A 1QBJA 1X1CA 5M5YK 2X1DA 2HEOA 3T01A 1UCRA 1K83C 4WJ3M 2IPQX 4D0PA 4MFDA 1HW1A 4BBRJ 4LG0B 1ACIA 3H3VL 2COBA 1WJCA 3RCOA 3ZOBA 1K4TA 1WJAA 3KEQA 1NK3P 4PJ0C 3K10A 2JJ7A 1S6LA 1TTYA 2W25A 2A61A 4HNUA 4JQFA 3LNQA 4AM3A 1DPRA 4M3DA 1Z9CA 1XZQA 5KHDA 2H1KA 3FOFA 4AC0A 5EG0A 1P4WA 5L46A 4PSWA 4DBQA 2DN0A 4CH7A 1XDSA 2XHKA 5GAHJ 1LDDA 1IQ0A 3GXOA 3AQOA 3HOUK 4O5VA 2V1XA 4U0YA 1WZ2A 2W48A 1VI0A 4AU7A 2V7FA 2F5VA 5C44J 3HOVC 4GTFA 1LKXA 3I53A 3HOVJ 1JE8A 4KC6A 3GTLA 5KAFC 2LKXA 4ZTFA 2HPIA 1VFCA 3S14K 4G6DA 4HW0A 2UWMA 3HRSA 3HM5A 2K9LA 2CUZA 3OOUA 5C44K 3O6BB 3VODA 2OQRA 4IKFA 2R7UA 5IOZA 5F1RA 4KMUX 3KETA 3AL0B 4UUSA 1AKHB 2R5ZA 2OV7A 3O8HA 4LLGF 4U0WA 3QP5A 4PGGA 2CW0A 3OREA 5ILSA 1WOOA 1XDUA 1U2WA 2B0LA 3CUQA 1X4OA 2LY1A 1WQGA 4BY1K 1Z0XA 4Y52C 4BQOA 4R8HA 1ETKA 1LEAA 3D5RC 1LFUP 3PJRA 1BR2A 4ZH4A 3L7WA 3CP2A 1XPXA 2NAZA 3LA3A 3TW7A 4WCGA 4BE1A 3G4AA 2Y0SL 4N4OB 3T0YA 1T33A 1U5TC 4MQ9F 3RJPA 3LSPA 1O2FB 2RQQA 3SEQA 1TWAC 4MQVA 2P5VA 3KZIC 5D8KB 3K4NA 3FKJA 2YU3A 5K5QA 3R60A 1TWCA 1FIAA 5EJCA 5EDNA 3IRQA 1ZRCA 3FISA 2JZYA 4XMYA 5KVRA 4AYBL 4A3DK 3I4NJ 2PJPA 3HOXK 2HNHA 3QX3A 3HUGB 5DDGA 4C3JJ 2VUMC 2R93A 3Q3SA 3ZQIA 2Y30A 1FT9A 2WY7Q 1PJ7A 3BP8C 2R4GA 1TWGK 4HX8A 2IS2A 2Y69H 4ILDA 2DOAA 1VH2A 3BR2A 3UNGC 4YFXA 4QPOA 4AYBN 1HW2A 3CUQC 4NNJA 1IBAA 1AA7A 2L2OA 4M73A 3ZN1A 1ZN2A 5K7HA 1FIPA 3L9FA 2R0QC 3M3YC 1XMKA 2ID3A 1R5HA 3DU6A 2ACJA 4M6YA 4Y4RA 2KHMA 2NVQC 4XKWA 1WCMK 2XPWA 4A69C 4RM2A 1T56A 4E7JA 2M9HA 4DGWB 1FOYA 3FIWA 5L3BA 1BA5A 4A3FC 5IYBC 3R61A 2DOFA 1GVDA 3BTIA 3ROUA 4O6JA 1TL8A 2E2IJ 4A3JC 2B7EA 2ZSHB 1JT6A 2F2EA 2Q2EA 3QYFA 2BEOA 1FBSA 3PUBA 1Y1VK 4G8XA 1UB9A 2AQEA 4RB2C 2Z3YA 3QYEA 3AG1H 3GTOA 2EV5A 1USSA 2XGXA 2DT7B 4A3IK 3BJAA 3J7AY 5LEKA 2LH9A 4E70A 4XRMA 1I1GA 3I4NK 4WXCA 4A3FJ 2XUBA 3KCCA 4LB5A 4C3IJ 1REPC 3LPXA 3QP6A 1POGA 2XPVA 3JW4A 4L5JA 3W6KB 4F55A 1CF7A 3EYIA 5FRMA 4RAYA 1MNDA 1RETA 3OR1C 2ZKZA 1JKRC 4S05A 4XLCA 3F21A 1DCHA 4B4CA 4ZC3A 1VNDA 4L18B 3FM3A 2L4AA 1SFUA 2DQLA 3DLLF 2E2HJ 2IP2A 5DV5A 2CMPA 3BZCA 2LD5A 4Q4ZA 2ZXWH 4A3LJ 1RC9A 4IXAA 2EB7A 2RREA 5J1RA 3REOA 5J8FA 2MA3A 3K1PA 1GUUA 2X1EA 1PUFB 1TWGC 2GXBA 1QO0D 1D0XA 3A1YA 4A93K 1I6VA 3HL2A 3BJ6A 2G7HA 5B1BH 3VPRA 4BYYA 4QIWN 2F6CA 2LBFA 1CF7B 4KYWA 3CCQI 1YITI 1TC3C 1MMDA 3RZDC 1TWHA 2ZUEA 5FD6A 1Z7LA 1UFMA 2ECCA 2EINH 2L9NA 3CCLI 1YCLA 2IXSA 5HLGA 4DJAA 2V9KA 4E4HA 2AXLA 3HC7A 5E3LA 3IRRA 2A5WA 1TW3A 3QU3A 1U78A 3EQLA 2XF5A 1BIBA 2IA2A 5FKLA 4P9FA 3TEDA 2JA5K 2FNAA 4LLLA 1WKMA 3SHFA 2R92J 3I64A 2FRHA 2XAHA 4RGXA 4XRSG 4I7HA 1QU3A 1XZPA 1G2HA 2V6SA 4AH6A 1R1TA 4LIVA 2KP6A 4GRIA 2CQKA 5JVOA 1XPPA 5GPAA 3DKWA 4OMYA 1ZHFA 3NWSA 2GLOA 5GAEJ 4Y52J 1EV7A 2VT3A 3BROA 3L09A 3RTRA 4A3JK 3D5LA 4KDPA 3AL0C 4OIOA 2QGUA 1VQNI 3C2BA 1QQIA 2JQ7A 1IG7A 3B6AA 1K83A 2Y48A 3H5NA 3AG2H 2H6CA 1K78A 1D8JA 3ADAC 2DPUA 1N77A 4QSHA 2IT0A 2BHYA 3PO3J 4XONA 4KJZA 1B72B 2R7SA 1JTXA 3U2RA 3HGYA 4RAGA 4RB0A 4CCNA 1OISA 4GDFA 2YU9A 2HDCA 4FE4A 1V54H 3FXQA 3WTSC 1E3PA 4ZYGA 5HNFA 2R7FA 3GEIA 3OIPA 2HWVA 4XLPF 2CQNA 1FMWA 4BE2A 2EA2A 4IX7A 3FKIK 2E7WA 2L7ZA 3I59A 1VJEA 1R6RA 3JTHA 5FFZA 4XSZA 4G12A 2XF6A 2HQRA 2A6HF 1JUMA 1H9GA 2FQOA 4C3JK 1JJ8C 3K69A 5FLVA 2CFAB 4XN3A 2CG4A 3W6JB 3GSIA 4M3EA 4HLXA 3ZQLA 1X2NA 2BVMA 2WB1N 1JGGA 3ESWB 3FBIB 2Z1DA 3S17K 4MIMA 1T98A 3QYBA 3S2HC 2MD5A 2DYRH 2P5KA 1MMNA 4LFUA 1HLVA 3S2DJ 3HXAA 5M5XK 2YU9K 1DP7P 1DUXC 1W7PD 5CKTA 3VYRB 4BQNA 4EEFG 3I59B 3S2HJ 3V8KA 1R1VA 2EFQA 5TGTA 2XROA 1U8RA 1I50C 5EEAA 4YIIA 3CCJI 3KP3A 4LG3A 1SMTA 1ON2A 2L5QA 3OS1A 1VQKI 1ZYRA 1Q1HA 1HA8A 3FKIA 3R4KA 2NRAC 2X4HA 2DOEA 3BT9A 4C30A 2QKLB 5L3GA
chains in the Genus database with same CATH topology
5EGEA 3BOQA 4HX7A 2EFOA 2FBIA 1ZGJA 1BC8C 5L3CA 3TO7A 5ILUA 3MFKA 1BIAA 5JHUA 1O25A 2RV8A 4KIFA 2K86A 1LNWA 3DXJF 5TRDA 3LFKA 3AH5A 1LEBA 2A69F 1ZG5A 1Y1VA 4KNYA 1MDMB 4KMFA 4RB1A 3K1NA 1LJ9A 1GXPA 1Z7UA 1JHFA 2KIMA 1ZXOA 4OIOF 1LVAA 4A12A 1TWFA 4U7DA 1ULYA 1U5TA 3N97A 4I0AA 2STWA 2JRTA 4WXHA 5K5OA 2F5EA 1R1UA 1GVJA 1QNTA 1IZ1A 3P9CA 1ZARA 1I27A 3MZHA 3F8CA 3FXRA 2JSCA 2D45A 2B63A 1EH6A 1U5TB 3HSRA 3WTYC 2KIFA 3BY6A 5IORA 3CUQB 1YTYA 2NYXA 5ICGA 1FX7A 1SFEA 1AOYA 1ZREA 5A2QK 1O3SA 3TGNA 2FE3A 3E6MA 3H92A 1KYZA 4HOBA 1Z6RA 1B4AA 3HHGA 2O61A 1ISEA 4AIJA 2NNNA 1PP7U 5DD8A 2QLZA 2V1UA 3VFZA 4CHUA 2PI0A 1WQ2A 4G7OF 2ESHA 2EFPA 2PG4A 2VOPA 3MQ0A 3GFMA 3KLNA 4HBLA 2FSWA 1BJAA 5E8GA 3FZVA 4GTDA 5D5WB 4WXDA 3T8TA 3JSPA 5D5XB 2Z5UA 3SFZA 5E1WA 2YX7A 4BH9A 3OPFA 4A5MA 2QVOA 2QQAA 4M74A 4Q48A 3GWZA 1WIHA 3DQVC 1D3YA 1ONVA 3KZZA 5E18F 1SD4A 4RB3C 2XASA 5D5UB 5DUIA 3I0TA 2CFXA 4BHPA 2M8EA 4AVPA 1B1BA 2VE9A 3KP5A 4HLYA 2P7VB 4R79A 3TOAA 4WK8F 2ZMEA 2PFBA 2LDUA 4HDVA 2XAQA 2MBFA 3GX4X 3E5QA 2FMYA 2O0YA 1MKMA 2CGPA 3E6CC 1B9MA 4AIKA 3G73A 2UZKA 5LHGA 1Y0UA 3WU0A 4M9SA 4WWCA 2M30A 2XCQA 1ZGAA 1TQMA 5LGTA 1ZBSA 2R7ZA 3R0AA 3WE2A 1YW9A 1I5ZA 1XXBA 4G0WA 1FY7A 1TNSA 5AONA 1HW5A 3CO7C 5D6FA 3J81Z 4IRHA 2DK5A 2IW5A 2V6CA 1OYWA 2ZCWA 1EK8A 4QLCU 1J5YA 3MCZA 1BM9A 2VXZA 5AIPA 4WX9A 2BBYA 5IT3A 1OMIA 2VE8A 4AWXB 2PMUA 4CDGA 3FHZA 4Y17A 4LG0A 4MEYF 4LR2A 1R23A 1A04A 1K7AA 3RYPA 3S2WA 4EJVA 2WTEA 4I01A 4AIHA 3IKTA 2H94A 1STZA 2OU2A 5ERIA 4P5OA 4CZZA 4U7BA 4I0BA 1BI3A 4ENNA 5JR3A 5CVVA 5ED4A 1IXCA 3F6OA 4KUMA 2WV0A 1T2KA 1BC7C 4ESJA 4Y13A 2XVCA 2QENA 2GXGA 4GT9A 1W4MA 3HRMA 4C3IC 2PQ8A 1ZRFA 1IN4A 4B09A 4GYIA 2ZO4A 3AQPA 4Z2YA 4GXOA 2GA1A 2MC3A 5E1XA 3HTSB 2ZMEB 2OAZA 2ZBKA 2DT5A 1Z91A 3F23A 2QM3A 2XIGA 2LF8A 5H6RA 2OD5A 1SAXA 1O3RA 3C7JA 4UV8A 4M72A 1O7FA 1TBXA 2DO7A 5J6XA 5JFEA 4O3MA 5E8IA 2V1DA 3DPLC 4C3HC 4RAZA 1L0OC 1XCBA 4HV6A 2DI3A 3TDZC 1JGSA 3KP7A 3LSTA 5AIQA 2JPBA 1C0WA 1G3WA 2RQPA 1I1SA 3MMLB 4ENJA 3FXUA 4EMSA 4M1XA 2DBBA 4FX4A 1J75A 4EM0B 3BP8A 4CYDA 1FZPB 4NQWA 4HDUA 1NHAA 1L3LA 1YW7A 1IRFA 3BUEA 3J80K 1KU2A 2L4MA 2E2HA 3RKWA 3HOTA 3GYHX 2QUFA 5HVQC 1MGTA 4G94A 3GTJA 3FF5A 5HDGA 4BAYA 1WSUA 4IF4A 4GTEA 2PN6A 4UV9A 5KK1A 5BQTA 4LLNA 3HHHA 5JVTA 2IRFG 2P5MA 2HTSA 1XSXA 4KMDA 4P5AA 4OIRF 1WI9A 1ZLJA 1ZG1A 3RIRA 1XMAA 2HZTA 3H0GA 2BE5F 2VUMA 3BJOA 1IRGA 3HOSA 1RZ4A 1FSHA 4KM8A 3KP4A 1CGPA 4RGUA 4KATA 2G9WA 5HOOA 1KQ8A 1S8NA 2EK5A 1Z6TA 2HYFA 3ZP5A 3H3ZA 4PZJA 4CXFA 2O03A 4HYEA 3F6VA 1FPQA 5CHPA 3E97A 4OMZA 2IVMA 3MEXA 4XRFA 2O6GE 3M8FA 4HF1A 4ESBA 4ZYEA 2RDPA 4UXNA 1JXSA 1ODDA 3HRUA 1BN5A 1SMYF 4XLNF 4ESFA 2F5DA 4N0BA 3L2CA 2MH9A 2E1NA 2RC4A 1ZG3A 1IUYA 4LK1F 5DUKA 1AWCA 4U88A 2HR3A 2H09A 3K0LA 3TQNA 2QBYB 1O7LA 3CJNA 4XBFA 3ISPA 1SD7A 3B73A 3V7CA 4QWQA 1IN6A 1RI7A 3SZTA 3BPVA 5E1ZB 3GF2A 4R1HA 1FNNA 2V9VA 4HF0A 4EGYA 2EWNA 1O2AA 4IJAA 2Q8KA 1LQ1A 3CTAA 4BHCA 4LQYA 2D1HA 1IN5A 5FLXK 3F8FA 3J80Z 2K27A 3WGIA 4BKWA 2FA5A 2WWYA 1T6SA 2CSOA 3ZMZA 1MJBA 3O2PE 1MZBA 2JA6A 5IT9K 5IOSA 2GQQA 1XGSA 2JH3A 2DLLA 4I09A 1SFOA 3EDPA 2FMLA 1Z05A 2RN7A 2KJBA 2W57A 2JA7A 3C1DA 3QPTA 1YFHA 4ZYDA 4J3NA 1W5SA 1QZYA 2M45A 4BQAA 1YLFA 3LQQA 3TDUC 4YFXF 5E17F 2JA5A 1H9TA 4CGZA 3RKYA 2PMHA 5D8LB 2XCOA 4KT5C 2K4JA 3DFGA 4EJTA 4N9HA 3IHUA 1DPUA 3V7RA 1KU3A 2HKXA 5EEHA 4MHGA 4XSXF 1TLHB 3VOEA 1WQFA 1B6AA 4L0YB 4JK1X 2GSNA 4RS8A 2HTJA 4G6QA 5ILVA 1OYYA 4UUVA 1BGWA 5D4RA 4FM9A 4L9TA 3ABUA 1I50A 3CQZA 4PGHA 1FC3A 4GO1A 2WC2A 3ULQB 4GTAA 2DTRA 3WTUC 1RUOA 1PUEE 1ZYRF 1ZLKA 3IKVA 1W7PA 2ETHA 2KJCA 2XKOA 3I71A 1P4XA 1R9TA 3EYYA 4G9YA 3LAPA 1EH8A 4MGRA 2Z99A 4JBAA 3FMRA 4B8XA 3GZ5A 2VBXA 5LGNA 4N9IA 3ZPLA 4L0ZB 3QAHA 4XSZF 4GCVA 1MJ9A 3O3KA 5CLSA 3ZMTA 3M8EA 2E2IA 4HZFA 2P7CB 4P5BA 3LWFA 1XXAA 3F8NA 1FBUA 3I54A 2H6BA 3VA7A 2IA1A 3BDDA 4S04A 3WODF 4GGGA 4GTCA 3GFIA 3LA2A 2R3SA 4G0UA 2CO5A 3E6BA 2RKHA 1S7OA 3FMQA 5CVUA 5L3DA 1IXSB 1OYIA 1TWGA 2PBIA 2VODA 1KU7A 2OZUA 3EQLF 2YSRA 2ISYA 2VT2A 1B59A 2HQNA 1TNTA 5A2QZ 3CO6C 2C6YA 1E17A 5L3EA 2GSOA 1S3JA 4RGRA 4EJUA 4MEXF 3K9TA 3NRVA 4A0YA 1W7PB 4LK0F 3JTGA 4FX0A 2DFIA 2FF4A 2DK8A 4Q4ZF 2Y0MA 4I98B 3N3YA 1FYKA 2EV6A 4KN7X 3B02A 3S0XA 2W84A 1K6OA 3OOPA 2ZNZA 3WG9A 1FOKA 1EH7A 1FSEA 2HFHA 3COAC 1DDNA 1HQCA 4DQ2A 3J7AO 1YS7A 3HRTA 3VB2A 1I6XA 1T38A 3FM5A 1IAWA 4KMAA 2NS0A 1P92A 3KP2A 4U0VA 3TKYA 2MH2A 1O27A 3OEPA 5D4SA 4GFQA 2HKOA 3CLOA 4F7ZA 2YX4A 2QZ8A 2Z9OA 2OZ6A 1ZRDA 2D2WA 4IHTA 1WWXA 3LA7A 1QZZA 1F4KA 2RNJA 3Q5FA 1BI1A 3U1DA 2XRNA 1X3UA 2M1BA 1D8KA 3IC7A 5TJ3A 1BJTA 1OKRA 4C3JC 4Y15A 1KQ0A 5BS6A 1FWZA 4KIGA 2BYVE 4BLAA 4C2MC 2FEZA 4KB4A 3T5XA 4ZH4F 4BLBA 1B9NA 3GVAA 2MLGA 4FT8A 4EJWA 2JT1A 1G3YA 2CW0F 4A6DA 4OINF 1R5GA 4YFNF 1OPCA 3MWMA 4Q47A 1HSJA 3F8BA 2BGCA 3Q9SA 1ZVUA 3DP7A 2H27A 4P55A 2TDXA 3GTGA 3IL2A 4CO8A 3HTUA 3KP6A 2KRFA 3KE2A 5FB2A 3GFJA 3Q3QA 2P8TA 1RUNA 2L01A 1HXDA 3C3WA 5LRSA 5CJ9A 3FMSA 2NVXA 2CFAA 4TV7A 4ENMA 3GFLA 1J9IA 3DEUA 5LGUA 4ETSA 1O2BA 2GAUA 2LSOA 2GWRA 1LDJA 4HA8A 3GTPA 1F9NA 3L4KA 4L9VA 2E7XA 3WE3A 4KMHA 2IA0A 1GE9A 5DEQA 3G4CA 4LGWA 5CVRA 3ZMUA 1H0MA 5IOTA 5BOXA 3SZPA 1FLIA 2MLKA 4P9UA 3WTWC 4G7HF 1KQ4A 3OV8A 5TJJA 4IHSA 3QU6A 1G3SA 3E3VA 2F5CA 2HOEA 3HYIA 2NVYA 5LLQA 2KWAA 1AB4A 5FFXA 4DDQA 3L4JA 4UNOA 2RH6A 2A07F 1W5TA 4I2OA 2EJRA 3ECHA 1RIOH 5E20A 3M9AA 4EM1A 5LRRA 3IWFA 1IXRC 3SQNA 3WTVC 2FOKA 3D0SA 5DCMA 3RYRA 4OOIA 2A68F 2ZFZA 2OBPA 1KQ9A 2EFNA 4KIBA 3WTZA 2DW4A 2FU4A 4IRIA 3ZMSA 1QGPA 3BZ6A 5LHIA 3GUDA 1KGSA 1LDKB 3P7NA 3VEPA 2O3FA 4CICA 1XSDA 3P9KA 1HBXG 3G3ZA 1XD7A 5BPIA 4KDDA 5D5VB 2LNBA 1HKQA 3T1BA 5IOQA 4EJOA 4ENKA 2A5YB 3WTXC 4ASNA 4KFCA 2FQ3A 4H0EA 1TQIA 2KKOA 5LHHA 4LJZF 3U9GA 1XGOA 1P2FA 2O8XA 2P5LC 1IW7F 2VBZA 2BV6A 2GSUA 2L54A 1MD0A 3EETA 2XV4S 4A5NA 2DAOA 5J8CA 2J5PA 3SXYA 4FZBA 3QPHA 4BXUA 1USTA 2IJLA 3N0CA 3M7GA 2RGRA 1J2XA 5FGMA 5HLIA 2G7UA 1SD5A 2YPRA 2VC1A 2XAJA 2XAFA 1TWAA 3GTMA 2LF7A 2Z33A 1FBQA 4BHBA 5EGHA 2PHCB 5EEGA 1XXCA 2HGCA 3R6SA 2F5FA 1BI0A 3K2ZA 1ON1A 5DCFA 2XCRB 1WQHA 1UHMA 3F72A 1ZH5A 3ECOA 4KARA 1FP1D 2HYGD 4RGSA 3GZ6A 3WU1B 1YIOA 5HS9A 3ZMVA 2OA4A 2W24A 3F8MA 1P4AA 1FP2A 5DD4A 3WTTC 3T8RA 4FHTA 2RVCA 3WGHA 2K02A 2P6TA 1SD6A 4PCQA 3LAJA 4IPAA 1O3QA 1Z1DA 5ICFA 4A0XA 1K79A 3CAGA 4LMYA 1YW8A 1GHCA 5BPDA 2QYOA 2VN2A 5LBQA 5HDKA 4K2EA 4BNCA 4EVIA 2QQBA 1F5TA 2P4WA 2JTVA 3N4MA 4KB2A 3M1EA 3HSFA 3GTQA 1O24A 5CVIA 2FBKA 1R22A 2ZJ2A 5JFRA 3TO9A 1J59A 1KYWA 2VBYA 1U3EM 2X0LA 1ZAOA 2CWEA 4YFKF 1T0FA 3FWEA 3EUHA 4UVBA 4GTLA 4A2UA 2LKPA 1XCVA 3TO6A 5K1YA 3RI4A 4YIFA 3GEZA 4EM2A 3CDHA 2EFWA 5JI6A 4Q5SF 3H3UA 4IVNA 2ADUA 1JHHA 2JPCA 2ELHA 1GXQA 5ICCA 1S29A 2AS5F 3RPQA 2A3SA 2VBWA 3RPUA 1YG2A 4OIPF 3LQRA 3L00A 2VOOA 2FBHA 4YG2F 2ISZA 2K7LA 3FOEA 3ABTA 4WF2A 2W85A 3GW2A 2FNPA 1V3FA 2M87A 3JAMZ 3MZYA 4L9NA 1TW2A 3RKXA 2GZWA 5DYMA 1HKSA 1J7KA 5FLXZ 2QBYA 2EA4A 2XKPA 4ZYHA 3I4PA 4EQQA 3ZMDA 1J0RA 5K5RA 2RGVA 1KA8A 1BI2A 1E2XA 3HUGA 2R92A 2M5WA 5BMZA 1EH1A 1IF1A 1G6NA 3BWGA 1PDNC 2QQ9A 4KASA 1HSTA 5HLHA 4KAWX 3CUOA 2L02A 1O26A 4NB5A 1I3QA 3QRFF 4KICA 3C18A 2J5OA 3F3XA 4M9XA 3PFIA 5FD5A 3KZYA 1XB4A 2QWWA 3NQOA 4UVCA 5CVJA 3E6DA 1YQAA 3I5UA 3JSOA 4HQEA 4A6EA 2UXNA 3ZQ7A 3K1MA 1LB2A 2KIUA 2EV0A 3N0BA 1YS6A 3KEOA 5LEJA 3RDIA 2NNYA 2FXAA 1IN7A 4NHJA 3PQKA 3ZN0A 1G4DA 4HQMA 5HS8A 4OIQF 2CYYA 2VONA 3KFWX 1BBYA 3P9IA 1O3TA 3Q9VA 3V8LA 4ZZLA 3V4GA 4L5IA 4ON0A 3FX3A 2Y3PA 5L3FA 1V4RA 1IN8A 2V79A 1TQPA 3DF8A 1Y1WA 2K4BA 4HX4A 4HF2A 3GLXA 3NUHA 2DPDA 4EV0A 3V7SA 1P6RA 4OU0A 3IWZA 1WRJA 1RNLA 4M9ZA 3ML6A 1UHWA 3I58A 4LB6B 5IT9Z 3R0JA 3ELKA 3GTKA 1O57A 1U6GA 1KU9A 1G3TA 1PP8F 1XSVA 4KN4X 2GIVA 3MAJA 3PQJA 5F64A 1BOAA 3ERED 2ZXJA 1D5VA 1O29A 2R7DA 2DQRA 3DV8A 2GA2A 5FO5A 2PEXA 4IRGA 2OQGA 1S7AA 4GTBA 3GO5A 4A0ZA 2Y75A 5D6EA 4G7ZF 1B4BA 3BPXA 2Q0OA 5HDNA 4L9JA 6PAXA 2YR2A 4HV5A 3DPTA 1R36A 1IS1A 2COMA 1F1ZA 2VC0A 2HS5A 3E5UA 1VTNC 1YYVA 4AD9A 1QPMA 4DNCA 3HIFA 1O28A 1K78B 4KM9A 2E1CA 4P96A 3E5XA 4GYGA 4UVAA 1FYLA 2ZFWA 3KLOA 3V8JA 3WGGA 4LD5A 4PDKA 1XGNA 4UHTA 1WCMA 2L3DA 3JAMK 4M71A 4M6XA 4G0VA 5CYVA 4HAMA 4I02A 3HSEA 2D1VA 1XGMA 2P6SA 1R00A 2ESNA 5F6FA 4MTDA 2A6EF 2DU9A 5HS7A 3J81K 2UXXA 3NEUA 5DCMB 1R58A 4KA4A 1HKTA 2STTA 3AAFA 4MTEA 1XN7A 1MDMA 4EGZA 1FYMA 5H20A 1DD5A 2XAGA 2PLYA 4ZZDA 1MJAA 5ICEA