1B4AA

Structure of the arginine repressor from bacillus stearothermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
GQRHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYKYSLPSDQRFNPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the arginine repressor from Bacillus stearothermophilus.
pubmed doi rcsb
molecule tags Repressor
molecule keywords ARGININE REPRESSOR
total genus 38
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1b4aA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1b4aA02
5JVTA 1HW5A 2IP2A 5CVRA 3KLNA 3GEZA 3HHGA 1IN5A 2IW5A 3V8KA 4EMSA 3FOEA 4A6DA 3AAFA 1FBSA 2A07F 1YYVA 1WRJA 3O2PE 3T8RA 4KB4A 4N9HA 3COAC 1UHMA 1O3QA 3BROA 3ERED 2AXLA 2EFPA 2QZ8A 2MD5A 3REOA 2V79A 3E6BA 2YSRA 1GHCA 4S05A 3MEXA 5E1XA 3FMQA 1XDSA 1EK8A 1HQCA 4YFNF 4QWQA 2VOPA 5BQTA 5K5OA 1BC7C 2IA1A 4A0XA 3RI4A 1U78A 1ZAOA 5HS9A 2Z9OA 2H94A 3DPLC 4OINF 1OPCA 3TOAA 1Z05A 2GA2A 5D6EA 1R23A 1WWXA 1LJ9A 1OKRA 4DDQA 4A2UA 2O61A 2W84A 2EFWA 4HOBA 3OPFA 1FNNA 1EH1A 3T8TA 2L3DA 4WXCA 3KETA 3BOQA 4WF2A 3BJAA 1QO0D 2KJCA 4L0ZB 3R60A 4EM0B 3R0JA 2DT5A 5HLIA 3F22A 2ZMEA 1CGPA 1PDNC 4L18B 5ERIA 3L7WA 3W6JB 3HRTA 4BYYA 1F9NA 2GWRA 5K5RA 1YTYA 3NEUA 3U1DA 4ENKA 2HGCA 2MLKA 1B59A 3BJOA 2STTA 2FU4A 4G0UA 2WV0A 1GE9A 3E5QA 4NHJA 3B73A 5EEHA 2ZMEB 3WTXC 3E5UA 2CW0F 3ZMZA 2RGVA 3OOPA 2KIFA 3F8BA 5H6RA 3LFKA 4G8XA 2E7WA 2MH9A 4ENMA 3ULQB 1SD4A 2D2WA 1HKTA 3RIRA 1J5YA 5FFXA 2V6CA 3CJNA 2XHKA 4LFUA 4B8XA 1B4BA 3Q9VA 4J3NA 1J9IA 3RYPA 3TQNA 2A61A 4PGGA 1KU3A 4R8HA 4WX9A 4UV8A 2WC2A 2XASA 3MCZA 1UFMA 5DDGA 4RB0A 1WQ2A 4IRGA 1T39A 3EETA 2YU3A 1SMTA 3ECOA 1PP7U 1OYYA 1U3EM 2LDUA 1JE8A 5D8LB 3KE2A 4EM1A 1W5SA 3IL2A 5K1YA 3MFKA 1BJTA 1WSUA 1O7FA 3JSPA 3CO6C 2Y48A 4KFCA 2HYFA 1FLIA 5IT9Z 3GO5A 2PBIA 4BNCA 5L3EA 1XGSA 5HDGA 4M6YA 4KC6A 4RAYA 2EFQA 4EVIA 1ZGAA 5LHHA 1IXCA 4R1HA 4HW0A 3CUQA 2DPUA 1XXAA 4GFQA 4P96A 4OIRF 1XMAA 2XAFA 2Y0MA 2L54A 4N0BA 1OR7A 3H3ZA 3F8NA 3MZHA 4L5JA 2EJRA 4IRHA 2RN7A 1Z6TA 2EB7A 1P4XA 3M8EA 1IUYA 2G7HA 3FXRA 2EA4A 1XN7A 3V7CA 2RC4A 1T98A 3L4KA 5E8IA 4U0WA 5D8KB 3OEPA 1AWCA 4LLGF 5DD4A 2A68F 3V7SA 2P4WA 1U6GA 2HTSA 4AIHA 5ILUA 4JQFA 3BY6A 3KP5A 3RYRA 3EQLF 2XAJA 1FPQA 1K79A 4PZJA 2QQAA 1LDDA 4ENNA 4CO8A 3EYYA 1TW2A 3QP6A 3L9FA 4EM2A 5JR3A 2M87A 2VONA 5E20A 5J8CA 2IRFG 3P7NA 3LA3A 4ON0A 3GZ5A 3R6SA 2UXNA 4U7DA 1G3SA 4XSXF 1YW9A 2HZTA 1KU7A 2VT2A 4WXDA 5E18F 4Q5SF 5AONA 3LWFA 1XGOA 3SFZA 2QBYA 3HIFA 3F8MA 5H6QA 3HOTA 1GXQA 2RV8A 1XD7A 2EV0A 1D3YA 2KWAA 1P4AA 3IKVA 1MDMB 2FF4A 5LGUA 4GO1A 2ELHA 3J80Z 4HQMA 1J7KA 4KIGA 1BBYA 2QM3A 1EH6A 1EH8A 4KAWX 1MZBA 1FBUA 3GLXA 1FC3A 2J5OA 4WXHA 5EEGA 3DQVC 1BI1A 1TTYA 1XXCA 1PUEE 2V1XA 4UVBA 3F3XA 1ZRCA 2V9VA 4OIOF 4MTDA 2VXZA 3J81K 3KP3A 1SD6A 3F8FA 5JVOA 4CHUA 4KN4X 3LQQA 2X4HA 4IF4A 4A5MA 2IT0A 3QOPA 3GUDA 3QX3A 2CYYA 4MQ9F 3TKYA 5DEQA 1FYKA 3ZMVA 2E1NA 4L9JA 2QWWA 1IXRC 1IW7F 4M9XA 2EFNA 5JI6A 4HF0A 5KVRA 1BJAA 5K5QA 4U0VA 3WTWC 2HKXA 4I0BA 1R1TA 2KIUA 3QRFF 1K78B 3NQOA 2VOOA 1R22A 2Q2EA 3KP7A 3QPTA 2ZBKA 3N97A 1G3YA 1FBQA 2JRTA 2OA4A 4HA8A 2O03A 1SD5A 4M9SA 2A6EF 4E70A 2MA3A 1UCRA 2DU9A 5JFRA 3M7GA 4OOIA 4UXNA 2GQQA 1SMYF 1TQMA 3G3ZA 4TV7A 2VC0A 3TOBA 1RUNA 2PN6A 2KJBA 2F2EA 4IHTA 1O3SA 4ZYEA 1OYWA 2GIVA 3VFZA 3OV8A 3M1EA 5A2QK 1W5TA 2P6TA 3K9TA 2HR3A 4U0YA 1W7PB 3KCCA 2CQKA 3IWZA 2RGRA 3WE3A 2QQBA 1ZG1A 3NRVA 1LNWA 3DV8A 1YQAA 2UWMA 4EV0A 1D8JA 2RDPA 2DK5A 2ESNA 2NYXA 3E5XA 3ISPA 5AIPA 4YFKF 2PJPA 2O3FA 1HSTA 3LAJA 5DUIA 2QYOA 3LA7A 3DKWA 1XMKA 1MGTA 2P7VB 4GCVA 3WGGA 2A5YB 5CLSA 3EYIA 3DP7A 4GYGA 5D4RA 2YR2A 4LD5A 4MTEA 4LGWA 3GZ6A 1UHWA 1BC8C 4MQVA 2V1DA 4XRFA 5FLXZ 3JAMK 4UNOA 3DF8A 3PFIA 4ESJA 3L4JA 2RVCA 4MEXF 5DCMA 4PDKA 3KLOA 3C3WA 5BS6A 3S2WA 5HDKA 5LRSA 2PHCB 2COMA 3ZN1A 4BHPA 3WTYC 1TW3A 2HKOA 3R4KA 5HLHA 2AS5F 1TNTA 4K2EA 2NRAC 2ETHA 4I02A 3I54A 4M72A 2NNNA 2FQ3A 1ON1A 2Z3YA 3PQKA 2VBXA 4XLPF 3LAPA 1L0OC 1R00A 1QGPA 4RGUA 1BIAA 3BP8A 1YW8A 4Y15A 3CUQC 4LG0A 4A5NA 3QU6A 3FMSA 1FOKA 2F5EA 4I7HA 4HLXA 2XKPA 4P9UA 4RB1A 5FD6A 1T38A 5F6FA 1TLHB 1IAWA 1GVJA 3VB2A 1BOAA 1IN4A 1O7LA 2ZFWA 3T1BA 2QQ9A 1W7PA 2ZO4A 1HW2A 4KIFA 4IVNA 3FOFA 2IA2A 2DAOA 2DQLA 3HRUA 3JAMZ 2EV5A 1DPRA 1E2XA 1FSEA 1R7JA 4MGRA 1B4AA 3KEQA 4HF2A 3F21A 5DV5A 1CF7B 4RS8A 3K0LA 3KZYA 3F8CA 2DBBA 4XSZF 1KQ0A 4P9FA 4ASNA 1XB4A 4OMYA 2FNPA 4ESBA 2XAQA 1HBXG 2HTJA 2HWVA 3RDIA 1EV7A 2J5PA 5F64A 3LPXA 4HX8A 2FNAA 4PCQA 1HKQA 4G7OF 5E1WA 2EA2A 3IRQA 3K1NA 2W57A 2RNJA 4I01A 1K7AA 5H20A 2HS5A 2PLYA 4Q47A 1QPMA 4KICA 1S8NA 3ZP5A 2DLLA 1ZLJA 4A0ZA 2FRHA 3SQNA 2QENA 4G6DA 4KDDA 4HZFA 3HTSB 5FO5A 2WWYA 5J8FA 1Z91A 4AVPA 1FT9A 2OAZA 2JTVA 3VOEA 1FYLA 1SFEA 1QBJA 5FGMA 3E6DA 2FMYA 2TDXA 3C7JA 1X3UA 4BHBA 4IXAA 3O3KA 2D45A 1I1GA 3MAJA 5CJ9A 3ZMSA 2MLGA 2P6SA 2OBPA 2XUBA 2XCOA 3KP4A 3QPHA 1FWZA 1I1SA 2Z33A 2VBZA 2GXGA 1WI9A 1P92A 4EJWA 2JZYA 3FMRA 4A0YA 1ZH5A 4M6XA 1S7OA 3MQ0A 4IRIA 3TO7A 3C1DA 1BI3A 2PQ8A 1D8KA 1YIOA 4WWCA 2QVOA 5HVQC 3RPQA 1FP2A 1XSVA 2MBFA 1TBXA 4G7HF 4JK1X 1Z1DA 1R58A 3LSTA 2Y3PA 5FFZA 5LBQA 4A12A 4I2OA 1A04A 1B1BA 2OD5A 1HXDA 5L3DA 3J81Z 3WE2A 3GW2A 2VODA 1TNSA 4L9TA 1U8RA 3J7AO 1MD0A 1SAXA 1CF7A 2ISZA 1F4KA 1MJAA 2K02A 1V3FA 1MJBA 2EK5A 1S3JA 2GA1A 3FXQA 3ZMUA 1R36A 1DDNA 2EFOA 3WGIA 2BE5F 4ZZDA 3LA2A 3FHZA 1T2KA 2K86A 2W25A 4R79A 4AIJA 4G94A 3WTUC 1I6XA 1H9TA 5HDNA 2L01A 2HQRA 2LNBA 4RAZA 3TO9A 3CAGA 3HTUA 1Z9CA 5L3CA 3G73A 1LDJA 4M74A 2NAZA 4DQ2A 2EV6A 2YX7A 2D1HA 4L5IA 5L3BA 2RQPA 3K2ZA 2V1UA 4M71A 6PAXA 2F5CA 2FEZA 1LEBA 1ZHFA 1KGSA 2VN2A 2ZKZA 1WIHA 2IPQX 1USSA 2VE9A 4D0PA 4HAMA 3HRSA 3HUGA 4HF1A 1ONVA 1YO5C 1S6LA 2CGPA 2K4JA 4HDUA 2Q0OA 2XKOA 2DTRA 1EH7A 4G7ZF 1XGMA 1JGSA 2Z99A 4NQWA 5D5XB 5LHIA 2PMHA 3GFMA 3TO6A 4GGGA 3V8LA 2OU2A 3O6BB 1ZRFA 2XROA 4NB5A 5ICGA 1JXSA 1FY7A 2H6CA 4OIPF 1QNTA 2KIMA 2L4MA 5AIQA 3NUHA 1B9MA 3N4MA 1XCVA 4BH9A 2PG4A 1WQHA 2Y75A 3KZZA 5DYMA 1REPC 2M5WA 4KT5C 3FM5A 1H9GA 2XVCA 4ZZLA 2JSCA 5LLQA 4ZYHA 1QZZA 2ZJ2A 3HYIA 3GFLA 2P5MA 3I53A 3F23A 2OZ6A 2P5LC 1IRGA 1TQIA 3D5LA 5JHUA 4ZYDA 1PP8F 1FZPB 3PQJA 3E3VA 1I27A 4ETSA 3RKXA 5ILVA 5A2QZ 3GWZA 2WTEA 1U2WA 2XCRB 3CLOA 3GXOA 2IA0A 1U5TA 5ED4A 3U2RA 1J75A 3TDUC 4KNYA 2UXXA 5L3FA 4AIKA 4CXFA 4Q4ZF 4EGZA 2W24A 3WTTC 3RKWA 1ZG3A 3QP5A 2F5DA 3HSRA 1Q1HA 4RGXA 4YIFA 3MWMA 2HFHA 3J80K 3KP6A 5ICCA 5LEKA 1USTA 2MC3A 2F5FA 2H09A 3L09A 4CDGA 3WG9A 3Q9SA 1DD5A 3K69A 2K27A 2KKOA 2IJLA 3HHHA 4B09A 1ZREA 3LQRA 2FBHA 1ZRDA 1S29A 5BPIA 3K1PA 4HX7A 3L2CA 1RIOH 3ROUA 3TGNA 2E1CA 3IHUA 2BBYA 4LJZF 4YFXF 1P6RA 1FP1D 4FT8A 3I5UA 4EJOA 2K4BA 4JBAA 3OREA 3R61A 2EWNA 4BAYA 1XSDA 2XAGA 3SHFA 1WQGA 2FBKA 1SFXA 1AB4A 1F5TA 1WKMA 1IS1A 4G0WA 4KA4A 2Z5UA 2NNYA 2M30A 3E6CC 1ON2A 3K1MA 1DP7P 4XLNF 3JTGA 1P2FA 3F6VA 2O6GE 5HLGA 5TRDA 5D5VB 4YG2F 3ZQ7A 1IXSB 4O3MA 4RB3C 2DI3A 1J0RA 5FB2A 4Y13A 3WTZA 4ESFA 1G4DA 2M8EA 1LQ1A 3I4PA 5BPDA 3L00A 2HEOA 3KEOA 3GVAA 2O0YA 3BJ6A 3ABTA 2XIGA 2R7FA 4U7BA 2FE3A 2HQNA 1ODDA 2P7CB 3T0YA 2XGXA 1BGWA 1LB2A 1R1UA 5HS7A 2XCQA 1F1ZA 3KP2A 4KDPA 1MJ9A 3WGHA 1DPUA 4WCGA 4UVCA 2VBWA 1W7PD 3GYHX 2GAUA 1KU9A 2DPDA 1MDMA 4I0AA 2ISYA 2PFBA 4HBLA 1U5TB 3IRRA 4G0VA 4PGHA 4WK8F 3I58A 4P5OA 5E8GA 4KYWA 2GXBA 4LB5A 5D5WB 3MZYA 3VODA 1OYIA 1BM9A 4YIIA 3EDPA 4ZYGA 5E17F 5BMZA 3ML6A 3DPTA 3BPVA 4FM9A 1P4WA 1FYMA 1G6NA 4M73A 1YG2A 1RUOA 2X0LA 2PI0A 4Y17A 1UB9A 2BV6A 3V8JA 1QZYA 4A6EA 5IT3A 5LEJA 5D6FA 3CUQB 1VTNC 4Z2YA 4FX4A 5E1ZB 3ZN0A 3D0SA 1ULYA 3F6OA 3FZVA 4KIBA 1MKMA 2ZFZA 2IVMA 2W85A 2PEXA 4HDVA 1L3LA 1XXBA 1E17A 1NHAA 3DFGA 3MMLB 3U9GA 3RTRA 1ZYRF 4UVAA 1C0WA 2FA5A 1GXPA 2M1BA 2ACJA 3GF2A 3H3UA 2H27A 4CGZA 4HYEA 3E97A 1Z6RA 1W4MA 3CTAA 4IHSA 4HLYA 4UUVA 4OU0A 2R7DA 3W6KB 1IZ1A 4LG0B 1J2XA 2A3SA 5ICFA 1BIBA 4MNUA 4H0EA 2HDCA 1ZVUA 2XV4S 1XCBA 4LB6B 1O3TA 2ZNZA 2BYVE 2E7XA 2M45A 1KYZA 1T0FA 3RKYA 2FMLA 3VEPA 1K78A 1LDKB 4EJVA 3WTVC 3SXYA 5CVVA 3CUOA 1ZARA 2JPBA 3P9CA 3BPXA 5FLXK 4HX4A 4ZH4F 1YW7A 1YS6A 3I59A 1O57A 4KN7X 1V4RA 2CSOA 5ICEA 2CO5A 4MHGA 1HKSA 1RZ4A 2QBYB 3BWGA 1YS7A 3CO7C 4CYDA 1YLFA 2VBYA 3C18A 1SFUA 5BOXA 1G3WA 4L9NA 1ZG5A 4RGRA 5CVIA 1H0MA 3JSOA 3M8FA 3FM3A 1OMIA 1B6AA 4RGSA 2Q8KA 5HOOA 3IWFA 2VC1A 3GX4X 4DNCA 2VE8A 1XSXA 2LF7A 3GFIA 4XBFA 2YPRA 2QUFA 1IF1A 2STWA 1G3TA 2L02A 4BXUA 2ESHA 4LMYA 1HW1A 4BQAA 1T6SA 3KFWX 4S04A 3HSEA 4HV6A 3SZTA 5HS8A 1STZA 2UZKA 1TQPA 3I64A 3QAHA 2ZNYA 1IN7A 3FXUA 1U5TC 5CVJA 3B02A 2FSWA 2VT3A 3BDDA 1S7AA 5FD5A 2C6YA 1Z7UA 1JHHA 3FF5A 2DQRA 3DXJF 4LLNA 3QU3A 1FSHA 3RPUA 4N9IA 4UV9A 3JTHA 1KQ9A 3ZMTA 3WU0A 4GYIA 3SZPA 4EJTA 4QLCU 3H92A 4LK1F 4KUMA 5CVUA 2OQGA 2XAHA 2FOKA 2DK8A 3ZMDA 4BHCA 3RJPA 4IJAA 3WU1B 3V7RA 2DW4A 1J59A 3EUHA 4HQEA 3P9IA 1RNLA 3F72A 1AOYA 4MEYF 3CDHA 2KRFA 1O3RA 2K7LA 4RB2C 2FBIA 3GFJA 4F7ZA 4KMFA 4KMUX 3HSFA 3P9KA 2R3SA 2HOEA 1LVAA 5LGNA 2ADUA 4FHTA 2XRNA 5J6XA 3I59B 1YFHA 2ZXJA 4L0YB 2P5KA 2B0LA 4O5VA 5IT9K 1D5VA 1HSJA 1QQIA 2P5VA 3HRMA 2YX4A 2MH2A 3IC7A 4EJUA 3ZPLA 2G9WA 1R1VA 1ISEA 4O6JA 3WTSC 2PMUA 3Q5FA 4OMZA 1WQFA 3VA7A 2LKPA 2JPCA 3BZ6A 4EQQA 3M9AA 5TJJA 4OIQF 5D5UB 2ZCWA 2G7UA 4CZZA 1XDUA 2HYGD 2DFIA 1RI7A 4L9VA 3ABUA 1IRFA 3I0TA 2D1VA 2BGCA 3IKTA 2H6BA 2DO7A 2RKHA 4GXOA 4M9ZA 1JHFA 4KB2A 4Q48A 5DCMB 3TDZC 3V4GA 5KK1A 1BI2A 2P8TA 2L4AA 4I09A 4LLLA 1SD7A 5LGTA 1FX7A 3JW4A 1Y0UA 5LRRA 1KYWA 4G6QA 2JT1A 4HV5A 5L3GA 2LF8A 5DD8A 2O8XA 4EGYA 1I5ZA 3ECHA 1R5HA 4IPAA 1BI0A 1LEAA 5DCFA 2CG4A 3ELKA 4P55A 2BEOA 4LK0F 3R0AA 2OZUA 3FWEA 5D4SA 1KQ8A 1XGNA 5LHGA 1BN5A 3WODF 4AWXB 2A69F 2FXAA 3FX3A 5DUKA 3E6MA 4UHTA 1B9NA 1KU2A 3I71A 1KA8A 3T5XA 2OQRA 4CICA 1IN6A 1ZGJA 4I98B 1R5GA 3HOSA 2QLZA 1ZLKA 1DUXC 2LSOA 1ZN2A 2GZWA 4AD9A 2CWEA 5ILSA 4FX0A 1K6OA 3DEUA 5CYVA 4ENJA 2NS0A 2A6HF 5F1RA 4U88A 3BUEA 1IN8A 4G9YA 2CFXA
chains in the Genus database with same CATH superfamily
4B43A 1W1WE 5JVTA 3OYHA 3HOXC 1HW5A 2IP2A 4BLBA 2CU7A 2QSFX 2AQFA 3S3NA 5CVRA 3KLNA 3GEZA 4FE4A 2DT7B 3HHGA 1IN5A 5E3NA 2E2JC 2IW5A 3V8KA 3LSIA 3GTPJ 4EMSA 3FOEA 4A6DA 4KITB 3AAFA 5IOSA 4KMHA 3ZOBA 4DZPA 1FBSA 2A07F 1YYVA 1WRJA 3O2PE 5FKOA 3T8RA 1JKOC 4X6AJ 4PAAA 4KB4A 4N9HA 3COAC 1FIAA 1WH7A 4N4NB 1UHMA 1O3QA 3BROA 3ERED 2AXLA 2X1DA 2EFPA 2QZ8A 2MD5A 3PIPF 3REOA 1IJWC 1F7VA 2JMWA 2V79A 2R7ZC 4AC0A 4BACA 3E6BA 2YSRA 2IGKA 1TWFC 2LREA 1RKWA 1OFCX 5EZGA 1GHCA 1SC7A 4S05A 4UUTA 3MEXA 1G8XA 2FJ1A 1I39A 5E1XA 5EYRA 2F5VA 4XSZA 3FMQA 1XDSA 3VWBA 1HQCA 3GTMJ 1EK8A 2N8GA 4YFNF 3DPUA 1JT6A 4QWQA 2VOPA 5BQTA 5K5OA 1X1DA 2IA1A 4A0XA 3RI4A 1BC7C 1VJEA 2DOAA 5E79C 1U78A 1ZAOA 5HS9A 2Z9OA 2H94A 3DPLC 1QVTA 4OINF 3S1RJ 1OPCA 3CD6I 2NVTC 2E19A 1X3ZB 3TOAA 3RSNA 9ANTA 4YEJA 1Z05A 2GA2A 2HU9A 5EG0B 2BVLA 1K4TA 2QA4I 5D6EA 1R23A 1WWXA 1D0YA 3S1NJ 3I3LA 1LJ9A 4C2MK 1OKRA 2HVSA 4DDQA 3K4MA 4A2UA 2O61A 1VQLI 3BCAA 2W84A 2M0MA 2EFWA 3GTMC 2VJIA 1IC8A 4QTRA 4HOBA 3OPFA 4P9SA 1X19A 1FNNA 1EH1A 2HNHA 3T8TA 2L3DA 2NXNB 2X6OA 2NVTJ 1I6HK 4WXCA 1YJWI 2XPVA 4LIVA 3KETA 3BOQA 3BR2A 4WF2A 3BJAA 5D4DA 3M3YC 1QO0D 2KJCA 2PMZN 3AKZA 1JT0A 2QCOA 4L0ZB 2BOLA 3BR0A 3R60A 1Y1VC 4EM0B 3HG9A 3R0JA 2DT5A 4A3BC 1NK3P 1EJ9A 2CUFA 3LL7A 5HLIA 3F22A 3H0GA 4GT9A 2ZMEA 1CGPA 2IAIA 4DW6A 2QEXI 5C3EK 1PDNC 4L18B 5ERIA 2PX9A 3L7WA 3W6JB 3HRTA 4BYYA 1ETQA 3DKXA 1F9NA 1JUMA 1A6IA 4NNJA 4GDFA 2GWRA 5K5RA 4XQFA 3NEUA 1MW7A 4ITVA 1YTYA 3U1DA 3TW6A 4P5BA 3RQIA 4ENKA 1WCMC 2HGCA 1B8IA 4E4HA 1K83K 1Y1WA 4NOIA 2MLKA 1B59A 3BJOA 2STTA 3SZZA 3HOZJ 2FU4A 3HKZA 2WV0A 4XORA 1YI2I 3E5QA 4G0UA 2KT0A 4NHJA 1GE9A 3B73A 2M0CA 2OV7A 3QODA 5EEHA 3HOVJ 4GTFA 1WJEA 2L7MP 3MKZA 2ZMEB 2V26A 3CC7I 3L2RA 2LYCA 4I6ZA 2JA8C 1HOMA 2B7EA 3WTXC 3E5UA 2CW0F 3ZMZA 3I4MC 3S8PA 2RGVA 3OOPA 2KIFA 1MBGA 3F8BA 4A3CK 5H6RA 4G7ZA 2XDVA 3LFKA 4C9YA 1IW7A 4G8XA 2E7WA 4DYCA 1O2BA 4BGDA 2EIKH 4BBRC 2Y0SD 3BQYA 3HOZK 1EFWA 2MH9A 2JH3A 4ENMA 3ULQB 1SD4A 4HNTA 3JRFA 2KL4A 2KQRA 2D2WA 1TWCJ 1HKTA 3RIRA 1J5YA 4ZDOA 5FFXA 1JJ6C 2V6CA 3CJNA 2LMDA 4XL9A 1TL8A 2XHKA 4LFUA 4B8XA 3K7AC 1V5FA 2PJRA 3DBRB 2I8DA 1B4BA 3D5SC 3Q9VA 4J3NA 1J9IA 3RYPA 4DYRA 3TQNA 2A61A 4PGGA 1KU3A 4R8HA 4WX9A 4YG2A 4UV8A 3CCEI 3HKZN 3VYUB 5DTDA 1WORA 2WC2A 2XASA 1XC5A 3MCZA 1ZTRA 1UFMA 3RPUD 5DDGA 5KAFC 2L2OA 4RB0A 2K5CA 1WQ2A 4IRGA 1T39A 1FTTA 3EETA 2YU3A 2JQ7A 1SMTA 3ECOA 3HJEA 3PM1A 1PP7U 5JFEA 1OYYA 3PUFA 1U3EM 4IX7A 2LDUA 1JE8A 3ZR8X 5D8LB 3JREA 1OISA 3KE2A 4EM1A 1W5SA 3IL2A 4BY1J 4BUPA 1MBEA 3MKWB 3ZCOA 1SMYA 5K1YA 3MFKA 1BJTA 3A8JA 1WSUA 1O7FA 2KP6A 2ECBA 3D5RC 3JSPA 2Y48A 3CO6C 3SEQA 2HYFA 4KFCA 1LPQA 2NVXA 2M8GX 1FLIA 3OSGA 5IT9Z 4GTCA 3GO5A 2PBIA 1V5VA 4BNCA 2K40A 5L3EA 2IBDA 3CMAI 1YJ9I 2NVQJ 1XGSA 2E2IA 2E2IJ 2K9NA 2X48A 5HDGA 4M6YA 4KC6A 2E1MC 4GRIA 4RAYA 5J1UA 4QIWN 2EFQA 3CMYA 2VQCA 3GTGK 4EVIA 1ZGAA 2MGQA 5K7FA 5LHHA 2ZSHB 1IXCA 2O5IA 4R1HA 4HW0A 3AL0B 3CUQA 2X85A 1SFOA 2DPUA 4RMNA 1OCCH 1XXAA 4GFQA 4P96A 3CCVI 4OIRF 1XMAA 2XAFA 2Y0MA 2M7AA 2K3FA 2L54A 2ZSIB 3K4KA 2DDBA 3S1QC 3TEDA 4N0BA 4CA0A 1OR7A 1WJBA 3F9KA 3H3ZA 3LSKA 3F8NA 3IH2A 4Q4ZA 3MZHA 3GTQA 3Q0VA 3J7ZI 4L5JA 2A68A 3ZGKA 2EJRA 4OAZA 4BE1A 5IPAA 4IRHA 1RKTA 4Y3OA 5F0HA 1ORKA 2RN7A 2X1EA 1Z6TA 4CYCA 1RESA 1SVOA 1TWAA 5C4XJ 1OLTA 2H1LA 2EB7A 1P4XA 4Y7NJ 5BNGA 2VUMA 3M8EA 3RCOA 2BHZA 1IUYA 2G7HA 2EINH 3FXRA 1TWGC 5LFAA 3OR1C 2EA4A 1MMDA 3Q3QA 1IBAA 1XN7A 3LSRA 3V7CA 3NARA 2GSOA 2WAQL 2QF7A 1X3WB 2RC4A 1T98A 2BXZA 4A3MJ 3L4KA 5E8IA 4U0WA 1ETXA 5D8KB 3S1NC 2QQ8A 3OEPA 1AWCA 3PNYA 3DTKA 1QHHD 4LLGF 5DD4A 2A68F 4CYCB 2X6WA 3V7SA 2P4WA 3CDIA 4YIRX 2VUMC 1SAUA 2B9SA 3HOYC 1U6GA 4ABZA 2JA2A 4RMFA 2HTSA 4M3BA 4AIHA 3VSKA 5ILUA 2X9DA 4JQFA 3BY6A 3KP5A 2W82A 4XN0A 1ETVA 1B8IB 2R5YB 4C3HK 3RYRA 2R92J 3EQLF 3JRDA 3AL0C 2W1OA 5GP9A 2HDDA 4KM8A 2XAJA 1FPQA 1K79A 3AH5A 4AH6A 3GTOJ 2R7QA 1VQ9I 1BR1A 4PZJA 2QQAA 1LDDA 4ENNA 2HVRA 3QQAA 3T01A 3S0XA 4CO8A 2LY9A 3EYYA 1TW2A 3QP6A 4FQGA 3L9FA 3OYNA 1VGXA 4MQ9A 2E2IC 4EM2A 5JR3A 2M87A 2VONA 1MSEC 3OYCA 5E20A 1FMVA 5HL8A 1WI3A 5J8CA 2Z1DA 4X6AK 2IRFG 5M3MK 2LG4A 5CPRB 3P7NA 3LA3A 3S3OA 3S1QK 1Y0NA 1JUPA 1X2MA 4ON0A 4A3JK 3GZ5A 1Y8QB 2E71A 2L7KA 3R6SA 2DMPA 2UXNA 5IP9K 5M5WJ 5TJ3A 3EQLA 1R4MB 2EIMH 3HOXK 3HOWJ 4U7DA 2GSNA 3AD9C 1G3SA 1FTZA 1T95A 4XSXF 1W36D 1YW9A 2JA8K 3S2HJ 4O2DA 2HZTA 5TGTA 1KU7A 2VT2A 4L5EA 2EILH 2LBFB 1JQWA 1UG0A 4WXDA 5E18F 4Q5SF 3P5JA 3S15J 4DJAA 3S3MA 4DBRA 4BY1K 5AONA 1I3QJ 2CW8A 3LWFA 1XGOA 4NUBA 1S5LC 4E7SA 3SFZA 2QBYA 3HIFA 4B47A 3QPLA 4Y52K 4JOMA 2NVXK 3F8MA 5C44J 2R92K 4A3BJ 5H6QA 3S2HC 3NAUA 2JUGA 3HOTA 3K7AJ 1GXQA 2RV8A 3BG5A 3JRBA 1XD7A 2EV0A 1YX3A 1D3YA 4AIDA 4A3MC 2DN0A 2KWAA 1SVMA 4F52A 5F1JA 4E7KA 3GTKA 1P4AA 3S15K 2E2JK 2LH9A 2AQEA 3IKVA 4C2MJ 1MDMB 4I99C 1TWFK 3CCYA 4DIQA 1X58A 5FLVA 4GTBA 3DBHB 2QGUA 2FF4A 1WJ5A 5LGUA 1R4NB 4GO1A 3PL8A 3BG7A 2R93J 3JRIA 1PJ5A 4XN3A 4HSRA 2ELHA 3J80Z 4HQMA 1J7KA 4KIGA 4XLFA 1BBYA 2X51A 2QM3A 4EEFG 1AHDP 1EH6A 5C44C 1EH8A 3CDLA 3AQPA 1MZBA 1FBUA 3GLXA 2VPRA 4KAWX 2AHQA 3K2AA 1FC3A 2J5OA 4WXHA 5EEGA 4HG2A 2DFFA 1V54H 4XKCA 3H9QA 4BXXC 1LVKA 3DQVC 2LLKA 4HNVA 1WCMA 2L7ZA 3N0CA 1Y1WC 1BI1A 2GXAA 3KIOA 1YNJA 4KMUA 2CUEA 2L9RA 1TTYA 1YIJI 2IGOA 1XXCA 3PFYA 1PUEE 2V1XA 2XPWA 4UVBA 5J47A 2YU9C 4AU7A 3F3XA 1I6HC 1ZRCA 4IL6C 2V9VA 1OJLA 1LFUP 2NVUB 4OIOF 3GTLK 4MTDA 2VXZA 4PFPA 4II2A 2KIQA 3J81K 1WVRA 3G4AA 3K4LA 4I76A 4QIWD 3KP3A 1SD6A 5GTHC 3F8FA 1WJCA 5JVOA 4CHUA 4KN4X 4BEHA 1TWHA 3HOYJ 4PJLA 4HRIA 2GSUA 3LQQA 3MKYB 2X4HA 1W0TA 4IF4A 4A5MA 2IT0A 3QOPA 3GUDA 3QX3A 1POGA 4BXXK 2CYYA 4MQ9F 3OYEA 3TKYA 1XX5A 1QPIA 4KM9A 3GTOA 3FK6A 5DEQA 1FYKA 3ZMVA 4S0HB 4RAGA 2E1NA 1MBHA 3RZOC 4L9JA 2QWWA 1IXRC 1IW7F 3FBNB 3K10A 4IHVA 3S2HK 4M9XA 2EFNA 2VQGA 2M2EA 2L5QA 1OCZH 4HF0A 5JI6A 1YHQI 4E6KG 2V9KA 1MMAA 5KVRA 1BJAA 1MBFA 5JLWA 5K5QA 4U0VA 3WTWC 1MBKA 1BS2A 2R5YA 1KONA 2HKXA 4I0BA 1R1TA 3X2QH 2KIUA 3QRFF 1B72B 1K78B 3NQOA 2VOOA 2RH6A 1R22A 2Q2EA 3KP7A 3QPTA 2ZBKA 4ZH4A 3S17J 1KZHA 3N97A 4HEA2 2OTLI 1G3YA 1PYVA 4CCOA 3K70C 1TWCC 1FBQA 3CLQA 2R7SA 1EKEA 4Q5SA 2JRTA 3GMEA 2OA4A 4HA8A 2EPFA 3BLYA 4MLOA 2ZXIA 3HPGA 2O03A 1SD5A 4M9SA 5DM6F 2A6EF 2XB5A 2HPMA 4E70A 4B44A 1SFOC 4PABA 2MA3A 2L0KA 1UCRA 2DU9A 3OWTA 3SYTA 5JFRA 3M7GA 4OOIA 4UXNA 1J09A 2GQQA 3CMMA 2V6UA 1V5EA 1SMYF 1TQMA 2MG4A 3G3ZA 3VYTB 3S17K 2K9MA 4TV7A 2VC0A 3TOBA 1RUNA 2PN6A 2KJBA 4C3IC 5IYDC 2F2EA 4IHTA 3CP8A 1O3SA 4ZYEA 2FQ4A 1OYWA 3OYBA 3GTJA 2GIVA 3UKGA 3VFZA 3OV8A 5IP9C 3M1EA 3W2VA 2MABA 5A2QK 4A3JC 1W5TA 3M8JA 3HPHA 2P6TA 3SZGA 4NDLA 4ZYAA 3A8IA 3K9TA 2HR3A 4U0YA 1W7PB 3KCCA 3LSMA 2O7OA 1XZPA 2CQKA 2NVTK 1UZCA 5JLXA 3IWZA 1ZGWA 4FASD 3L2VA 2RGRA 2EBBA 5J4VA 2Z16A 3DU6A 3WE3A 1WSVA 1ZBSA 2R93A 3LSPA 1NG6A 3H0GC 1BA5A 2W00A 2QQBA 4CCNA 2R5ZB 1ZG1A 3NRVA 3AG1H 3HOWC 1LE8A 3GTGC 3K7AK 2HPIA 2A5WA 3AG3H 1N25A 1LNWA 3DV8A 3J7AY 2F6CA 1YQAA 1HI9A 1D1CA 4IHXA 1TWAC 1DQUA 4BE2A 4EV0A 2UWMA 2RDPA 2BXYA 1D8JA 3W6VA 5IP6A 2DK5A 3SDGA 3FHNA 2ESNA 4CZCA 2NYXA 3E5XA 3H3VK 1K61A 3OL3A 3ISPA 3FISA 5AIPA 4YFKF 4NC6A 4UUSA 2PJPA 1HQMA 2O3FA 3RQ4A 1HSTA 1Y56A 3LAJA 3I4NC 5DUIA 2QYOA 3LA7A 3DKWA 1XMKA 2ZJQF 1MGTA 2P7VB 3PIOF 1V55H 1PUFA 1Z67A 3NWTA 4GCVA 1WOSA 2B63K 3WGGA 2A5YB 2WAQN 4RAFA 5CLSA 3EYIA 3DP7A 4GYGA 3OIPA 3RZDK 4M3EA 3GZNB 3GTJC 1E3PA 2K9QA 5D4RA 3DEWA 2YR2A 4LD5A 4MTEA 4G12A 1JKQC 3D1NI 4LGWA 3GZ6A 5F0FA 1UHWA 3BZKA 1VLOA 1RETA 4A3FC 1ETKA 1BC8C 2R7XA 4MQVA 2V1DA 3HUGB 4XRFA 5FLXZ 3JAMK 1TWFJ 2HDWA 3DF8A 4UNOA 1MNDA 3PFIA 4B1RA 4BE0A 2DYRH 3IUOA 4ESJA 3L4JA 3S1MJ 2CMPA 2RVCA 3GTOK 4MEXF 2O9LA 2KFDA 3H9JA 4UB6C 4ZC3A 5DCMA 1BW6A 4PDKA 4C3HC 2XF7A 1Z3YA 3KLOA 4AYBL 3C3WA 2W7NA 1DCHA 5BS6A 3S2WA 5HDKA 5LRSA 2PHCB 5M5YK 1VQOI 2COMA 2E2HJ 2O5JA 3ZN1A 4BHPA 3WTYC 1VQMI 1TW3A 2HKOA 3R4KA 4WJ4A 3LSJA 1FIPA 4LQYA 2E5NA 5HLHA 2AS5F 3G4CA 2HOAA 3H0DA 1IO2A 4KATA 1PJRA 1TNTA 4N4OB 4KT6A 2ZC2A 4K2EA 2ID6A 2XB0X 5EDNA 2NRAC 1I6VA 2KMUA 1B72A 1T33A 2JA8J 3CQZC 2NOGA 2ETHA 4I02A 1ZR4A 3FKIK 3I54A 2PMZD 1UHSA 4M72A 1P7JA 4A3DK 1GUUA 2NNNA 4NBQA 2FQ3A 1ON1A 2Z3YA 3PQKA 1RR7A 2VBXA 2VIXA 4XLPF 2ZJPF 1YRNA 3LAPA 1L0OC 1R00A 1VQ5I 1QGPA 2XSJC 3AD7C 2E2IK 4RGUA 3KZIC 1BIAA 4M3DA 3GCMA 3BP8A 1YW8A 2HZDA 4ZJZA 1XTAA 1MMNA 3KX2A 2MFZA 4A93C 4Y15A 2L9SA 3CUQC 4LG0A 4A5NA 2D5VA 2JA7A 5E3LA 3B6AA 3QU6A 3FMSA 5CHPA 5EGHA 2BVMA 2DT6A 3ERMA 4QIWL 1G2HA 2VJ4A 4DBQA 1FOKA 2F5EA 5IOYA 2VPLA 1OR7C 3KYDB 4I7HA 5FLMC 4HLXA 2H8RA 3DXJA 2XKPA 4P9UA 4RB1A 3CCMI 3GTMK 1ETOA 5FD6A 3ABKH 2CV2A 4A93J 3H0GJ 1T38A 2NVXC 3GTQK 3QYBA 5F6FA 4F55A 4XLPA 1TLHB 2ICWG 1IAWA 3U1KA 3GTGJ 1G51A 4C2UA 1GVJA 3VB2A 1AU7A 2W7VA 1BOAA 3FIWA 1O7LA 1IN4A 2ZFWA 3T1BA 2QQ9A 1W7PA 4BXFA 2VJJA 1HF0A 2HOSA 4D1QA 2ZO4A 5GADJ 1HW2A 3OOUA 4C45A 5JVGF 4A3MK 1PJ7A 2X6YA 1K4SA 4KIFA 2R0QC 2E1OA 4IVNA 5FLMJ 3FOFA 2IA2A 5TISC 1ENHA 1YOVB 2DAOA 1TWGA 2DQLA 4BJ6C 1MNMC 2CV0A 2IS1A 2GIZA 3HRUA 3JAMZ 2E2HC 2VL8A 2EV5A 1DPRA 2YS9A 5KHDA 3JRAA 1D1BA 1E2XA 1FSEA 1R7JA 5EF6A 4MGRA 1JKRC 1B4AA 1QZEA 3OYJA 5IOTA 4XLNA 2WV1A 2EZKA 2BY2A 2I10A 3PSFA 2ELKA 3EUAA 1WOPA 3KEQA 4HF2A 3F21A 5DV5A 1CF7B 4PUSA 2B63A 1IV8A 2HQ5A 3E0JB 4RS8A 2KISA 3LNQA 3K0LA 1E0EA 3Q0UA 3KZYA 3F8CA 5FRNA 2YU9J 3PSIA 2DBBA 4XSZF 1F7UA 1KQ0A 4A3GC 4P9FA 4ASNA 1XB4A 3S17C 1JVIA 4OMYA 4A3IJ 2FNPA 4ESBA 4A3BK 2XAQA 1QHGA 3HOVC 1HBXG 2HTJA 3A0HC 2HWVA 3HB9A 4JX6A 1MNEA 3H5AA 3GTLA 4IKFA 2NVYJ 4LLGA 2BY0A 1MH3A 2HYJA 3DTIA 3RDIA 1BDFA 1EV7A 2J5PA 5F64A 3LPXA 3OIOA 1TWHK 5KAIC 4HX8A 3I4NJ 2FNAA 4PCQA 1HKQA 1LKXA 4XLCA 2A05A 2EA2A 4PJMA 5E1WA 5K7ZA 3OS2A 4G7OF 3IRQA 3PJRA 4IOAF 4LK1A 2WAEA 3QWLA 3K1NA 2W57A 1XZQA 2FQOA 2RNJA 4A3GJ 4I01A 1K7AA 3VPRA 5H20A 2A6HA 2HS5A 2PLYA 5HNFA 4Q47A 1QPMA 4KICA 1O28A 2PA8L 1S8NA 4ZTJA 3ZP5A 3EUHC 2DLLA 1ZLJA 1VNDA 1VRQC 1YE9A 2B63C 3K4NA 5C4JC 4A0ZA 2FRHA 3SQNA 2QENA 4G6DA 4KDDA 4HZFA 3HTSB 5GPCA 5FO5A 1VQ8I 4IO9F 2PMZL 2WWYA 2DTZA 3H5RA 5J8FA 3S16C 3F0CA 2DA4A 3CCUI 2ID3A 1Z91A 5B3SH 4AVPA 1HDDC 4E7JA 1FT9A 5C3EJ 2OAZA 2JTVA 2X6XA 3VOEA 4XIDA 1SFEA 2KDZA 1FYLA 2IS4A 1QBJA 1W36C 1VZ0A 1A36A 5FGMA 3E6DA 1XZQB 2JSPA 2UUZA 1ZK8A 5C4JJ 2FMYA 3LSGA 2TDXA 4A3DJ 2W4SA 3C7JA 1X3UA 4BHBA 1VQKI 1MMGA 3O3KA 4IXAA 1I1GA 3MAJA 5CJ9A 2D45A 3GTKK 1LFBA 1YX2A 1SEUA 3ZMSA 2MLGA 1TWCK 2P6SA 2OBPA 3OS1A 1Y1VA 2XUBA 2JA7K 4X1EA 2XCOA 3KP4A 3QPHA 2DOFA 1FWZA 1I1SA 5C4JK 3S1MK 3S16J 3GTGA 2Z33A 1DGWY 2VBZA 1WHUA 2GXGA 1O25A 1WI9A 1P92A 3A1YA 4EJWA 4BLAA 1O29A 3FMRA 2JZYA 4A0YA 1GVDA 5H2FC 1ZH5A 2R7ZJ 4M6XA 2XF5A 3I55I 1S7OA 3MQ0A 4IRIA 2KDOA 3N3YA 4Y4RA 3TO7A 4A93K 3V42A 3O8GA 5J1YA 3C1DA 2Y30A 1BI3A 2CFOA 2PQ8A 2R92C 1D8KA 4QJVB 1YIOA 4WWCA 2NVYC 2FQTA 2QVOA 5HVQC 5C4XK 4B48A 1AKHA 3RPQA 1FP2A 1XSVA 1XMXA 2MBFA 3BTCA 2Y9ZA 4YFKA 1TBXA 2DDAA 4G7HF 1QA6A 1WPKA 4JK1X 1Z1DA 4RA2A 1R58A 3LSTA 2Y3PA 5FFZA 3H36A 2WY8Q 2XSDC 3DLAA 2YUSA 5LBQA 1R9TJ 2JA5C 3A03A 2XRLA 4A12A 4I2OA 5M3FJ 1A04A 4C3JK 3FXJA 1G59A 2MYSA 1B1BA 2OD5A 3TFJA 5FKKA 1HXDA 5L3DA 2R7OA 4A3EC 2NVXJ 2HXOA 3J81Z 3WE2A 3GW2A 3QPSA 1TNSA 2MD0A 2VODA 2XF6A 4KN4A 1OCRH 5LD2C 4P5AA 4QJVA 4L9TA 3CP2A 3BP8C 1U8RA 3WODA 3IAS2 3J7AO 1MD0A 2KZGA 3ZQQA 4J00A 1SAXA 1CF7A 3GTLJ 1Z3XA 2ISZA 2ZMEC 2EQRA 1F4KA 4MEYA 1MJAA 2K02A 2LC2A 1V3FA 1MJBA 3DCFA 3S93A 3PO3K 2JVGA 1RPWA 2EK5A 1S3JA 2GA1A 3BZCA 2JA6C 3FXQA 3ZMUA 1R36A 4IQJA 1DDNA 3DU5A 4OAYA 4MEXA 1I6HJ 2EFOA 2OF7A 3WGIA 2P0WA 2BE5F 4ZZDA 1I50A 3LA2A 3FHZA 4MFEA 4D9JA 1SFKA 4JX5A 3TP0A 1T2KA 2HQAA 1TT0A 2K86A 2W25A 3K6GA 4R79A 4AIJA 2LKSA 4HPQA 4D7NA 2CQXA 2EH3A 3GTOC 2QKMB 2RNGA 4BBRK 1ZXOA 3J7YJ 1EQRA 4G94A 3WTUC 3K4JA 1I6XA 1WGXA 4IZZA 3HOYK 1H9TA 5HDNA 2L01A 3AQOA 2HQRA 4M6VA 3BG3A 2LNBA 4RAZA 3TO9A 4II3A 2LD5A 3HXLA 4OWRB 3CAGA 3HTUA 3BTIA 3RZOJ 3LSHA 1Z9CA 5L3CA 2COBA 3ZQFA 3G73A 1LDJA 4M74A 3ZQLA 2NAZA 4DQ2A 2EV6A 1K83J 1NH3A 3GTJK 4E7LA 2YX7A 2D1HA 1U8BA 4CCMA 2CQNA 3GTKJ 3QYFA 2XGCA 4L5IA 5L3BA 3OR2C 2L9VA 2RQPA 2WAFA 3K2ZA 3HBLA 3RZOK 2LOOA 3IAM2 3CCQI 2V1UA 4JK1A 4XICA 4M71A 5K7HA 6PAXA 2R93K 1E3HA 2F5CA 1ZR2A 2FEZA 3IH3A 2ME6A 2CQQA 2ZUEA 2R92A 1LEBA 2JN6A 2KRCA 1LUJB 1ZHFA 1KGSA 2VN2A 1P9QC 2ZKZA 4XRSA 1LFPA 3IV5A 1USOA 1WIHA 5IOQA 2IPQX 1USSA 3CF2A 3WHBA 4XRMA 1Y1VK 1D1AA 3B6CA 2VE9A 4D0PA 1GLNA 4HAMA 4F3QA 1PJ6A 3TTGA 2E2JJ 3HRSA 2OCEA 3HUGA 4HF1A 3M3YK 1ONVA 1JUSA 1NTCA 4XMYA 1YO5C 1XS9A 1S6LA 5EZHA 3EUKL 3G1OA 2GOXB 4C3IK 5IYDK 5GAHJ 2CGPA 2K4JA 5FJ8J 4HDUA 2VKEA 4AUXA 2Q0OA 2XKOA 2DTRA 1EH7A 3HKZD 3L1PA 4FCYA 3K4CA 3VDXA 1TZLA 4G7ZF 5M5XK 3MZ8A 1XGMA 3W2AA 1I3QK 1JGSA 3GTPA 3PO3J 2Z99A 4NQWA 4YFNA 5D5XB 5LHIA 1DGRM 2ECCA 4DOZA 2R93C 2PMHA 3GFMA 1WCMK 1A6QA 3TO6A 4GGGA 4OINA 1IGNA 1HLVA 1U9OA 3V8LA 1L0WA 4BDYA 1BR2A 2OU2A 3O6BB 1IV6A 1ZRFA 2WB1N 2XROA 3T00A 3OYGA 4NB5A 1F93A 5ICGA 1JXSA 1FY7A 2H6CA 4BEHB 2MW8A 2BW3A 4OIPF 1QNTA 1JKPC 2KIMA 5EGOA 2L4MA 5AIQA 3NUHA 1BR4A 3CJRB 1APLC 1B9MA 3N4MA 3MMYB 2VI6A 1XCVA 4BH9A 1O26A 3S1QJ 2PA8D 2E1MB 2PG4A 2V1NA 1KQ4A 1WQHA 2Y75A 3KZZA 3CJQB 5DYMA 1REPC 2E60A 2M5WA 4KT5C 3FM5A 1H9GA 2XVCA 4NQWB 4ZZLA 2JSCA 5LLQA 4LK0A 1F43A 3PO2K 4ZYHA 4M3FA 5GAEJ 1QZZA 3OYFA 3GIRA 3GTKC 1VFCA 2ZJ2A 3HYIA 2BW3B 3ESWB 3GFLA 2P5MA 3GDZA 3I53A 3F23A 1S7EA 1IRZA 2OZ6A 2P5LC 2PMZA 2V6SA 1IRGA 1TQIA 3BR6A 4M3GA 2Q2EB 3BR5A 1S72I 3VSLA 3D5LA 5JHUA 4ZYDA 1PP8F 1FZPB 4A3LJ 4IEJA 3KYLA 4A3IK 3CQZA 2CS3A 2RQQA 4D5CA 4A3CC 4QPOA 1I50K 3H9GA 3PQJA 4F92B 4AYBD 3FXKA 4KJZA 3E3VA 1I27A 2VKHA 4ETSA 3RKXA 1K6YA 5ILVA 4WILA 5A2QZ 3GWZA 2HI3A 2WTEA 4XOTA 1U2WA 4A3EJ 2VUMJ 4A3FJ 4G6TB 2XCRB 3CLOA 3GXOA 5F0CA 1Y8RB 2WBMA 2GOMA 3VYRB 2IA0A 4PJ0C 1U5TA 1FOXA 2Q1ZB 5ED4A 2CW0A 3HOZC 3U2RA 4KARA 1J75A 3MD2A 3TDUC 2UXXA 3OS0A 3HEFA 4C2TA 4KNYA 5L3FA 2WB1L 4AIKA 2F4OB 4BKXA 4CXFA 4C3JJ 3A2KA 3BR3A 2HOTA 1JTYA 4B3AA 4Q4ZF 1YX5A 1AA7A 4EGZA 4ZDPA 3UR3C 2W24A 3WHCA 3WTTC 3RKWA 1ZG3A 4FE7A 3QP5A 4LG3A 2F5DA 2R7RA 5CQGA 3HSRA 1Q1HA 4RGXA 2GM4A 4YIFA 3E7LA 3JCUC 3MWMA 1CQTA 3HOVK 2ZJRF 2HFHA 3J80K 3KP6A 5ICCA 4GTDA 2FX0A 5F08A 5IYBC 5LEKA 1USTA 2MC3A 2VKDA 2F5FA 2H09A 2MC4A 2PJRB 4OIQA 3L09A 4CDGA 3WG9A 1LE8B 4V19K 2LP0A 3Q9SA 1DD5A 3K69A 4Y52C 3SEZA 1JTXA 2K27A 2OPTA 3C2HA 2KKOA 2IJLA 3HHHA 5B1BH 4B09A 1ZREA 3LQRA 1FJLA 2FBHA 2EZIA 1ZRDA 1F36A 1S29A 3K1PA 5BPIA 2RREA 1IRXA 3PNVA 4HX7A 3L2CA 3CCSI 1RIOH 3ROUA 3WU2C 3TGNA 1ETWA 3IHUA 2E1CA 1TWCA 3A0BC 4CUGA 3S15C 5GTIC 2BBYA 1DU6A 1YCLA 4LJZF 4YFXF 1P6RA 4FZBA 3ASNH 3CCJI 2DMNA 5EGEA 1ACIA 2IXSA 1FP1D 5C44K 4XNFA 4Y52J 2JA7C 4KASA 4FT8A 3ZQHA 1VF9A 3S2DJ 3I5UA 4EJOA 2K4BA 2CQ7A 3GTPK 2CUJA 4JBAA 3OREA 1HCRA 1DCPA 4Y7NK 2E2HA 3R61A 2EWNA 3OYDA 4BAYA 1XSDA 1JI8A 1BW5A 2JJ7A 3SDBA 2XAGA 2ME0A 3SHFA 1WQGA 2A6EA 2FBKA 1SFXA 4JX4A 1F5TA 1AB4A 1WKMA 4DGWB 1IS1A 1ITYA 1WOOA 4G0WA 4KA4A 2Z5UA 2Y0SL 5IP7J 4OIRA 3S2DC 2NNYA 2M30A 3E6CC 5B5EC 3I56I 4D7MA 1YNNA 1ON2A 3K1MA 1WH5A 1DP7P 1H88C 3BCBA 4BXXJ 2M7BA 4XLNF 3JTGA 1IG7A 1P2FA 3F6VA 2O6GE 2IS2A 5HLGA 5TRDA 1QVUA 5D5VB 1I3QC 4J19A 4ILDA 4YG2F 3ZQ7A 1IXSB 5M3MJ 2K3PA 3JSTA 4O3MA 1VQ7I 4RB3C 2DI3A 1J0RA 2OTJI 5FB2A 4HSTA 4Y13A 3WTZA 4ESFA 4C30A 1G4DA 3GTLC 2M8EA 3ABMH 1LQ1A 1U0JA 3G4SI 2IGNA 2LR8A 3I4PA 3L2WA 5BPDA 1H89C 3L00A 4XR6A 1ETYA 3DWLE 3KEOA 3Q3SA 2HEOA 3GVAA 5CKTA 1P7IA 2Y0SA 2O0YA 3BJ6A 3ABTA 1IUFA 2XIGA 3CQZK 4C3IJ 5IYDJ 2R7FA 4U7BA 2OC6A 2VB6A 1A5JA 2FE3A 2OCCH 4YELA 3W2WA 2Y2ZA 2HQNA 1ODDA 1UJ8A 2DXIA 2P7CB 1T08B 4BY7C 3T0YA 3HKZL 3ADAC 2XGXA 5J3LA 1BGWA 1LB2A 3FKIJ 1R1UA 4MO7A 3FKIA 5HS7A 3W3CA 1F1ZA 2XCQA 4C3JC 3TW7A 3KP2A 4KDPA 1MJ9A 3WGHA 2AXTC 1DPUA 1IL2A 2LVSA 2M4GA 4UVCA 4WCGA 2VBWA 2DMTA 1W7PD 3TFHA 1A31A 3GYHX 2GAUA 1XZPB 4PFOA 1UV7A 1KU9A 1MH4A 1I3AA 4H4KC 1VQPI 5J40A 1MDMA 2DPDA 4UY8I 1FEXA 4I0AA 3HOUC 2ISYA 2PFBA 3OYIA 5CQEA 3GEEA 4KN7A 2BZTA 2Y9YA 4HBLA 2CRGA 1TP4A 1U5TB 2RAEA 3KEYA 3IRRA 4G0VA 3OIQA 4PGHA 4BY7J 4JP0A 2UV1A 4WK8F 3I58A 3HGGA 2K9SA 1IE0A 2R5ZA 4P5OA 3M1CA 5E8GA 5IORA 4KYWA 2VKVA 2GXBA 4LB5A 2WY7Q 5D5WB 3MZYA 2VQLA 4XKVA 1OYIA 3VODA 3CF5F 1BM9A 2LK2A 4YIIA 1VQ4I 3EDPA 3GTMA 4ZYGA 5E17F 1IDYA 1Q1VA 5BMZA 1TWGJ 3ML6A 3DPTA 3BPVA 2LRDA 4FM9A 1TC3C 1P4WA 5TMCA 2YU9A 1FYMA 2V6EA 1G6NA 3AG4H 4GFBA 3PUBA 4M73A 3K4BA 1M1EB 1X1BA 1YG2A 1RUOA 4BBSK 5FRMA 3GTQC 2X0LA 3HOWK 1NK2P 4B3XA 3T02A 5HODA 4PJJA 2PI0A 4Y17A 2W48A 1UB9A 2BV6A 3V8JA 1QZYA 4A6EA 2QSHX 1UELB 4YRVA 3AG2H 5IT3A 1ZQ3P 5LEJA 2NVYA 5D6FA 3BR1A 2O8KA 3FXOA 2NVQK 3CUQB 4BS9A 2IS6A 1O27A 4XKWA 1VTNC 2FUG2 3IPJA 3QYEA 4Z2YA 2E5ZA 4MFDA 1R6RA 3G1MA 2WB1A 4FX4A 3IH4A 1TWGK 3HOUK 5E1ZB 3ZN0A 4A69C 3D0SA 1ULYA 3F6OA 3FZVA 1HC8A 4KIBA 3L2QA 2TRTA 1FOYA 1MKMA 3BTLA 2ZFZA 2IVMA 5L46A 2W85A 2PEXA 4KISA 4HDVA 4LOCA 5M5XJ 1X1CA 4G7HA 2D6FC 1L3LA 1A35A 3H3VD 4BY7K 1XXBA 3BP3A 1E17A 1NHAA 3DEEA 3GLLA 2EZLA 2K85A 1VI0A 3DFGA 5FJ8K 4BBRJ 2H1KA 3MMLB 3U9GA 3RTRA 3FKJA 3Q0WA 3OYLA 2M34A 1ZYRF 2TCTA 4UVAA 1C0WA 2CJJA 2FA5A 3RKQA 1GXPA 2M1BA 2ACJA 3GF2A 2R7WA 2WB1D 3A02A 1WJDA 3H3UA 3HGYA 3AFHA 2H27A 2HVQA 4CGZA 2I5UA 2DA6A 4B4CA 1N77A 1X1PA 4PSXA 3SJMA 2F4MB 4P1WA 4E7ZA 2CV1A 4HYEA 3E97A 1Z6RA 1W4MA 3I9V2 1O2AA 5FKMA 4XOPA 5F04A 5EG0A 1R9TC 3BQZA 1BOBA 3CTAA 1H8AC 4IHSA 2LY1A 2AO9A 4FISA 4HLYA 4UUVA 2JK3A 1E3OC 1OQYA 2VLAA 3PO2J 1Y6IA 4NC7A 3HM5A 4A3GK 2OUMA 4OU0A 2R7DA 3W6KB 1MBJA 2CH0A 3OSFA 2V6TA 1IZ1A 1YRNB 2KRHA 4A3FK 4LG0B 4LR2A 1J2XA 2LY2A 2A3SA 4A3LC 5ICFA 3M07A 1BIBA 2K9LA 2WA0A 4KMDA 4C2MC 4MNUA 1X31C 4NC8A 1WJAA 4H0EA 3MKLA 2HDCA 1RU0A 1ZVUA 3JRGA 2XV4S 1XCBA 3M4OJ 2FOWA 4LB6B 4BQOA 1O3TA 2NVQC 1Z7LA 1PVEA 3H35A 3ZXSA 3UNGC 4ZTFA 2B63J 2ZNZA 2BYVE 4W97A 2E7XA 2M45A 3TMOA 4C3HJ 1KYZA 1T0FA 3RKYA 2FMLA 3PO2C 3VEPA 5IYCK 1K78A 2R7ZA 1LDKB 4EJVA 4XRSG 3WTVC 3SXYA 5CVVA 5EGOB 3CUOA 3CC4I 1ZARA 3CMEI 2JPBA 5C3EC 2QKLB 1DU0A 3P9CA 3BPXA 4QPQA 2L7FP 5FLXK 2WADA 4HX4A 4ZH4F 2GLOA 4RM2A 1IQ0A 2IEKA 1YW7A 3U21A 1YITI 3FDYA 2BE5A 4GTEA 4RBOA 3GEHA 1YS6A 3I59A 2F4IA 3FK7A 5EJCA 1GV2A 2EBIA 2XC7A 3S16K 1O57A 2ZXHA 4KN7X 3JRCA 1V4RA 4JYKA 3DBLB 3ONQA 2GAGC 2CSOA 5ICEA 4EATA 2CO5A 1R71A 4MHGA 1ERDA 1HKSA 2VJ5A 1RZ4A 2QBYB 3MN2A 1I50C 1R9TA 3BWGA 1UG2A 5FLMK 3S1NK 1YS7A 3OYKA 4CH7A 4CYDA 3CO7C 1J6VA 1YLFA 1Z21A 2VBYA 3C2BA 2DA7A 3C18A 3MVPA 5BOXA 1SFUA 5GAGJ 3LFUA 1Z0XA 3C2GA 2JA6J 1G3WA 4XLHA 2JA6A 2G0EA 2DA5A 2DJIA 3RZDC 1SFOJ 1TWAK 4L9NA 1ZG5A 4RGRA 4XSXA 1XG1A 1R5ID 5CVIA 2V4JC 1Z77A 2GBYA 1H0MA 1I50J 3JSOA 5FROA 2NVYK 3M8FA 3OYMA 3FM3A 1OMIA 1B6AA 4RGSA 2Q8KA 5HOOA 3S14K 3N05A 4E7HA 3CZ6A 3FXLA 2VC1A 3IWFA 4PK4A 4CCJA 3AD8C 1ZYRA 3GX4X 1D5YA 4DNCA 2VE8A 5DS9A 5M5WK 2XGDA 1XSXA 5IP9J 2LF7A 4F93B 2VQHA 3GFIA 2DCEA 1J6XA 1WSRA 4XBFA 4A3JJ 2YPRA 1RRJA 2QUFA 1IF1A 2STWA 4FTHA 3G2BA 3TP3A 1JJ8C 1G3TA 2JRMA 4MIMA 2L02A 4BXUA 3HXAA 4IHWA 4D5FA 2ESHA 4PJNA 4LMYA 1HW1A 4BQAA 3I4NK 3PO3C 2JA5K 1T6SA 2DMUA 3KFWX 4S04A 1W0UA 1RR8C 3HSEA 4HV6A 1OCOH 3SZTA 5HS8A 4BY1C 1JGGA 4RDUA 1STZA 2UZKA 4Y7NC 1TQPA 2L9NA 3I64A 3QAHA 2ZNYA 1IN7A 1DCOA 3FXMA 1O2FB 2LTPA 3FXUA 1U5TC 4A3EK 1SANA 5CVJA 2DODA 3B02A 1MSFC 2FSWA 1Y39A 2VT3A 3CESA 3OL4A 3NWSA 3BDDA 3ZQGA 2E35A 1S7AA 4E7IA 5FD5A 4A3IC 1Z7UA 2C6YA 1JHHA 3FF5A 5HNHA 2DQRA 3DXJF 5J1RA 4A3DC 2Z2SB 4LLNA 3QU3A 1FSHA 1BL0A 3RPUA 4N9IA 2O5RA 4BKWA 4UV9A 3JTHA 4OIPA 3BG9A 4XM3A 1KQ9A 3CCLI 3ZMTA 3WU0A 3G1LA 3HOXJ 4GYIA 4IOCF 2X1CA 3SZPA 4EJTA 4RM3A 4QLCU 3H92A 4IQ4A 4LK1F 3O8HA 4UB8C 4KUMA 3TL4X 2QSGX 4HNUA 1INNA 2BY1A 5CVUA 3S2DK 4KMAA 2WAQD 2WAQA 2OQGA 4AYBA 2XAHA 3SZYA 2FOKA 5B66C 1USMA 3FKIC 1GV5A 2DK8A 3ZMDA 2DA3A 2CUZA 4BHCA 3RJPA 5E3MA 1O4XA 4IJAA 3ZQCA 3WU1B 3V7RA 2DW4A 1J59A 3EUHA 4HQEA 3P9IA 1T0FC 1X1AA 1RNLA 3I4MK 5IYCJ 2EIJH 4QSHA 1HA8A 3F72A 1AOYA 2DA1A 2DYSH 1TWFA 4MEYF 2IGMA 3H0GK 3CDHA 2KRFA 5IYBK 4ANJA 1O3RA 1UAAA 2K7LA 1WFXA 2BHYA 2CW7A 4RB2C 1XPPA 2DA2A 2FBIA 3GFJA 2XAUA 4F7ZA 4KMFA 4KMUX 5JHFA 1AKHB 3HSFA 1ZQ1C 1QRYA 3P9KA 4ZDLA 2R7TA 4V2GA 3A4CA 1YJNI 2Y31A 3HDDA 2R3SA 2HOEA 1LVAA 3JR9A 1Y1WK 1UMQA 5LGNA 2ADUA 3BT9A 2DFHA 1X4PA 4GTLA 5IP7K 4FHTA 3WG7H 2XRNA 5J6XA 1R9TK 3I59B 1YFHA 4XK4A 2ZXJA 2E2HK 1JOEA 1XPXA 1D0XA 4L0YB 1I3QA 2P5KA 2B0LA 2NOJB 4BBSC 4O5VA 5IT9K 1D5VA 1V5GA 3BC8A 4Y33A 2PPBA 1HSJA 1QQIA 2A69A 5E3OA 2P5VA 2VXDA 1U9NA 4X0GA 3HRMA 2YX4A 2YU9K 2CFAA 4G7OA 2MH2A 3K70D 3IC7A 4A3CJ 4BJ5C 2F48A 3IP4B 4BDZA 5DM7F 4EJUA 1ZELA 2HXIA 2M4KA 3VYSB 3ZPLA 2G9WA 3CCRI 1R1VA 1ISEA 3ABLH 4O6JA 3WTSC 2LBFA 2Y0SN 3KPHA 3H3VL 2PMUA 4X6AC 3Q5FA 4BQQA 2VUMK 4OMZA 4UUSB 3S1RK 1WQFA 1WJFA 3DKYA 3OMYA 2LKPA 3VA7A 2JPCA 3H1CA 3BZ6A 5EEAA 3PNTA 2OJED 3TBIA 5FKLA 4V2FA 3M9AA 4EQQA 5TJJA 4CCLA 4OIQF 2V9PA 3CQZJ 1HDPA 1PUFB 2JA7J 1QU3A 5D5UB 2ZCWA 4J01A 3GEIA 2VASA 2G7UA 1MIJA 1ZKGA 1EI6A 3A01B 4CZZA 1XDUA 2DMQA 2HYGD 1BJZA 1VQ6I 2DFIA 3CJTB 1RI7A 4L9VA 3ABUA 2KZVA 2R4GA 1IRFA 1OCTC 3TFIA 2DOEA 1WCMJ 4BU2A 1Y1WJ 1X4OA 2JA5J 1TWHJ 2JA5A 3S14C 3M4OC 2DJNA 3I0TA 2D1VA 3E1SA 2BGCA 4F91B 4LJZA 3KYCB 3IKTA 2ELJA 2H6BA 4DZJA 3LOCA 4YFXA 2NS7A 2DO7A 2EZHA 3A8KA 3S1RC 1WZ2A 4XLAA 5IP7C 2RKHA 3ZQIA 4GXOA 3QOEA 4M9ZA 1IDZA 2Y69H 1JHFA 3N0BA 4KB2A 1FOWA 4Q48A 2KHMA 4BJTA 1GDTA 1J6WA 4GTAA 4RLFA 3BG6A 5DCMB 4A3KK 3TDZC 3V4GA 1T56A 5KK1A 3A01A 5GPAA 1BI2A 1X2NA 2P8TA 3BTJA 2L4AA 4I09A 4LLLA 3S14J 1O24A 1SD7A 4WJ3M 3CC2I 4PSWA 3JRHA 5LGTA 1FX7A 3JW4A 5FKNA 1Y0UA 1J98A 5LRRA 3EPZA 4LITA 1KYWA 4G6QA 4BQNA 2JT1A 4HV5A 3HC7A 2JWTA 1SFOK 1EA3A 3G6EI 2H8WA 5E68A 1OCPA 5L3GA 1N75A 4OIOA 3SFIA 5IOZA 2ZB9A 2LF8A 1C0AA 2KLOA 4GZYA 5DD8A 2O8XA 4A3LK 4EGYA 1I5ZA 5M5YJ 3ECHA 1R5HA 4IPAA 2R7VA 5J4YA 1BI0A 1LEAA 5DCFA 2CG4A 3M4OK 3ELKA 3DTEA 2LKXA 4XLEA 1D0ZA 4P55A 5KCMA 2BEOA 2FD5A 2DFEA 2M9HA 4LK0F 4Z6YA 3R0AA 2OZUA 2E36A 2ZXWH 5IY5H 3FWEA 5D4SA 2A6TA 3HZJA 3S32A 3DLLF 1MMSA 1KQ8A 3LMMA 1XGNA 4M1XA 5LHGA 4XCHA 3H5NA 3S1MC 5IYBJ 3GBGA 1BN5A 3WODF 4AWXB 1K83C 5C4XC 2A69F 2FXAA 2M3AA 3FX3A 5DUKA 4DYQA 3I4MJ 3E6MA 4BL0B 4AYBN 4RLQA 2XPUA 4UHTA 4A3KJ 4FETA 2MSYA 3FBIB 1TT5B 2NS8A 1B9NA 1KU2A 4BBSJ 3I71A 3OYAA 1KA8A 3T5XA 3OY9A 2OQRA 4W1UA 3GTJJ 2KPMA 2R7UA 4CICA 1K83A 2JVHA 1FMWA 1IN6A 5TMFA 3ASOH 1ZGJA 1VH2A 4I98B 4XONA 4XKBA 3GSIA 2ZFUA 1EF4A 1R5GA 2LFBA 3RZDJ 3HL2A 5IYCC 1T8IA 2P81A 4CSWA 1R49A 2E34A 3G71I 3HOSA 4A3KC 4LOWA 2JA6K 2QLZA 3L2UA 4IHYA 1ZLKA 1DUXC 2LSOA 1NG7A 1ZN2A 2GZWA 1SVLA 3GTQJ 2R7ZK 4AD9A 1S9HA 2BY3A 5HLTA 2CWEA 1W5CC 4LIUA 5ILSA 4FX0A 1K6OA 1DP3A 2CFAB 3DEUA 5CYVA 1VQNI 4ENJA 2NS0A 1N78A 2GAHC 5KNLA 5M3FK 1TWAJ 2A6HF 1GT0C 5F1RA 1RC9A 2JUCA 4U88A 3M3YJ 3BUEA 4CCKA 4AVZA 4AM3A 3GTPC 5B1AH 4U87A 2ZUFA 1Y1VJ 2XGEA 3ZRGA 5F27A 3HOUJ 2V7FA 1IN8A 1TWHC 4G9YA 2CFXA
chains in the Genus database with same CATH topology
5JVTA 1HW5A 2IP2A 4BLBA 5CVRA 3KLNA 3GEZA 3HHGA 1IN5A 2IW5A 3V8KA 4EMSA 3FOEA 4A6DA 5IOSA 3AAFA 4KMHA 1FBSA 2A07F 1YYVA 1WRJA 3O2PE 3T8RA 4KB4A 4N9HA 3COAC 1UHMA 1O3QA 3BROA 3ERED 2AXLA 2EFPA 2QZ8A 2MD5A 3REOA 2V79A 3E6BA 2YSRA 1GHCA 4S05A 3MEXA 5E1XA 3FMQA 1XDSA 1EK8A 1HQCA 4YFNF 4QWQA 2VOPA 5BQTA 5K5OA 1BC7C 2IA1A 4A0XA 3RI4A 1U78A 1ZAOA 5HS9A 2Z9OA 2H94A 3DPLC 4OINF 1OPCA 3TOAA 1Z05A 2GA2A 5D6EA 1R23A 1WWXA 1LJ9A 1OKRA 4DDQA 4A2UA 2O61A 2W84A 2EFWA 4HOBA 3OPFA 1FNNA 1EH1A 3T8TA 2L3DA 4WXCA 3KETA 3BOQA 4WF2A 3BJAA 1QO0D 2KJCA 4L0ZB 3R60A 4EM0B 3R0JA 2DT5A 5HLIA 3F22A 3H0GA 4GT9A 2ZMEA 1CGPA 1PDNC 4L18B 5ERIA 3L7WA 3W6JB 3HRTA 4BYYA 1F9NA 2GWRA 5K5RA 1YTYA 3NEUA 4P5BA 3U1DA 4ENKA 1Y1WA 2HGCA 2MLKA 1B59A 3BJOA 2STTA 2FU4A 4G0UA 2WV0A 1GE9A 3E5QA 4NHJA 3B73A 5EEHA 4GTFA 2ZMEB 3WTXC 3E5UA 2CW0F 3ZMZA 2RGVA 3OOPA 2KIFA 3F8BA 5H6RA 3LFKA 4G8XA 2E7WA 1O2BA 2MH9A 2JH3A 4ENMA 3ULQB 1SD4A 2D2WA 1HKTA 3RIRA 1J5YA 5FFXA 2V6CA 3CJNA 2XHKA 4LFUA 4B8XA 1B4BA 3Q9VA 4J3NA 1J9IA 3RYPA 3TQNA 2A61A 4PGGA 1KU3A 4R8HA 4WX9A 4UV8A 2WC2A 2XASA 3MCZA 1UFMA 5DDGA 4RB0A 1WQ2A 4IRGA 1T39A 3EETA 2YU3A 1SMTA 3ECOA 5JFEA 1PP7U 1OYYA 1U3EM 2LDUA 1JE8A 5D8LB 3KE2A 4EM1A 1W5SA 3IL2A 5K1YA 3MFKA 1BJTA 1WSUA 1O7FA 3JSPA 3CO6C 2Y48A 4KFCA 2HYFA 2NVXA 1FLIA 5IT9Z 4GTCA 3GO5A 2PBIA 4BNCA 5L3EA 2E2IA 1XGSA 5HDGA 4M6YA 4KC6A 4RAYA 2EFQA 4EVIA 1ZGAA 5LHHA 1IXCA 4R1HA 4HW0A 3CUQA 1SFOA 2DPUA 1XXAA 4GFQA 4P96A 4OIRF 1XMAA 2XAFA 2Y0MA 2L54A 4N0BA 1OR7A 3H3ZA 3F8NA 3GTQA 3MZHA 4L5JA 2EJRA 4IRHA 2RN7A 1Z6TA 1TWAA 2EB7A 1P4XA 2VUMA 3M8EA 1IUYA 2G7HA 3FXRA 3Q3QA 2EA4A 1XN7A 3V7CA 2GSOA 2RC4A 1T98A 3L4KA 5E8IA 4U0WA 5D8KB 3OEPA 1AWCA 4LLGF 5DD4A 2A68F 3V7SA 2P4WA 1U6GA 2HTSA 4AIHA 5ILUA 4JQFA 3BY6A 3KP5A 3RYRA 3EQLF 4KM8A 2XAJA 1FPQA 1K79A 3AH5A 4PZJA 2QQAA 1LDDA 4ENNA 3S0XA 4CO8A 3EYYA 1TW2A 3QP6A 3L9FA 4EM2A 5JR3A 2M87A 2VONA 5E20A 5J8CA 2IRFG 3P7NA 3LA3A 4ON0A 3GZ5A 3R6SA 2UXNA 5TJ3A 4U7DA 2GSNA 1G3SA 4XSXF 1YW9A 2HZTA 1KU7A 2VT2A 4WXDA 5E18F 4Q5SF 5AONA 3LWFA 1XGOA 3SFZA 2QBYA 3HIFA 3F8MA 5H6QA 3HOTA 1GXQA 2RV8A 1XD7A 2EV0A 1D3YA 2KWAA 3GTKA 1P4AA 3IKVA 1MDMB 4GTBA 2FF4A 5LGUA 4GO1A 2ELHA 3J80Z 4HQMA 1J7KA 4KIGA 1BBYA 2QM3A 1EH6A 1EH8A 3AQPA 4KAWX 1MZBA 1FBUA 3GLXA 1FC3A 2J5OA 4WXHA 5EEGA 3DQVC 1WCMA 3N0CA 1BI1A 1TTYA 1XXCA 1PUEE 2V1XA 4UVBA 3F3XA 1ZRCA 2V9VA 4OIOF 4MTDA 2VXZA 3J81K 3G4AA 3KP3A 1SD6A 3F8FA 5JVOA 4CHUA 4KN4X 1TWHA 2GSUA 3LQQA 2X4HA 4IF4A 4A5MA 2IT0A 3QOPA 3GUDA 3QX3A 2CYYA 4MQ9F 3TKYA 4KM9A 3GTOA 5DEQA 1FYKA 3ZMVA 2E1NA 4L9JA 2QWWA 1IXRC 1IW7F 4M9XA 2EFNA 5JI6A 4HF0A 5KVRA 1BJAA 5K5QA 4U0VA 3WTWC 2HKXA 4I0BA 1R1TA 2KIUA 3QRFF 1K78B 3NQOA 2VOOA 2RH6A 1R22A 2Q2EA 3KP7A 3QPTA 2ZBKA 3N97A 1G3YA 1FBQA 2JRTA 2OA4A 4HA8A 2O03A 1SD5A 4M9SA 2A6EF 4E70A 2MA3A 1UCRA 2DU9A 5JFRA 3M7GA 4OOIA 4UXNA 2GQQA 1SMYF 1TQMA 3G3ZA 4TV7A 2VC0A 3TOBA 1RUNA 2PN6A 2KJBA 4C3IC 2F2EA 4IHTA 1O3SA 4ZYEA 1OYWA 3GTJA 2GIVA 3VFZA 3OV8A 3M1EA 5A2QK 1W5TA 2P6TA 3K9TA 2HR3A 4U0YA 1W7PB 3KCCA 2CQKA 3IWZA 2RGRA 3WE3A 1ZBSA 2R93A 2QQBA 1ZG1A 3NRVA 1LNWA 3DV8A 1YQAA 2UWMA 4EV0A 1D8JA 2RDPA 2DK5A 2ESNA 2NYXA 3E5XA 3ISPA 5AIPA 4YFKF 2PJPA 2O3FA 1HSTA 3LAJA 5DUIA 2QYOA 3LA7A 3DKWA 1XMKA 1MGTA 2P7VB 4GCVA 3WGGA 2A5YB 5CLSA 3EYIA 3DP7A 4GYGA 5D4RA 2YR2A 4LD5A 4MTEA 4LGWA 3GZ6A 1UHWA 1BC8C 4MQVA 2V1DA 4XRFA 5FLXZ 3JAMK 4UNOA 3DF8A 3PFIA 4ESJA 3L4JA 2RVCA 4MEXF 5DCMA 4PDKA 4C3HC 3KLOA 3C3WA 5BS6A 3S2WA 5HDKA 5LRSA 2PHCB 2COMA 3ZN1A 4BHPA 3WTYC 1TW3A 2HKOA 3R4KA 4LQYA 5HLHA 2AS5F 3G4CA 4KATA 1TNTA 4K2EA 2NRAC 2ETHA 4I02A 3I54A 4M72A 2NNNA 2FQ3A 1ON1A 2Z3YA 3PQKA 2VBXA 4XLPF 3LAPA 1L0OC 1R00A 1QGPA 4RGUA 1BIAA 3BP8A 1YW8A 4Y15A 3CUQC 4LG0A 4A5NA 2JA7A 3QU6A 3FMSA 5CHPA 5EGHA 1FOKA 2F5EA 4I7HA 4HLXA 2XKPA 4P9UA 4RB1A 5FD6A 1T38A 5F6FA 1TLHB 1IAWA 1GVJA 3VB2A 1BOAA 1IN4A 1O7LA 2ZFWA 3T1BA 2QQ9A 1W7PA 2ZO4A 1HW2A 4KIFA 4IVNA 3FOFA 2IA2A 2DAOA 1TWGA 2DQLA 3HRUA 3JAMZ 2EV5A 1DPRA 1E2XA 1FSEA 1R7JA 5IOTA 4MGRA 1B4AA 3KEQA 4HF2A 3F21A 5DV5A 1CF7B 2B63A 4RS8A 3K0LA 3KZYA 3F8CA 2DBBA 4XSZF 1KQ0A 4P9FA 4ASNA 1XB4A 4OMYA 2FNPA 4ESBA 2XAQA 1HBXG 2HTJA 2HWVA 3GTLA 3RDIA 1EV7A 2J5PA 5F64A 3LPXA 4HX8A 2FNAA 4PCQA 1HKQA 4G7OF 5E1WA 2EA2A 3IRQA 3K1NA 2W57A 2RNJA 4I01A 1K7AA 5H20A 2HS5A 2PLYA 4Q47A 1QPMA 4KICA 1O28A 1S8NA 3ZP5A 2DLLA 1ZLJA 4A0ZA 2FRHA 3SQNA 2QENA 4G6DA 4KDDA 4HZFA 3HTSB 5FO5A 2WWYA 5J8FA 1Z91A 4AVPA 1FT9A 2OAZA 2JTVA 3VOEA 1FYLA 1SFEA 1QBJA 5FGMA 3E6DA 2FMYA 2TDXA 3C7JA 1X3UA 4BHBA 4IXAA 3O3KA 2D45A 1I1GA 3MAJA 5CJ9A 3ZMSA 2MLGA 2P6SA 2OBPA 1Y1VA 2XUBA 2XCOA 3KP4A 3QPHA 1FWZA 1I1SA 3GTGA 2Z33A 2VBZA 2GXGA 1O25A 1WI9A 1P92A 4EJWA 4BLAA 1O29A 2JZYA 3FMRA 4A0YA 1ZH5A 4M6XA 1S7OA 3MQ0A 4IRIA 3N3YA 3TO7A 3C1DA 1BI3A 2PQ8A 1D8KA 1YIOA 4WWCA 2QVOA 5HVQC 3RPQA 1FP2A 1XSVA 2MBFA 1TBXA 4G7HF 4JK1X 1Z1DA 1R58A 3LSTA 2Y3PA 5FFZA 5LBQA 4A12A 4I2OA 1A04A 1B1BA 2OD5A 1HXDA 5L3DA 3J81Z 3WE2A 3GW2A 2VODA 1TNSA 4P5AA 4L9TA 1U8RA 3J7AO 1MD0A 1SAXA 1CF7A 2ISZA 1F4KA 1MJAA 2K02A 1V3FA 1MJBA 2EK5A 1S3JA 2GA1A 3FXQA 3ZMUA 1R36A 1DDNA 2EFOA 3WGIA 2BE5F 4ZZDA 1I50A 3LA2A 3FHZA 1T2KA 2K86A 2W25A 4R79A 4AIJA 1ZXOA 4G94A 3WTUC 1I6XA 1H9TA 5HDNA 2L01A 3AQOA 2HQRA 2LNBA 4RAZA 3TO9A 3CAGA 3HTUA 1Z9CA 5L3CA 3G73A 1LDJA 4M74A 2NAZA 4DQ2A 2EV6A 2YX7A 2D1HA 4L5IA 5L3BA 2RQPA 3K2ZA 2V1UA 4M71A 6PAXA 2F5CA 2FEZA 2R92A 1LEBA 1ZHFA 1KGSA 2VN2A 2ZKZA 1WIHA 5IOQA 2IPQX 1USSA 2VE9A 4D0PA 4HAMA 3HRSA 3HUGA 4HF1A 1ONVA 1YO5C 1S6LA 2CGPA 2K4JA 4HDUA 2Q0OA 2XKOA 2DTRA 1EH7A 4G7ZF 1XGMA 3GTPA 1JGSA 2Z99A 4NQWA 5D5XB 5LHIA 2PMHA 3GFMA 3TO6A 4GGGA 3V8LA 2OU2A 3O6BB 1ZRFA 2XROA 4NB5A 5ICGA 1JXSA 1FY7A 2H6CA 4OIPF 1QNTA 2KIMA 2L4MA 5AIQA 3NUHA 1B9MA 3N4MA 1XCVA 4BH9A 1O26A 2PG4A 1KQ4A 1WQHA 2Y75A 3KZZA 5DYMA 1REPC 2M5WA 4KT5C 3FM5A 1H9GA 2XVCA 4ZZLA 2JSCA 5LLQA 4ZYHA 1QZZA 2ZJ2A 3HYIA 3GFLA 2P5MA 3I53A 3F23A 2OZ6A 2P5LC 1IRGA 1TQIA 3D5LA 5JHUA 4ZYDA 1PP8F 1FZPB 3CQZA 3PQJA 3E3VA 1I27A 4ETSA 3RKXA 5ILVA 5A2QZ 3GWZA 2WTEA 1U2WA 2XCRB 3CLOA 3GXOA 2IA0A 1U5TA 5ED4A 3U2RA 4KARA 1J75A 3TDUC 4KNYA 2UXXA 5L3FA 4AIKA 4CXFA 4Q4ZF 4EGZA 2W24A 3WTTC 3RKWA 1ZG3A 3QP5A 2F5DA 3HSRA 1Q1HA 4RGXA 4YIFA 3MWMA 2HFHA 3J80K 3KP6A 5ICCA 4GTDA 5LEKA 1USTA 2MC3A 2F5FA 2H09A 3L09A 4CDGA 3WG9A 3Q9SA 1DD5A 3K69A 2K27A 2KKOA 2IJLA 3HHHA 4B09A 1ZREA 3LQRA 2FBHA 1ZRDA 1S29A 5BPIA 3K1PA 4HX7A 3L2CA 1RIOH 3ROUA 3TGNA 2E1CA 3IHUA 1TWCA 2BBYA 4LJZF 4YFXF 1P6RA 4FZBA 5EGEA 1FP1D 4KASA 4FT8A 3I5UA 4EJOA 2K4BA 4JBAA 3OREA 2E2HA 3R61A 2EWNA 4BAYA 1XSDA 2XAGA 3SHFA 1WQGA 2FBKA 1SFXA 1AB4A 1F5TA 1WKMA 1IS1A 4G0WA 4KA4A 2Z5UA 2NNYA 2M30A 3E6CC 1ON2A 3K1MA 1DP7P 4XLNF 3JTGA 1P2FA 3F6VA 2O6GE 5HLGA 5TRDA 5D5VB 4ILDA 4YG2F 3ZQ7A 1IXSB 4O3MA 4RB3C 2DI3A 1J0RA 5FB2A 4Y13A 3WTZA 4ESFA 1G4DA 2M8EA 1LQ1A 3I4PA 5BPDA 3L00A 2HEOA 3KEOA 3GVAA 2O0YA 3BJ6A 3ABTA 2XIGA 2R7FA 4U7BA 2FE3A 2HQNA 1ODDA 2P7CB 3T0YA 2XGXA 1BGWA 1LB2A 1R1UA 3FKIA 5HS7A 2XCQA 1F1ZA 4C3JC 3KP2A 4KDPA 1MJ9A 3WGHA 1DPUA 4WCGA 4UVCA 2VBWA 1W7PD 3GYHX 2GAUA 1KU9A 2DPDA 1MDMA 4I0AA 2ISYA 2PFBA 4HBLA 1U5TB 3IRRA 4G0VA 4PGHA 4WK8F 3I58A 4P5OA 5E8GA 5IORA 4KYWA 2GXBA 4LB5A 5D5WB 3MZYA 3VODA 1OYIA 1BM9A 4YIIA 3EDPA 3GTMA 4ZYGA 5E17F 5BMZA 3ML6A 3DPTA 3BPVA 4FM9A 2YU9A 1P4WA 1FYMA 1G6NA 4M73A 1YG2A 1RUOA 2X0LA 2PI0A 4Y17A 1UB9A 2BV6A 3V8JA 1QZYA 4A6EA 5IT3A 5LEJA 2NVYA 5D6FA 3CUQB 1O27A 1VTNC 4Z2YA 4FX4A 5E1ZB 3ZN0A 3D0SA 1ULYA 3F6OA 3FZVA 4KIBA 1MKMA 2ZFZA 2IVMA 2W85A 2PEXA 4HDVA 1L3LA 1XXBA 1E17A 1NHAA 3DFGA 3MMLB 3U9GA 3RTRA 1ZYRF 4UVAA 1C0WA 2FA5A 1GXPA 2M1BA 2ACJA 3GF2A 3H3UA 2H27A 4CGZA 4HYEA 3E97A 1Z6RA 1W4MA 1O2AA 3CTAA 4IHSA 4HLYA 4UUVA 4OU0A 2R7DA 3W6KB 1IZ1A 4LG0B 4LR2A 1J2XA 2A3SA 5ICFA 4C2MC 1BIBA 4KMDA 4MNUA 4H0EA 2HDCA 1ZVUA 2XV4S 1XCBA 4LB6B 1O3TA 2ZNZA 2BYVE 2E7XA 2M45A 1KYZA 1T0FA 3RKYA 2FMLA 3VEPA 1K78A 2R7ZA 1LDKB 4EJVA 3WTVC 3SXYA 5CVVA 3CUOA 1ZARA 2JPBA 3P9CA 3BPXA 5FLXK 4HX4A 4ZH4F 1YW7A 4GTEA 1YS6A 3I59A 1O57A 4KN7X 1V4RA 2CSOA 5ICEA 2CO5A 4MHGA 1HKSA 1RZ4A 2QBYB 1R9TA 3BWGA 1YS7A 3CO7C 4CYDA 1YLFA 2VBYA 3C18A 1SFUA 5BOXA 1G3WA 2JA6A 4L9NA 1ZG5A 4RGRA 5CVIA 1H0MA 3JSOA 3M8FA 3FM3A 1OMIA 1B6AA 4RGSA 2Q8KA 5HOOA 3IWFA 2VC1A 3GX4X 4DNCA 2VE8A 1XSXA 2LF7A 3GFIA 4XBFA 2YPRA 2QUFA 1IF1A 2STWA 1G3TA 2L02A 4BXUA 2ESHA 4LMYA