1B4AA

Structure of the arginine repressor from bacillus stearothermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
b'GQRHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYKYSLPSDQRFNPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE REPRESSOR
publication title Structure of the arginine repressor from Bacillus stearothermophilus.
pubmed doi rcsb
molecule tags Repressor
total genus 38
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1b4aA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1b4aA02
1YS7A 3HYIA 4IRGA 2F5EA 3GXOA 3FMRA 2XROA 4KDPA 4BYYA 2CO5A 5FB2A 5L3GA 3GFLA 4I01A 3U9GA 3CO7C 2GA1A 3O6BB 3T8TA 2Y0MA 2Z5UA 2OA4A 3L4JA 3V8KA 5EEGA 5TJJA 1AB4A 2QYOA 5BPDA 3F22A 4O3MA 3IL2A 5FFXA 3C3WA 3JTGA 3EUHA 3IHUA 2HOEA 6PAXA 2MD5A 2XAFA 2L4AA 3FMSA 3GO5A 3J7AO 3FXQA 2V1XA 3QPHA 1ZLJA 5DV5A 2WWYA 2P6TA 3TOAA 2C6YA 2XCRB 5E1XA 4TV7A 5KK1A 2RV8A 5LBQA 2RKHA 1S8NA 3I58A 3GFMA 4ZZDA 3S2WA 1ZRFA 2W25A 2B0LA 3BJAA 3TDUC 5D5WB 3DXJF 3GYHX 1FOKA 5HLIA 3RTRA 3WE2A 1LVAA 4ASNA 4M9XA 1HKTA 1WIHA 2GA2A 5KVRA 3HRTA 4LK1F 1O57A 1W7PA 3BZ6A 3NRVA 4L9VA 1ON2A 3BWGA 4XLNF 1H9TA 1UB9A 4XRFA 3DEUA 1IXSB 3KEQA 3CDHA 4G7HF 3WTSC 4CYDA 1FPQA 2IA0A 3C1DA 3SQNA 5K1YA 3E6CC 3U2RA 1U5TA 2UXXA 3DF8A 3GW2A 4IJAA 3RI4A 5EEHA 4FX0A 4GO1A 2BGCA 1I6XA 1LEBA 5LRSA 4HAMA 3R0JA 3FXRA 2JZYA 1U78A 1TQIA 3WU0A 2ESHA 2ZJ2A 1P4XA 5D5VB 3C18A 4GYIA 4GFQA 2ZNZA 3CUQC 2LSOA 2RNJA 1KQ9A 3K2ZA 5F6FA 2FMLA 4ESBA 3J81Z 2IT0A 1KA8A 4WWCA 3MEXA 2G9WA 4LB5A 3L00A 3GEZA 2NNYA 2XKOA 1IXCA 4MEXF 4HQMA 3KCCA 1P6RA 1F1ZA 5ICEA 4KB4A 2FQ3A 2F5CA 2PMUA 3LWFA 4RB1A 3F6VA 3RYPA 1K7AA 5HS8A 4Y15A 5TRDA 5LHIA 2ZO4A 1BIBA 2R7DA 4OU0A 1BIAA 3OPFA 4CDGA 2HYFA 1FC3A 3I71A 2PMHA 3D0SA 1V3FA 1YO5C 2DU9A 5A2QK 4P5OA 1G4DA 1ZG1A 4P55A 3P9KA 3TO6A 2QUFA 3FXUA 1U5TC 5J8CA 4MQ9F 4LG0A 4AIKA 2L3DA 1Z6TA 3OEPA 2CGPA 3IRQA 2JPBA 5ILVA 3QU6A 2W84A 2PQ8A 1R1UA 3AAFA 2E7WA 1F5TA 1U3EM 4CGZA 1P4WA 2O61A 3KEOA 1T38A 3BROA 4IRHA 2EWNA 4HLYA 3KZYA 4XLPF 1XMAA 4RAZA 2KKOA 4L5IA 2A61A 1QQIA 5DDGA 3ERED 2NRAC 2O8XA 3L9FA 3ML6A 5L3FA 3GWZA 4GCVA 2GWRA 2PBIA 2EJRA 1YLFA 2O6GE 3I5UA 1FYLA 1R36A 2ESNA 3E5UA 4L9TA 1SD7A 3HRMA 1HW2A 1XXAA 1SFEA 2MBFA 1WI9A 4ETSA 1XGNA 1BI3A 4A12A 1ZAOA 3W6KB 1FLIA 5LGNA 2VBWA 2MH9A 5CVVA 2VBZA 4WXCA 2FBIA 4ZYDA 4HX4A 3CLOA 1MJAA 4I2OA 5E8IA 3OOPA 1U8RA 1HKQA 4O6JA 1H0MA 4M73A 4PCQA 1FZPB 4ENMA 4IXAA 2JRTA 3VB2A 3FMQA 2DPDA 4MTDA 1QZZA 1S7OA 5FGMA 5LEKA 1ZRDA 2ADUA 2K7LA 2J5OA 4BAYA 5F1RA 2OQGA 3JAMZ 1S6LA 4RGSA 1K6OA 1RI7A 2P7VB 3ZMSA 4N9HA 4RS8A 2PI0A 5BPIA 2W24A 4KUMA 3TO7A 4EJOA 2O3FA 2DLLA 3KE2A 4RGXA 4WX9A 2H09A 3M9AA 1LJ9A 1ZN2A 2XKPA 4LD5A 1NHAA 2HFHA 4OIPF 3FOEA 2QENA 1HW1A 2AXLA 4BQAA 5JVTA 3QU3A 3N4MA 4HDUA 1RNLA 4UVCA 2IRFG 3BUEA 1OYWA 1EH7A 1FX7A 3W6JB 2VBYA 2XVCA 3GLXA 3GF2A 3RPUA 4G6DA 2W57A 1EV7A 4G7OF 3NQOA 2LF7A 4GYGA 2F2EA 5E8GA 1KGSA 2VXZA 5CYVA 1ZGAA 3I4PA 1HKSA 4HX7A 5DUIA 3LQRA 1TLHB 2BBYA 2EFOA 4L9NA 3LA2A 2A5YB 2FOKA 3JSOA 1OR7A 2TDXA 5CVIA 2EFWA 2Z99A 1XDSA 1ON1A 2MH2A 1R1VA 2MLGA 2P7CB 5HOOA 2EA2A 4BXUA 1LQ1A 3MCZA 2KJCA 4HF0A 1XSVA 2NNNA 4AIJA 2XRNA 1DPRA 4Z2YA 5K5OA 4HF2A 1XGOA 4G0UA 3WGIA 4R79A 2PHCB 3BJ6A 4BH9A 2DI3A 3HTUA 5ILUA 2L02A 2YPRA 5BQTA 3WGHA 1YW7A 4LLGF 1XXCA 3DPTA 4DNCA 4F7ZA 5FD6A 2DO7A 4WF2A 1B4AA 1PDNC 4KIGA 1G3YA 3TO9A 3ULQB 2DK8A 1R00A 4P9FA 4UVBA 1SD5A 2OZ6A 1LEAA 4WXDA 2PN6A 1BGWA 2JPCA 1E2XA 2EK5A 1QO0D 3VODA 4ZYEA 4DDQA 5F64A 2VODA 2HTJA 3F3XA 2V1DA 1AOYA 1H9GA 1MDMB 4UUVA 1G3SA 3V7CA 1WSUA 3RKXA 4HLXA 2IA1A 4I0BA 4ESJA 4HYEA 1F4KA 1ZLKA 1S3JA 1XSXA 1FSEA 1FY7A 2VC1A 3BPXA 4I98B 4G7ZF 4KT5C 4CICA 3GZ5A 1YIOA 2AS5F 1ZG5A 1XGSA 3SFZA 2STTA 1KYWA 2EFNA 4ZYGA 4KNYA 2XIGA 3G3ZA 3T5XA 4KC6A 3PQKA 3VFZA 2HEOA 5HDKA 1JHFA 3V8JA 4IPAA 2F5FA 3WG9A 2P5MA 4A5MA 2EFPA 3ZN0A 2P8TA 3RDIA 4QLCU 1TNTA 1T6SA 1MGTA 2UZKA 2M8EA 3Q9SA 1BI2A 2LNBA 1OPCA 3E6BA 2QQBA 2IJLA 2ZFZA 3P9CA 1IN5A 2VE8A 3KP2A 3T0YA 4N0BA 2VOPA 2FU4A 4JQFA 2ISYA 3KLOA 5D5XB 3E3VA 2FA5A 1OYYA 1YQAA 1L0OC 2FSWA 2QWWA 3EETA 5E20A 1BJTA 2RC4A 1BI0A 3M7GA 2RN7A 1BC7C 4EJTA 4PGHA 1WQFA 4WCGA 2L01A 4FHTA 5D6FA 3HTSB 2A68F 3ROUA 2VT3A 3N97A 1IAWA 4XBFA 2Z3YA 4EM2A 1S7AA 4KMUX 1QBJA 3WTVC 2MA3A 1WQGA 1SMTA 4M6XA 4G6QA 4MNUA 2G7HA 4NHJA 1GHCA 4AIHA 2DT5A 2RGRA 2HKXA 1U2WA 4M72A 1EH1A 4Y13A 2MC3A 2K4BA 4PDKA 4U7DA 4KYWA 3JSPA 3P9IA 4Q47A 2UWMA 2RDPA 3I0TA 2G7UA 2ETHA 2UXNA 4H0EA 3QX3A 1G3WA 3HHGA 2ACJA 1D3YA 3Q5FA 4KN4X 5AONA 3O3KA 2EV0A 2IVMA 2VT2A 3IC7A 1XMKA 2ZXJA 3L09A 1K79A 1D8JA 3CUOA 5HDNA 2QM3A 2ELHA 1TQPA 1XD7A 4G0VA 2H94A 3WU1B 1I5ZA 3JTHA 4OIRF 3FHZA 1JXSA 2COMA 5IT3A 1FYMA 3R6SA 2IA2A 1XB4A 2Z33A 2M1BA 5L3BA 2YX4A 3VOEA 3HRUA 1Z91A 5JI6A 5ILSA 1IN4A 4U0VA 1UHMA 1P2FA 2OU2A 1SAXA 4WK8F 2JSCA 2CSOA 4P9UA 3HOSA 1J5YA 3RKYA 1TW3A 2R3SA 3L7WA 3QAHA 4RAYA 5D5UB 3CAGA 5J8FA 3C7JA 2A6HF 1IN8A 3KP3A 5AIQA 3MZHA 1E17A 3HHHA 2GXBA 1BM9A 1BBYA 1FYKA 3FF5A 1MKMA 5K5QA 4HF1A 1LB2A 1IRGA 2X0LA 3ZQ7A 4G9YA 1R58A 4A0YA 4ENKA 1SFUA 2Z9OA 3I59A 2HGCA 4A2UA 3SZPA 2BYVE 3TQNA 4EJUA 3R61A 4KIBA 1MJ9A 5D4RA 1HXDA 2EA4A 3KZZA 4JBAA 3IWZA 3KP5A 4UV9A 3MQ0A 3PFIA 1X3UA 4ENJA 1C0WA 2CFXA 2GQQA 1R22A 3GVAA 5H6RA 4LLLA 1XN7A 1W5TA 2L54A 3FM5A 5D8KB 2YSRA 4Q5SF 4OMZA 5ICGA 3QRFF 3J80K 2J5PA 4CHUA 2BE5F 3IKTA 3ZPLA 3RPQA 2FRHA 4LFUA 2LDUA 3E6DA 5IT9K 5E18F 1J75A 3E5XA 3BJOA 5JHUA 3DP7A 3QOPA 5HLHA 4JK1X 5DD8A 1HW5A 1XXBA 1G6NA 1XCVA 5D8LB 1Q1HA 3F6OA 1MZBA 4KDDA 1OKRA 4M9SA 3QP5A 4YFXF 4UVAA 3FM3A 2GXGA 3U1DA 3R60A 2DAOA 3E5QA 5A2QZ 2CYYA 2OQRA 3SHFA 5L3DA 2ZNYA 1XDUA 1FNNA 1G3TA 1W7PD 3WTWC 3TKYA 3HRSA 5LLQA 2A69F 4OOIA 1Y0UA 2K02A 3H3ZA 2P5LC 1B1BA 3LA3A 1ZRCA 3EYIA 4U7BA 4HZFA 3F8FA 1FP2A 2FXAA 3M1EA 5H20A 3I59B 4MGRA 2V9VA 1IRFA 1QNTA 4HBLA 1O3SA 1CF7B 4J3NA 3WGGA 1PP7U 3G73A 1O3QA 1XGMA 2KIMA 4L0ZB 1W5SA 4G8XA 2FNAA 4HV6A 3L4KA 3WTUC 1MDMA 4HDVA 1EK8A 1IW7F 4Y17A 2HZTA 3GFJA 3I64A 2P5VA 4AD9A 1T0FA 2YX7A 2CG4A 3FWEA 2OAZA 2W85A 3F8NA 1ODDA 1GXQA 1LDJA 3REOA 1Z1DA 2PJPA 1B4BA 5LHHA 2HQRA 3RJPA 1Z6RA 2DBBA 3ZN1A 2QQAA 5FLXK 3V7RA 5JFRA 2FE3A 2LF8A 4MHGA 1REPC 4O5VA 1LDDA 1OYIA 1BN5A 4LLNA 3GZ6A 5DYMA 1FBUA 3D5LA 2XHKA 1XCBA 3ABUA 4QWQA 1IN6A 4MEYF 4RB0A 3WTYC 4LB6B 4EV0A 1USTA 5DCMB 5CVRA 1BOAA 3O2PE 2OD5A 4L9JA 1DDNA 1YFHA 1ISEA 1BI1A 1LDKB 2Y75A 2XCOA 4A6EA 2EFQA 2FBHA 1BJAA 1S29A 3DKWA 3F8BA 1UHWA 2FEZA 3Q9VA 1RIOH 3EYYA 2KIUA 4ZH4F 3TDZC 2NYXA 2DFIA 2DPUA 3ECOA 3VEPA 5L3CA 1B59A 3E97A 4B09A 1P4AA 2WV0A 2O03A 2KWAA 2XAHA 4B8XA 4YG2F 3P7NA 4EMSA 2XCQA 2HWVA 1O3TA 3I53A 5DEQA 1R5HA 2PFBA 5FFZA 4AWXB 4HV5A 1STZA 1KU9A 3J81K 4L0YB 3RIRA 3F8CA 3CJNA 4M71A 4EVIA 4FX4A 1SFXA 2ZKZA 1CGPA 2BV6A 1R1TA 4OINF 1TW2A 2H6BA 2VE9A 1YTYA 2R7FA 4RGRA 5D4SA 5HS7A 5LGTA 3SZTA 4AVPA 3T8RA 3HSFA 3ZMTA 1IXRC 4ESFA 1B9NA 5CVJA 4UNOA 4RGUA 2E1CA 4R1HA 3BP8A 3OV8A 3V7SA 5ED4A 1O3RA 5K5RA 3HOTA 4MTEA 2V79A 2F5DA 3CUQA 3HSEA 2ISZA 1J59A 1YW8A 4HOBA 2QVOA 4KAWX 3ECHA 2H6CA 5AIPA 1KYZA 4EJWA 1DUXC 3LAJA 1Z05A 2FBKA 3ISPA 5HDGA 2CQKA 4IVNA 3WTTC 3TOBA 1LNWA 3F8MA 4R8HA 1UFMA 2OZUA 2PEXA 4OMYA 4D0PA 5FLXZ 3WTZA 1D8KA 2RQPA 1MD0A 4MQVA 3SXYA 4E70A 1DPUA 4KB2A 4N9IA 1R7JA 1YS6A 4EJVA 2RGVA 2O0YA 5HLGA 3LPXA 5DD4A 3F23A 3B73A 1V4RA 1MJBA 3ABTA 3KFWX 3ZMVA 4S04A 2M5WA 3HUGA 2QLZA 2MLKA 2XGXA 3ZP5A 2QBYA 3BPVA 1ZH5A 4I09A 2ZFWA 3GUDA 4HA8A 4LGWA 1QGPA 3MWMA 2HDCA 1JE8A 1VTNC 4M74A 1WRJA 2E7XA 3E6MA 1ZHFA 2FF4A 3R4KA 1J0RA 3WTXC 3OREA 2YU3A 2D45A 2XAJA 3DPLC 4EGYA 5LRRA 1JHHA 4M6YA 2HYGD 3WODF 1ZVUA 3MMLB 1QPMA 3K1PA 4BHCA 5BS6A 4BNCA 1DP7P 3ZMDA 1IS1A 3LFKA 5J6XA 4NB5A 3K9TA 3MAJA 5JR3A 2A07F 3VA7A 3GX4X 2GZWA 2K86A 3CUQB 1WQHA 2XAQA 4YIFA 1L3LA 1YW9A 1RUNA 3HIFA 3QPTA 1FT9A 3K0LA 4NQWA 2FMYA 2VN2A 4KMFA 4FM9A 3BDDA 1PP8F 2E1NA 2FNPA 2KRFA 2M30A 2XV4S 1RUOA 1R23A 1TTYA 5DCFA 4ZYHA 4A6DA 4HX8A 2DTRA 3FOFA 4OIOF 2WC2A 1TBXA 2V1UA 3V4GA 3IWFA 1O7LA 5LGUA 3TGNA 2IP2A 2OBPA 2HKOA 1W7PB 2HS5A 2K27A 1I1GA 2M87A 1BC8C 5E17F 4BHBA 3NEUA 1ZYRF 4L18B 1FSHA 1R5GA 3I54A 4EM0B 4UV8A 3ZMZA 1QZYA 4LMYA 3JAMK 2HR3A 4EM1A 4S05A 1O7FA 5FD5A 2KIFA 1W4MA 2EV6A 1Z7UA 4G0WA 3MZYA 1T2KA 2QBYB 1XSDA 1T39A 4CZZA 3K1MA 4KA4A 2M45A 3V8LA 1U5TB 1PUEE 4PZJA 5CJ9A 4ON0A 4YFKF 2GAUA 1GE9A 3L2CA 4CO8A 1TNSA 2K4JA 4KFCA 1UCRA 3ZMUA 4WXHA 1ULYA 2DW4A 5HS9A 2ZMEA 3JW4A 1B9MA 1HBXG 1U6GA 4PGGA 5LEJA 4P96A 1EH6A 3KP7A 1CF7A 1TQMA 2Y3PA 5E1WA 2D1VA 2DQLA 2QZ8A 2XUBA 3M8EA 4U0WA 3BOQA 4YIIA 1GXPA 1A04A 4A5NA 2CW0F 2ZBKA 4KN7X 3B02A 3PQJA 3LA7A 1HSTA 2EB7A 2PG4A 4EQQA 2HQNA 1WWXA 5FO5A 3IKVA 2NAZA 1ZREA 1RZ4A 1F9NA 4I0AA 4I7HA 1HQCA 1IZ1A 4A0XA 3BY6A 4Q48A 1J9IA 3F21A 4HW0A 4IF4A 2BEOA 2JTVA 3DV8A 3CO6C 5ICFA 2IPQX 4KIFA 1DD5A 2JT1A 4M9ZA 4HQEA 3KLNA 1USSA 1ZARA 1SD4A 3FZVA 2P5KA 4EGZA 3ELKA 4FT8A 4LK0F 2WTEA 4XSZF 2XAGA 1KQ0A 2A6EF 4XSXF 4KICA 4K2EA 4YFNF 4LG0B 3KP4A 3QP6A 1KQ8A 4BHPA 4GGGA 1I27A 4Q4ZF 3DFGA 2Q8KA 5CVUA 5DCMA 3K1NA 2EV5A 3GFIA 3K69A 3RYRA 4L5JA 1K78A 2VC0A 4A0ZA 1WKMA 1FBSA 2PLYA 2RVCA 2ZMEB 4DQ2A 2VBXA 3R0AA 5L3EA 5ICCA 4U88A 1ZGJA 1IUYA 2KJBA 4UXNA 1ONVA 1KU7A 2DQRA 2VOOA 4ENNA 2STWA 1FP1D 3F72A 4RB2C 5H6QA 2VONA 2Q0OA 3H3UA 1HSJA 2GIVA 1JGSA 4G94A 1EH8A 4CXFA 3COAC 3T1BA 2P6SA 4U0YA 1D5VA 4I02A 1KU2A 3H92A 2YR2A 3DQVC 1Z9CA 3CTAA 1YYVA 1J7KA 5CLSA 4IRIA 2QQ9A 3KETA 3IRRA 5E1ZB 3MFKA 1GVJA 1WQ2A 2LKPA 2H27A 5BOXA 5BMZA 3LSTA 2IW5A 5ERIA 1KU3A 3EDPA 4OIQF 1B6AA 2ZCWA 2V6CA 4UHTA 2D1HA 1IN7A 1FWZA 1OMIA 4ZZLA 3NUHA 1ZG3A 2NS0A 1SD6A 4RB3C 1YG2A 4LJZF 2X4HA 3FX3A 2Q2EA 2P4WA 3J80Z 3KP6A 3WE3A 5HVQC 2Y48A 4GXOA 1I1SA 5D6EA 1K78B 3RKWA 5JVOA 2DK5A 3LQQA 5IT9Z 1FBQA 3HSRA 3EQLF 5DUKA 1IF1A 1T98A 1AWCA 2L4MA 1J2XA 4IHSA 2HTSA 1SMYF 4IHTA 3LAPA 1P92A 2XASA 2D2WA 2A3SA 5LHGA 3M8FA 2CWEA
chains in the Genus database with same CATH superfamily
1YS7A 4OIOA 1JI8A 3HYIA 4IRGA 3GTJJ 2F5EA 3GXOA 1XX5A 3FMRA 3NARA 2XROA 1W0TA 4M3FA 4BYYA 4KDPA 3EPZA 4PJNA 2CO5A 5FB2A 3K7AC 5L3GA 4FCYA 2CS3A 3GFLA 4QPOA 2BXZA 4I01A 3U9GA 3CO7C 3LSGA 1VGXA 2GA1A 3HOXC 3O6BB 3T8TA 2Y0MA 2Z5UA 4A3IC 2OCEA 2OA4A 3L4JA 3V8KA 5EEGA 4WJ4A 3RZOK 2K3PA 1S72I 2VASA 5TJJA 1AB4A 3GTQJ 2QYOA 3BTLA 5BPDA 2GM4A 3NWSA 1I39A 3F22A 2CV0A 2HOAA 4O3MA 1RU0A 3GEIA 2DA6A 3IL2A 2KDZA 3DBHB 5FFXA 2E19A 3C3WA 1Z21A 2DT6A 4MQ9A 3AL0B 3JRFA 2GLOA 3JTGA 3TFHA 1OCOH 2VQCA 3BTIA 2D6FC 3EUHA 1WPKA 3OS0A 3IHUA 1TWAA 4HSTA 2HOEA 6PAXA 2MD5A 2E2JC 1R9TC 2XAFA 4Y3OA 2L4AA 5M3FJ 3FMSA 3GO5A 3J7AO 1K4SA 5IP7K 1YITI 4YFKA 1MW7A 3FXQA 2BVMA 3LSKA 1TL8A 2V1XA 3NWTA 4DBRA 5IP6A 1YCLA 3QPHA 1JUMA 1ZLJA 5DV5A 2WWYA 3VDXA 3PO2K 3PJRA 3TP0A 2P6TA 2X51A 3TOAA 2C6YA 1K83K 3CMYA 2XCRB 5E1XA 4TV7A 5KK1A 2RV8A 5LBQA 4A3BC 2RKHA 3W2WA 1S8NA 2V6SA 3I58A 3GFMA 4ZZDA 3OYFA 3S2WA 5IORA 4EEFG 3RZDJ 1ZRFA 2W25A 2LTPA 2GSUA 2B0LA 3BJAA 3IAS2 3S2DC 4ITVA 2ZB9A 4YEJA 3DXJF 4PJ0C 3TDUC 5D5WB 1F7UA 3GYHX 3S17C 4A3EC 4UUSB 3C2BA 1YNNA 1APLC 2Q2EB 4BQQA 1SAUA 1FOKA 5HLIA 3A2KA 3RTRA 2JA5J 2FQTA 3A8JA 1YOVB 3WE2A 1LVAA 1B72B 5DM6F 2LKSA 1D1BA 2HQ5A 3FKJA 4ASNA 4M9XA 4P5BA 1HKTA 2EILH 2V6EA 1WIHA 2GA2A 4CA0A 4ABZA 5KVRA 2R7ZK 4KM9A 3HRTA 3VSLA 4LK1F 2PMZA 1BR4A 4XLPA 1O57A 1TWHC 1W7PA 2VUMA 3BZ6A 4RBOA 5M3MJ 2DA1A 3NRVA 1W36C 4L9VA 2JWTA 5IOZA 2X48A 1ON2A 3BWGA 4XLNF 1H9TA 5FJ8K 1T33A 2M4KA 1UB9A 4XRFA 3DEUA 1IXSB 1BL0A 2V1NA 3KEQA 1IDZA 2M8GX 3CDHA 5IYCK 4G7HF 3WTSC 2W7VA 4CYDA 1FPQA 1G2HA 4E7KA 2ZJRF 2E2IJ 3GEHA 2IA0A 4BJ6C 2PA8D 2OJED 3C1DA 3DU5A 4F55A 2F5VA 3L2UA 2YS9A 2NOGA 1A35A 4UB8C 3A0HC 3SQNA 2WAQA 1Y56A 3LFUA 1K61A 4A3FJ 3VWBA 1WJ5A 5K1YA 3FXLA 3E6CC 3HPHA 2LMDA 3OWTA 3HG9A 3U2RA 1SANA 2ZUFA 3M4OJ 2EIKH 1U5TA 2IS2A 2UXXA 3DF8A 2W48A 3GW2A 4BXXJ 4X6AK 2Z2SB 4IJAA 3RI4A 2FOWA 2M34A 3M1CA 5EEHA 3S1QK 3GTKC 4FX0A 4RA2A 4GO1A 3H0DA 1HC8A 3GTGA 1FTZA 1VZ0A 2BGCA 2NS8A 1I6XA 4X0GA 4GDFA 1LEBA 5LRSA 1TWAC 4HAMA 4BL0B 2X6YA 3R0JA 3FXRA 1G59A 3HKZA 2JZYA 3CCEI 1MIJA 4XSXA 1U78A 4G6TB 1TQIA 3WU0A 1YI2I 2ESHA 2ZJ2A 1Y1WJ 1P4XA 1QHHD 1ETXA 5D5VB 4BE2A 3C18A 4GYIA 4YFNA 1IBAA 1YX3A 4NC7A 2VJ5A 1X58A 3E0JB 3OYCA 4GFQA 4BKWA 2VUMK 2ZNZA 3CQZC 3CUQC 2LSOA 3ZQCA 3ASOH 4KM8A 4Q4ZA 1Z77A 2RNJA 3ZQGA 4NOIA 1KQ9A 3HOXJ 4II3A 3ABLH 2PA8L 3K2ZA 4JYKA 3CCLI 1DCHA 5F6FA 2FMLA 4DGWB 4ESBA 2XC7A 5E68A 2B63C 4X6AC 2LC2A 1O2BA 3J81Z 1O24A 3AD8C 1J09A 2EIMH 4D9JA 2IT0A 4FETA 1KA8A 4WWCA 3MEXA 2E2HA 2G9WA 5CQEA 4E4HA 3L00A 4LB5A 3GEZA 2NNYA 2NVXA 2X6WA 4DW6A 3D5SC 1JGGA 2XKOA 4BY1K 2P81A 1IXCA 4MEXF 4HQMA 1O2FB 3KCCA 1P6RA 1WJAA 1F1ZA 5ICEA 4KB4A 2FQ3A 4BDYA 2F5CA 3L1PA 4E7IA 4IHVA 2PMUA 3DEWA 1GUUA 3LWFA 3DTIA 3NAUA 5B1AH 5LFAA 4RB1A 3F6VA 1QRYA 3RYPA 2VUMC 1K7AA 1QVUA 2L9SA 4J19A 5HS8A 1TWCA 4Y15A 2B9SA 2DDAA 4PJJA 3CLQA 2WV1A 5TRDA 2AQEA 5LHIA 2ZO4A 3JSTA 1BIBA 2R7DA 1XZPB 4OU0A 1BIAA 4XK4A 3OPFA 4CDGA 4OIPA 2HYFA 1W5CC 3RZOJ 1AKHA 3BT9A 4C3JC 1FC3A 4P5AA 3KZIC 3K10A 4KARA 2RNGA 3I71A 4ZC3A 2PMHA 5EDNA 1WGXA 2M7AA 3D0SA 1O27A 1QVTA 1V3FA 1GV5A 1YO5C 5IYDK 2DU9A 5A2QK 1V5EA 4P5OA 1G4DA 3S17J 1ZG1A 4P55A 3P9KA 4FZBA 3HOYC 3TO6A 1G51A 2QUFA 3ABMH 5KAIC 4S0HB 4HNVA 3FXUA 4G7OA 1U5TC 5J8CA 4MQ9F 1VNDA 2ZC2A 3GTGC 3SZYA 4BGDA 2OTLI 4LG0A 5FRNA 2FQ4A 3V42A 1TWHJ 2E5NA 3LSIA 3SDGA 4AIKA 2NVXK 4DYCA 2XB0X 2L3DA 3S16K 3PO2J 1Z7LA 4E7ZA 3QPSA 3S15C 1K83J 3FXMA 5IOTA 2G0EA 1Z6TA 4AIDA 1RKTA 1Y8RB 2CUZA 3BG5A 1HI9A 1NH3A 1Z3YA 5FKMA 3CC2I 2EZIA 1BJZA 2DMQA 2HDWA 3OEPA 4CUGA 2QSHX 2IAIA 3IRQA 2JPBA 2CGPA 1WCMK 5ILVA 1XMXA 3CDIA 3QU6A 4IQ4A 3G4SI 3PM1A 2W84A 3GTJA 2E5ZA 1S7EA 3HM5A 1D0YA 2PQ8A 3HOZK 2EZLA 2K3FA 1R1UA 3CMAI 3AAFA 4LJZA 2R7ZJ 4PK4A 2HVRA 4KASA 3GBGA 2E7WA 3I56I 2NVUB 1F5TA 2CFAA 1U3EM 1ETVA 2E2HC 2AXTC 4CGZA 1P4WA 1W0UA 3OYLA 2NVXC 2MFZA 2L7MP 2O61A 3KEOA 3S16C 2LG4A 3Q0WA 5LD2C 2V9PA 5FJ8J 3DKYA 1T38A 3K4LA 3BROA 4IRHA 2EWNA 5C44K 4HLYA 1WH5A 3ZR8X 3KZYA 4XLPF 1XMAA 2GAHC 4RAZA 3G1LA 3S1NC 1YE9A 4OAYA 2KKOA 2L7ZA 4L5IA 2A61A 2L7FP 2E36A 2L9VA 1QQIA 3W3CA 5DDGA 2DXIA 1TWCC 4HNTA 1P7IA 3ERED 2WAEA 1QPIA 2NRAC 1ORKA 2O8XA 1SMYA 4NBQA 4RDUA 2KZVA 3L9FA 3ML6A 4PJLA 1O29A 3A8KA 3HOZC 2ECBA 3PL8A 5L3FA 3ZGKA 3ZQFA 9ANTA 3GWZA 3H36A 2K9LA 2HU9A 4GCVA 2GWRA 2PBIA 2EJRA 2WY8Q 1YLFA 2X85A 3BQYA 1YX2A 3M07A 2O6GE 1VQKI 3I5UA 1Y0NA 1FYLA 2ELJA 4X6AJ 2BY0A 3VYUB 2WB1A 2VB6A 1Y1VA 5TMCA 3OIPA 1R36A 2ESNA 4X1EA 1PJ5A 4DYRA 1MNEA 3E5UA 3AG1H 1LVKA 2DOAA 4L9TA 1SD7A 3HRMA 1HW2A 1XXAA 1WZ2A 1SFEA 3LL7A 4GT9A 4HRIA 1I50K 2MBFA 4Z6YA 4BE0A 1WI9A 4FE4A 4IOAF 5IOYA 3K70C 4ETSA 1XGNA 1BI3A 2KQRA 4A12A 4AYBD 2NS7A 2JA5A 2F4IA 5FLVA 1ZAOA 2VUMJ 3B6CA 3W6KB 1FLIA 2ELKA 5LGNA 2VBWA 2BW3B 2MH9A 5CVVA 2VBZA 4WXCA 4JX4A 2FBIA 4ZYDA 4HX4A 3CLOA 1UV7A 4XOTA 1MJAA 2X1CA 1E0EA 4I2OA 5E8IA 3OOPA 3L2WA 3CP8A 5E3MA 2VL8A 3S1MK 1V5VA 4XRSG 5KNLA 1U8RA 1HKQA 1R6RA 4O6JA 3TEDA 3DBRB 1H0MA 1TP4A 2YUSA 4M73A 4PCQA 2ZMEC 3GTJC 1FZPB 4ENMA 4IXAA 2JRTA 1U9OA 4BY1J 2DA2A 2WY7Q 3A01B 3LSHA 3HOUK 3VB2A 3FMQA 2KL4A 3HOYJ 4A3CK 2VIXA 4G7ZA 2DPDA 3ONQA 4MTDA 1QZZA 1IJWC 1S7OA 5FGMA 1ZELA 5FKOA 5LEKA 1ZRDA 3DPUA 2ADUA 2K7LA 2J5OA 4BAYA 5JVGF 4KISA 5F1RA 4BJ5C 2OQGA 3JAMZ 1S6LA 4RGSA 5F27A 2H1LA 2KRCA 3DXJA 1K6OA 3CCUI 1RI7A 4AYBL 5F1JA 4ZDPA 2P7VB 1AHDP 3ZMSA 4N9HA 4RS8A 2PI0A 5BPIA 4B43A 2W24A 4KUMA 4A93K 2L9RA 2CMPA 3TO7A 4EJOA 2O3FA 4KITB 2DLLA 2XGCA 3KE2A 4RGXA 4WX9A 2H09A 3M9AA 1ZKGA 1IO2A 3MKLA 4KN7A 1LJ9A 1ZN2A 1IC8A 4C3IK 3RSNA 2XKPA 3BG6A 4LD5A 1NHAA 2HFHA 4OIPF 2EZHA 4QTRA 5IYDJ 3FOEA 2KPMA 1P9QC 2QENA 2Y31A 1HW1A 2AXLA 2MGQA 5JVTA 4BQAA 4B47A 2JA6A 1OFCX 3QU3A 3VYSB 3N4MA 3MD2A 4HDUA 1HOMA 3M3YC 1RNLA 4UVCA 3IH4A 3ZRGA 1B8IB 2YU9K 2IRFG 4M3BA 2OV7A 2CFOA 1QA6A 1OYWA 3BUEA 1EH7A 1VLOA 3BC8A 2M9HA 1FX7A 4GTEA 3W6JB 1Y1VC 2VBYA 4G7HA 2XVCA 3GLXA 3GF2A 3RPUA 2IS1A 4G6DA 4IHXA 3GTOK 4F92B 4A3KK 1DU0A 4NUBA 2W57A 1PJ6A 1V55H 1EV7A 1LKXA 4G7OF 2PMZL 3NQOA 3HL2A 2JA7A 2NVXJ 2LF7A 2R7UA 4GYGA 3S16J 2F2EA 1MMNA 4A93C 2NVQK 4XLEA 2R5ZB 1W1WE 1E3HA 5E8GA 1KGSA 2VXZA 5CYVA 1ZGAA 3GSIA 3I4PA 4I76A 1HKSA 4HX7A 5DUIA 3LQRA 1TLHB 5E3NA 3TL4X 2JA5C 2BBYA 2DYRH 2EFOA 4L9NA 3LA2A 4A3MK 2A5YB 2FOKA 3JSOA 1RRJA 2ICWG 1WCMJ 2RH6A 1OR7A 2Y0SD 2TDXA 5J1YA 4XM3A 2PPBA 5CVIA 2EFWA 1X31C 3IUOA 3HOZJ 1A5JA 2Z99A 4PSWA 5J47A 4LR2A 1I6HK 1XDSA 2JRMA 1AU7A 2VJ4A 1T8IA 1ON1A 5B5EC 2MH2A 3HC7A 4UUTA 3S93A 2KISA 3DBLB 1R1VA 2MLGA 2P7CB 5J1RA 5HOOA 2EA2A 4BXUA 1LQ1A 3MCZA 3BZKA 3G6EI 2KJCA 4HF0A 5KHDA 1MSEC 1XSVA 2NNNA 3VYTB 4AIJA 2XRNA 3C2GA 1DPRA 2W4SA 3OL4A 3CCQI 4Z2YA 2JA6K 4UUSA 3I4NK 5C44J 3ZXSA 1XS9A 3PNYA 2BOLA 5K5OA 4HF2A 1XGOA 1O25A 2V6UA 3QYEA 4G0UA 4FTHA 2LOOA 3WGIA 2OTJI 4CCMA 4XLAA 3K4BA 4R79A 2PHCB 3BJ6A 3AKZA 4BH9A 1SVLA 1VQ7I 2DI3A 3HTUA 2V9KA 1S5LC 2L02A 5ILUA 4E7HA 3OR2C 2JA7K 3M4OC 4XNFA 2JUCA 2YPRA 1IUFA 3SDBA 5BQTA 5FRMA 5GAHJ 2COBA 4CCOA 3WGHA 4DZPA 2Y0SL 4CH7A 4MEXA 1YW7A 2CUFA 2E35A 5KCMA 4C9YA 2CQNA 4LLGF 1EQRA 1XXCA 1N77A 5EZGA 1UZCA 1D1AA 3UR3C 1MH4A 3DPTA 2ZXWH 1X1BA 4I6ZA 4DNCA 2K5CA 4F7ZA 5FD6A 2DO7A 4WF2A 1YHQI 2DJIA 1B4AA 3BR6A 1PDNC 4KIGA 4BLBA 3K4MA 1G3YA 1K83A 1VQ4I 3CJTB 2JA6C 3TO9A 3AQOA 1O2AA 4CYCB 1GLNA 3ZQIA 3FXOA 1R71A 1NK2P 5K7HA 1KQ4A 1Y1WC 3MMYB 3ULQB 2DK8A 2DOFA 4DZJA 3H5AA 1R00A 4P9FA 4UVBA 1WORA 5EYRA 1SD5A 3CCJI 2ID6A 2OZ6A 1LEAA 4WXDA 2PN6A 1MMSA 1BGWA 2JPCA 1E2XA 4IHWA 2EK5A 2NVTK 2JA7C 3K4KA 5IYBK 1QO0D 1QU3A 2HZDA 3DWLE 5EG0B 4B44A 3RKQA 1MMGA 3MVPA 3VODA 4BJTA 2R7ZA 4ZYEA 2EQRA 3AL0C 4DDQA 3CC7I 4DBQA 3OSGA 2KRHA 5F64A 1ZR4A 2VODA 1NG7A 3H3VD 3S14K 3S1RK 2HTJA 3F3XA 5C4JK 3JRBA 4BBRK 2V1DA 1AOYA 4BQNA 2R92K 1H9GA 3MZ8A 3S1MJ 1MDMB 1SFKA 3OYAA 2Q1ZB 3GEEA 3H9GA 4ILDA 4UUVA 1G3SA 1OR7C 2OPTA 3GCMA 1WFXA 3BQZA 4XKWA 3V7CA 1ETQA 3PUFA 3GLLA 4P1WA 1U8BA 3Q0VA 1WSUA 3RKXA 1VH2A 4HLXA 2IA1A 2LY2A 4I0BA 3HOUJ 2GBYA 3M3YJ 3H1CA 4A3CJ 4BKXA 4ESJA 4HYEA 2ECCA 2QGUA 1JQWA 1F4KA 3DLLF 1ZLKA 4LOWA 1S3JA 2R7XA 1JVIA 1XSXA 4RAGA 4Y33A 2DTZA 1FSEA 1FY7A 1Y1VJ 3K6GA 1EJ9A 5IYBC 2NVTC 4ZDOA 1USMA 2VC1A 3BPXA 4I98B 4G7ZF 3RZOC 2LK2A 3LOCA 1IG7A 3MN2A 4KT5C 1JTYA 3D1NI 1SEUA 4KMDA 3S2HK 4CICA 3AD9C 3GZ5A 4OAZA 4XL9A 1YIOA 2AS5F 1T56A 1ZG5A 5C4JC 1XGSA 3SFZA 4A93J 1YRNB 2STTA 4BBRC 3GTPK 1ETWA 1KYWA 5M5WK 2WBMA 2EFNA 4C30A 3KIOA 2JA8K 2ME6A 4ZYGA 4AUXA 3C2HA 4KNYA 4UY8I 4C3IJ 3H3VL 3PNTA 1OCPA 1HA8A 3CCMI 2JUGA 2XIGA 3G3ZA 3T5XA 4KC6A 3PQKA 2CUEA 3VFZA 2HEOA 5HDKA 5JFEA 1JHFA 3OOUA 3V8JA 4J00A 4IPAA 5EGEA 2F5FA 1X4PA 3WG9A 2P5MA 4A5MA 2EFPA 1K6YA 2YU9J 5J1UA 4ZTJA 3ZN0A 1FJLA 5IP7C 2P8TA 3GIRA 1XZPA 3RDIA 4QLCU 2Y69H 3BR5A 3K2AA 1TNTA 1T6SA 1MGTA 3G71I 2UZKA 2M8EA 2WB1D 3Q9SA 1BI2A 4FQGA 2MABA 3PO2C 3GTOJ 4A3KJ 4XONA 1K83C 3MKWB 2VJJA 2LNBA 1H89C 1OPCA 4C45A 3E6BA 2QQBA 2IJLA 2ZFZA 3P9CA 5TMFA 3F0CA 1IN5A 2FX0A 4BXFA 1IV8A 2VE8A 1RC9A 3KP2A 3T0YA 1QHGA 2NVQJ 4N0BA 2VOPA 2FU4A 3G2BA 5IOQA 2L5QA 2R93K 4JQFA 2V4JC 2ISYA 3KLOA 5EJCA 5IP9K 1IL2A 3OYIA 1WSRA 5D5XB 1U0JA 2XPWA 3E3VA 1OCTC 2FA5A 1OYYA 1YQAA 1L0OC 1MNDA 2FSWA 2QWWA 3EETA 5E20A 4N4NB 1BJTA 2R7ZC 3QYFA 2RC4A 1VQ6I 1BI0A 3M7GA 2RN7A 1BC7C 4EJTA 4PGHA 4XOPA 1WQFA 4WCGA 4FISA 3O8GA 2L01A 4FHTA 5D6FA 5C3EK 3HTSB 2A68F 4OWRB 3P5JA 3N0CA 3ROUA 2VT3A 3HOVK 3BZCA 3N97A 1IAWA 4XBFA 2Z3YA 4EM2A 2IS6A 1S7AA 2JJ7A 2WB1L 3EUHC 4KMUX 5IYCC 2BY3A 2JA6J 4KJZA 2GAGC 1QBJA 3I4NJ 3WTVC 2MA3A 5GP9A 2KDOA 2X9DA 1WQGA 4F52A 1SMTA 4M6XA 3G4AA 4G6QA 4H4KC 4MNUA 5GPAA 2G7HA 3OIQA 3FK7A 4NHJA 4W1UA 1GHCA 3KYDB 1OQYA 2X1EA 1PVEA 2DT5A 4AIHA 2RGRA 2HKXA 4UB6C 1U2WA 2N8GA 2FD5A 4XKCA 4BU2A 4A3LK 2VXDA 2JA7J 3WG7H 4M72A 1EH1A 1T08B 4Y13A 2MC3A 1H8AC 2K4BA 2KZGA 4PDKA 2HPMA 4YFXA 2XB5A 3S1QC 4U7DA 5GAGJ 4KYWA 1N25A 2DODA 1ETYA 1EA3A 2L7KA 3JSPA 1JTXA 4B3AA 3P9IA 5EEAA 4J01A 3ERMA 1DCPA 4A3DK 4Q47A 2UWMA 2RDPA 4D7MA 2HNHA 3I0TA 3H0GK 2G7UA 1V54H 1P7JA 2ETHA 4D5FA 2A69A 1HCRA 1WSVA 1TWFA 4E7JA 2UXNA 2M3AA 4H0EA 3QX3A 2V6TA 4BQOA 1ZXOA 1G3WA 1WCMA 3HHGA 3OYHA 2ACJA 1L0WA 3W6VA 4MO7A 1D3YA 3Q5FA 4KN4X 4XLCA 3E1SA 5AONA 3O3KA 2DMNA 2EV0A 2IVMA 2VT2A 2MD0A 3L2RA 3IC7A 3W2VA 1VQOI 5IYBJ 3CC4I 2NVTJ 1XMKA 1X4OA 3DU6A 4C3HK 3U21A 2ZXJA 3L09A 4XKVA 1K79A 1D8JA 3CUOA 3S14J 3S1RJ 3SFIA 5HDNA 5C4JJ 2QM3A 2ELHA 2M0MA 1TQPA 4BBRJ 2Y9ZA 3AH5A 1XD7A 2E34A 2H94A 3WU1B 4G0VA 5DTDA 2R92J 2CW8A 1I5ZA 4BY1C 3F9KA 4XR6A 1E3OC 2O5RA 2E71A 2HVSA 3A4CA 2RREA 3JTHA 4OIRF 4MLOA 2R7WA 4AVZA 4JX5A 3FHZA 1IRZA 4NNJA 1JXSA 4XCHA 1RPWA 5CKTA 2COMA 3S3MA 5IT3A 2BW3A 2RQQA 1FYMA 3ADAC 5IP7J 4XLFA 3RQ4A 2HXIA 2IA2A 3R6SA 3CMMA 3HZJA 1XB4A 2Z33A 2M1BA 5L3BA 2Z16A 1SC7A 1C0AA 2GSNA 3AG3H 2YX4A 2CH0A 5FLMK 3VOEA 1SVOA 2NOJB 3HRUA 1Z91A 3OL3A 3S2HJ 5JI6A 1WHUA 3I4MK 5ILSA 1IN4A 3HUGB 4U0VA 2OUMA 2M0CA 1UHMA 1P2FA 3FBNB 2OU2A 4RM3A 1TWFK 1SAXA 4WK8F 2JSCA 2CSOA 4P9UA 3IAM2 3HOSA 2R0QC 3GTPJ 3A01A 5IYDC 1J5YA 1FMWA 5M5WJ 4F91B 2CUJA 3RKYA 1TW3A 2JA8J 2R3SA 2OCCH 3L7WA 2H8RA 3QAHA 4RAYA 1JKRC 5D5UB 2CQXA 4BDZA 3CAGA 1I50A 5J8FA 4BEHA 3C7JA 2A6HF 2DJNA 1IN8A 3KP3A 5AIQA 3MZHA 1E17A 1AA7A 2EPFA 5EGOA 3HHHA 2GXBA 1BM9A 2F48A 1BBYA 1SFOK 1FYKA 5J4VA 2HXOA 3FF5A 2QQ8A 1W36D 1MKMA 5K5QA 4HF1A 2DMUA 1VRQC 1R4MB 4KT6A 1LB2A 4MEYA 1IRGA 2GOMA 2X0LA 3IPJA 3ZQ7A 4G9YA 1R58A 4A0YA 4ENKA 1SFUA 2EIJH 2Z9OA 1UMQA 2E60A 2EH3A 2ME0A 3BCAA 1TWFC 3I59A 2EBBA 2HGCA 5IYCJ 3PIPF 3DTEA 2CV2A 4A2UA 3IH3A 4P9SA 2H8WA 5M5YK 3SZPA 2BYVE 3TQNA 3WU2C 1WJFA 1WCMC 1B8IA 4EJUA 3R61A 2R93J 2WADA 2VKHA 5F04A 2OC6A 4LLGA 4Y52K 4KIBA 1MJ9A 5IP9J 5D4RA 1HXDA 4RLQA 3PFYA 4IL6C 2EA4A 3KZZA 2NXNB 3OIOA 2BY2A 4GRIA 4JBAA 2CRGA 3OYMA 3QODA 3CESA 3IWZA 1VQLI 2BZTA 1JKQC 2DFFA 3KP5A 4NQWB 4UV9A 4Y7NK 3CCRI 2EZKA 3MQ0A 3PFIA 4ZH4A 1X3UA 5C3EJ 4ENJA 3S1QJ 1J6WA 2R5ZA 1C0WA 1WVRA 2CFXA 2GQQA 1R22A 3GVAA 2LY1A 3KPHA 3E7LA 5H6RA 4LLLA 4B48A 3JREA 5C44C 1K4TA 3HOVJ 1UHSA 1XN7A 1M1EB 2LR8A 5HNFA 1W5TA 2L54A 4V2GA 4ZDLA 3HXAA 3FM5A 2LD5A 2BHZA 4DIQA 5J4YA 4YG2A 5D8KB 2YSRA 4Q5SF 4OMZA 2F6CA 5ICGA 3QRFF 1IDYA 3J80K 4HPQA 1R4NB 3O8HA 2EINH 2J5PA 3JRHA 2O9LA 4CHUA 2DT7B 2BE5F 3IKTA 3ZPLA 3RPQA 3J7ZI 3QQAA 4PFOA 2FRHA 2XSDC 1YJWI 4LFUA 3TP3A 3JRAA 2YU9A 2LDUA 1YX5A 3E6DA 3HB9A 4A3LJ 4XKBA 3TTGA 4M6VA 5IT9K 5E18F 1J75A 5E3LA 3CF5F 3E5XA 3DEEA 2M7BA 3BJOA 3DP7A 5JHUA 1ACIA 3QOPA 1BR1A 5HLHA 3GTOA 4JP0A 4JK1X 5DD8A 4AYBN 1HW5A 1XXBA 1D5YA 1ZBSA 1G6NA 2RAEA 1XCVA 5D8LB 3FIWA 1Q1HA 3DKXA 3OMYA 3F6OA 3OYKA 1MZBA 4A3DJ 4KDDA 1Y39A 1OKRA 4M9SA 4XICA 4DOZA 1I50C 3QP5A 4YFXF 4UVAA 3FM3A 2GXGA 3U1DA 2ZXIA 3H0GJ 3R60A 3JRGA 3G4CA 2DAOA 3AG2H 3E5QA 5A2QZ 2CYYA 2OQRA 3SHFA 5L3DA 2ZNYA 3Q0UA 1INNA 2PMZD 3GTLA 2HOSA 1XDUA 1FNNA 1G3TA 1W7PD 4NC8A 3WTWC 3UNGC 1DCOA 3TKYA 4BEHB 3HRSA 1OCCH 3W2AA 1HDPA 2KT0A 5LLQA 2A69F 4OOIA 4ZYAA 1Y0UA 2K02A 3GMEA 5EGOB 4W97A 1I3AA 3H3ZA 4IQJA 5FKNA 1B1BA 3LA3A 2P5LC 1GV2A 2DMPA 3HPGA 1ZRCA 3T01A 4BBSK 3EYIA 3CDLA 1JKPC 4C3HJ 4U7BA 1RESA 4HZFA 2Z1DA 3S1MC 3F8FA 4CYCA 1IV6A 4A3JK 1FP2A 2PMZN 2FXAA 3OY9A 4G12A 3M1EA 5H20A 3I59B 4MGRA 2V9VA 1I3QK 1IRFA 1QNTA 3HOUC 4HBLA 2WAQD 5EGHA 4A3CC 1O3SA 1CF7B 4J3NA 1UJ8A 1X3ZB 3WGGA 1PP7U 2BHYA 3LSJA 3G73A 3FKIK 2DFHA 5HODA 1O3QA 4AU7A 2R5YA 1LFUP 4CCNA 5EG0A 1XGMA 2KIMA 4L0ZB 1W5SA 2DN0A 1BOBA 3LSPA 4G8XA 2FNAA 5GAEJ 1BR2A 3K4NA 1HLVA 1WJBA 5FLMJ 3OYNA 3G1OA 1I6VA 4HV6A 5F0FA 3L4KA 3WTUC 1MDMA 1JT0A 4HDVA 1EK8A 1OCRH 1IW7F 3I4MJ 4Y17A 2HZTA 3GFJA 3I64A 2P5VA 3HKZD 4QIWD 3OYDA 4AD9A 1T0FA 2NVYA 1MMDA 1TWFJ 2YX7A 3ZQLA 2CG4A 1RR8C 4II2A 3FWEA 3FK6A 2OAZA 3HGYA 5GPCA 4C3IC 3M8JA 2R7TA 5IOSA 2W85A 3GTLK 3AFHA 2VQHA 3F8NA 1ODDA 1MBGA 1GXQA 3DTKA 1LDJA 3REOA 1Z1DA 3FISA 2PJPA 1B4BA 2DA5A 2A68A 1F93A 5LHHA 2YU9C 1OJLA 2HQRA 3RJPA 1Z6RA 5CQGA 3Q3SA 2DBBA 1WJCA 3ZN1A 5K7FA 2HPIA 4B1RA 3KEYA 2E1MB 4LITA 2WAQL 3KYCB 4AC0A 3GTOC 2QQAA 4A3KC 5FLXK 3V7RA 5JFRA 2FE3A 2LF8A 4MHGA 1REPC 1ETKA 4O5VA 1YRNA 4M1XA 5C4XK 3BCBA 1LDDA 4PSXA 5HNHA 2HOTA 2Y0SN 2XAUA 3TMOA 2NVQC 1OYIA 1BN5A 4LLNA 3GZ6A 5DYMA 1FBUA 1XZQB 3D5LA 2XHKA 1XCBA 3ABUA 4QWQA 3GTLC 5M5YJ 3HOWK 4A3MC 1IN6A 4IO9F 2R7QA 2MSYA 4MEYF 4RB0A 2R92A 3WTYC 2LREA 4LB6B 3HKZL 4EV0A 2I5UA 3PIOF 4QIWL 4Y52J 1D0XA 3WODA 3CCYA 3PO3K 4CCJA 1USTA 4YRVA 2V7FA 5DCMB 5CVRA 1I6HC 1BOAA 4O2DA 2XPVA 3O2PE 2OD5A 4L9JA 1UELB 4CSWA 1DDNA 2BY1A 1YFHA 1ISEA 3A02A 1BI1A 3N0BA 1WI3A 3CCVI 2NVYK 3K7AK 1X1CA 1LDKB 2L9NA 2Y75A 1BW5A 2XCOA 2Y2ZA 5IY5H 3I55I 4PAAA 4A6EA 2EFQA 2VQLA 1KONA 2FBHA 1X1PA 1F7VA 1BJAA 1S29A 3HOXK 2JA2A 3DKWA 3ZQHA 3F8BA 1WOOA 4A3IK 1UHWA 2FEZA 3JR9A 2VKDA 4XORA 5F0HA 3Q9VA 1RIOH 3I4NC 3B6AA 3EYYA 2KIUA 4M3GA 1I50J 4ZH4F 3BR2A 3GTPA 2VPRA 3IV5A 1G8XA 1R49A 1DGWY 3K70D 3TDZC 2NYXA 2QKLB 1A6QA 3SEQA 2DFIA 2DPUA 3ECOA 3VEPA 5L3CA 1B59A 1V5FA 3E97A 1P4AA 2DOEA 4B09A 3PO3C 2LFBA 5B1BH 4IX7A 4C2UA 2WV0A 3H35A 2O03A 2KWAA 1D0ZA 3K4CA 2XAHA 4B8XA 2R5YB 3TFJA 1ZK8A 4YG2F 4FE7A 2CJJA 3P7NA 4EMSA 1USOA 1WH7A 2XCQA 2HWVA 2QSFX 5H2FC 1O3TA 2E2JK 1T0FC 3I53A 5DEQA 2NVYC 1R9TK 1R5HA 3OYGA 2PFBA 1GT0C 4OIRA 5FFZA 2Y9YA 2UV1A 2K85A 3IH2A 4HV5A 1FIAA 1STZA 4U87A 3X2QH 4AWXB 1IE0A 1KU9A 3J81K 4L0YB 3RIRA 2TCTA 4KMAA 3F8CA 1KZHA 5CHPA 3CJNA 4M71A 2KIQA 4EVIA 1ZYRA 2L2OA 4FX4A 2FQOA 1SFXA 2ZKZA 1CGPA 2BV6A 1R1TA 5K7ZA 4OINF 1TW2A 2H6BA 2VE9A 1YTYA 4A3BK 2R7FA 4RGRA 5TJ3A 2R93A 1LE8B 5D4SA 5HS7A 5LGTA 3SZTA 4AVPA 3T8RA 1HQMA 3A8IA 3S2DK 3GTKA 3HSFA 3ZMTA 1IXRC 4ESFA 1B9NA 3S17K 5CVJA 4A3EK 1FOYA 3ASNH 2W1OA 2D5VA 4I99C 4UNOA 1TC3C 4RGUA 3I3LA 2CV1A 2E1CA 2ZSHB 1LPQA 4R1HA 4XRMA 5HL8A 3S14C 1MBKA 2CQ7A 2TRTA 3BP8A 3OV8A 4BBSJ 2LBFB 3S1RC 3V7SA 5ED4A 1O3RA 1DGRM 1ZGWA 5K5RA 2HQAA 3HOTA 2R92C 2K9NA 4AYBA 4E7SA 4IHYA 2A6HA 4MTEA 2HDDA 4A3JJ 2H1KA 2V79A 2KP6A 1TWHK 1V5GA 2F5DA 3D5RC 3CQZA 3CUQA 1EKEA 3HSEA 2ISZA 5HLTA 1J59A 5F0CA 4QJVA 1I3QJ 1YW8A 2K9SA 1A6IA 4HOBA 4D5CA 2DMTA 2QVOA 4KAWX 3OR1C 3ECHA 2H6CA 5AIPA 1KYZA 4EJWA 1DUXC 2B63A 4LQYA 3S0XA 1MBEA 3FKIJ 1Z05A 2OF7A 3OYBA 3LAJA 2FBKA 3ISPA 5HDGA 2CQKA 2AO9A 2BVLA 3FXJA 4IVNA 1JUPA 3WTTC 1X19A 3TOBA 5EF6A 1FTTA 1UG2A 1LNWA 3S2HC 3F8MA 1DU6A 4N4OB 1E3PA 4R8HA 1UFMA 2OZUA 2PEXA 3BR0A 4OMYA 4D0PA 5FLXZ 2CW0A 2PX9A 3GTPC 2JMWA 3WTZA 4EATA 2JA8C 1ITYA 3H5NA 2VJIA 3J7AY 4PJMA 3GTLJ 2WB1N 3GTKK 1D8KA 4A3MJ 2RQPA 1MD0A 4MQVA 3SXYA 3S32A 1OLTA 4E70A 1DPUA 4KB2A 4C2TA 1TT0A 2VKVA 1R7JA 1YS6A 4N9IA 4EJVA 2RGVA 3H0GA 2O0YA 5HLGA 2VLAA 3LPXA 5DD4A 3F23A 1TWAK 4BE1A 3B73A 1V4RA 1MJBA 3FHNA 3ABTA 3KFWX 1N75A 4FASD 3QOEA 3ZMVA 4LOCA 4S04A 1I6HJ 4JX6A 2M5WA 3HUGA 2QLZA 2IBDA 1T95A 1FOXA 1UG0A 1FEXA 4Q5SA 2MLKA 2XGXA 3CQZK 3ZP5A 2QBYA 3BPVA 1ZH5A 5C4XJ 2GOXB 3RCOA 4IEJA 4I09A 5FROA 1MNMC 2BE5A 2ZFWA 3GUDA 4HA8A 4LGWA 4XLHA 1QGPA 3MWMA 2JSPA 1IGNA 2HDCA 1JE8A 1VTNC 2B63K 4M74A 2R93C 1VQNI 1UAAA 3HOWJ 1WRJA 2E7XA 3E6MA 5IP9C 1TZLA 2IGKA 1ZHFA 2FF4A 3R4KA 5CPRB 4LK0A 1J0RA 4D1QA 3OSFA 1A36A 5BNGA 3PO3J 3WTXC 3OREA 4XSZA 2YU3A 3CD6I 2I10A 2D45A 2F4MB 2XAJA 3DPLC 4ZTFA 2A6EA 4EGYA 3BP8C 5LRRA 1JHHA 4AM3A 3GZNB 4M6YA 2X6OA 2HYGD 3PSIA 4RM2A 5C3EC 1VQ8I 4CCLA 2E1OA 3WODF 1ZVUA 2NVYJ 1F43A 3MMLB 3K7AJ 1QPMA 3S8PA 3K1PA 3CJRB 4BHCA 5GTHC 3PUBA 5BS6A 3HOVC 4BNCA 1LUJB 1DP7P 2Y0SA 1VFCA 1YJ9I 2X1DA 3ZMDA 1ZR2A 1GDTA 1IS1A 3LFKA 5J6XA 4NB5A 4LG3A 3K9TA 3MAJA 1S9HA 5JR3A 1XPPA 3GTMA 4A3IJ 1XTAA 5M5XK 2A07F 2XGDA 2I8DA 3VA7A 2XRLA 2GZWA 3GX4X 3EUAA 2K86A 4Y4RA 1TT5B 1PJ7A 3CUQB 1WQHA 4DJAA 2XAQA 4C3JK 4YIFA 4A3GK 1L3LA 5IPAA 1YW9A 1RUNA 2LY9A 5GTIC 2DYSH 3HIFA 1X2NA 4QJVB 2ZFUA 3QPTA 5J3LA 3RPUD 4GTBA 1FT9A 3DCFA 3HBLA 2HI3A 3K0LA 2FMYA 4NQWA 1GVDA 3BP3A 4QSHA 1N78A 2VN2A 4KMFA 4FM9A 4A3LC 3BDDA 1PP8F 3FBIB 2E1NA 2FNPA 2KRFA 3HOYK 2M30A 2XV4S 2CQQA 1RUOA 1VJEA 1O26A 4XMYA 1R23A 2A6TA 1TTYA 3QWLA 2ZUEA 3BLYA 5DCFA 2E2JJ 4ZYHA 1R9TJ 1SFOA 2K9MA 2K40A 4A6DA 4HX8A 2DA3A 2DTRA 4JOMA 3FOFA 3GTGK 4A3DC 1BW6A 4OIOF 2WC2A 3BTCA 3JRDA 1TBXA 2V1UA 3V4GA 3IWFA 3K4JA 4HSRA 1O7LA 5LGUA 3TGNA 3H0GC 2IP2A 2OBPA 1PUFA 2HKOA 1W7PB 1IQ0A 3S15K 2XSJC 2HS5A 1MBHA 3SYTA 2DFEA 2K27A 2K9QA 4F93B 4A3GC 4MFEA 1I1GA 2JN6A 4GTFA 2JK3A 1TWGA 2WAFA 4A3BJ 2XF7A 1SVMA 2M87A 1BC8C 1MSFC 3H9JA 3KYLA 5E17F 4BHBA 3AQPA 1IW7A 1RR7A 3A0BC 5D4DA 2KHMA 3KX2A 1Z67A 3NEUA 3T00A 1ZYRF 4RLFA 4L18B 3S2DJ 1Q1VA 1BA5A 1FSHA 1WJEA 1R5GA 3I54A 1MH3A 4A3EJ 1RKWA 1U9NA 2DA7A 3TBIA 1VI0A 2O5IA 4EM0B 4UV8A 3ZMZA 1QZYA 4LMYA 4M3DA 2HR3A 2IEKA 3HGGA 4EM1A 3JAMK 4C3HC 4S05A 3GTMK 1O7FA 5F08A 5KAFC 3L2QA 1XPXA 5FD5A 2KIFA 3Q3QA 1W4MA 2DA4A 2EV6A 1Z7UA 1ZTRA 4IZZA 3MZYA 5FKLA 4G0WA 1YJNI 1T2KA 1HDDC 2QBYB 1XSDA 1T39A 3JCUC 3K1MA 4CZZA 4KA4A 2ZJPF 5EZHA 4KMUA 2E2HK 2M45A 3V8LA 1U5TB 1PUEE 3SZZA 4RMFA 2XF5A 1JKOC 2F4OB 4PZJA 5FKKA 3VSKA 1J6VA 5CJ9A 4ON0A 4YFKF 1VQPI 2GAUA 2ZJQF 1GE9A 1R5ID 1DQUA 4OIQA 3ZCOA 3TW6A 3L2CA 1BS2A 2FJ1A 3S1NK 4CO8A 1TNSA 1NK3P 2K4JA 5L46A 5TGTA 2O7OA 1FOWA 2QCOA 3CF2A 4KFCA 1UCRA 2R7VA 1TWCK 1VF9A 2KFDA 2XF6A 3LSMA 3ZMUA 5B3SH 2IGMA 4WXHA 2MYSA 5FLMC 5B66C 1IRXA 1ULYA 2DW4A 4AH6A 3AD7C 4GFBA 5HS9A 2ZMEA 3I4MC 4HG2A 2CW7A 3RQIA 3JW4A 1JOEA 4CZCA 1B9MA 2W7NA 3GTMC 1HBXG 1U6GA 1Y6IA 4BY7K 4PGGA 5LEJA 1TWGK 4L5EA 4P96A 3CZ6A 3BTJA 1O28A 1EH6A 3KP7A 1CF7A 1TQMA 2Y3PA 5E1WA 2D1VA 1XC5A 2DQLA 4GTLA 2QZ8A 1JUSA 2AQFA 2XUBA 3M8EA 3BOQA 4U0WA 4YIIA 3MKZA 1GXPA 1A04A 2GXAA 3GTKJ 4E7LA 3G1MA 3ZQQA 4A5NA 2CW0F 2ZBKA 4KN7X 3B02A 3GTQA 2R7OA 3PQJA 4C2MK 3LA7A 1HSTA 3T02A 2ZXHA 1TWAJ 2EB7A 2PG4A 4EQQA 1FIPA 3EQLA 4KN4A 1SFOC 2HQNA 1WWXA 1OCZH 5FO5A 5E79C 3IKVA 2NAZA 1ZREA 1RZ4A 1F9NA 2MW8A 4I0AA 4I7HA 1HQCA 1D1CA 5E3OA 1IZ1A 4A0XA 3CQZJ 3OS1A 4ZJZA 2VI6A 3BY6A 2EBIA 4Q48A 1JJ8C 1J9IA 2MG4A 3F21A 4HW0A 4BY7C 4IF4A 2DCEA 4CCKA 2A5WA 4PFPA 2JH3A 1TWGC 2BEOA 1Y8QB 2JTVA 2X6XA 3OS2A 2QA4I 3H3VK 4GTAA 3DV8A 3OYJA 3CO6C 2R7RA 5ICFA 2LKXA 1OISA 2IPQX 1BDFA 2B63J 4KIFA 1DD5A 4Y52C 1WOSA 1PUFB 4DYQA 1A31A 1WJDA 1AKHB 4XN3A 4NDLA 4V19K 2CU7A 2JT1A 1I3QA 1JT6A 1CQTA 2KLOA 4C2MC 3HJEA 4XRSA 4KATA 4GZYA 3GTJK 4M9ZA 1QZEA 4HQEA 4Y7NC 3AG4H 5GADJ 2QF7A 3FKIA 2HYJA 1NTCA 3KLNA 1LFBA 1USSA 1ZARA 2B7EA 3BR3A 1SD4A 3SEZA 3FZVA 2P5KA 2AHQA 4EGZA 4BLAA 3ELKA 4FT8A 4OINA 4LK0F 1XZQA 3LSRA 2Y30A 1EI6A 2WTEA 3H9QA 3EUKL 2WA0A 4XSZF 4E6KG 2VKEA 1KQ0A 2XAGA 2A6EF 1LFPA 4XSXF 4IKFA 4IOCF 3GTQK 4KMHA 4KICA 4XN0A 2DDBA 4K2EA 5M5XJ 4YFNF 1JJ6C 4LG0B 3KP4A 3QP6A 1KQ8A 4BHPA 4RMNA 3QYBA 4GGGA 3U1KA 1I27A 4C3JJ 4Q4ZF 4A3GJ 3ABKH 3DFGA 2Q8KA 2LVSA 5DM7F 5CVUA 4V2FA 5DCMA 1EFWA 2JVGA 3K1NA 2EV5A 1XG1A 3GFIA 3K69A 3RYRA 4WILA 4L5JA 1K78A 3I9V2 3QPLA 2LRDA 3L2VA 2VC0A 1ENHA 2FUG2 4A0ZA 3LNQA 4BUPA 1WKMA 1MMAA 1X2MA 3M3YK 5M3FK 3BG9A 1FBSA 2E2IA 2ID3A 1ERDA 2PJRA 2PLYA 3HXLA 2RVCA 2ZMEB 4DQ2A 1X3WB 1Y1VK 1J98A 2VBXA 3GTGJ 3R0AA 3TW7A 3CMEI 1EF4A 5L3EA 3GTQC 2JQ7A 5ICCA 4MIMA 5JLXA 4ANJA 4U88A 2CFAB 2LLKA 1ZGJA 1IUYA 2KJBA 2KMUA 2ZSIB 4UXNA 3RZDK 3FDYA 3S15J 3VPRA 3JRIA 1ONVA 1DP3A 1KU7A 1NG6A 2DQRA 2VOOA 3S3OA 4ENNA 2STWA 2XDVA 1FP1D 3F72A 2JA5K 4LK1A 2BXYA 4RB2C 5H6QA 3WHCA 2VONA 2Q0OA 3H3UA 1HSJA 2GIVA 1JGSA 3BG7A 4G94A 1EH8A 4CXFA 4BBSC 3COAC 1X1DA 3T1BA 2WAQN 4XLNA 2XGEA 5JHFA 2W00A 3MKYB 3FXKA 3GTMJ 1Y1WA 2P6SA 4LIUA 3SZGA 4BACA 2GSOA 1VQMI 4U0YA 4A3JC 1D5VA 3TFIA 4I02A 1KU2A 4GTDA 5M3MK 3UKGA 4LIVA 3H92A 3N3YA 2YR2A 3DQVC 4BS9A 1Z9CA 1YIJI 4HNUA 2E1MC 1I3QC 2E2HJ 3CP2A 1MBFA 2L0KA 1YYVA 1J7KA 3CTAA 3IP4B 2W82A 2R7SA 1LE8A 4QPQA 2UUZA 5CLSA 2IGOA 4IRIA 2QQ9A 5JLWA 3RZDC 2VPLA 3KETA 3IRRA 5E1ZB 1YNJA 3FKIC 4B3XA 2QEXI 2R4GA 3MFKA 1GVJA 3HKZN 1WQ2A 2E2IK 4QIWN 2LKPA 2VQGA 4F3QA 4YELA 2H27A 3S1NJ 1MBJA 5BOXA 3ESWB 5BMZA 2QKMB 3LSTA 2IW5A 5ERIA 5TISC 1SFOJ 1KU3A 2MC4A 3OYEA 2IS4A 1TWCJ 1WOPA 1POGA 2LBFA 3BG3A 3EDPA 3HEFA 4HEA2 4XIDA 3BR1A 3N05A 4OIQF 1B6AA 2IGNA 4A3FK 4PABA 4RAFA 1H88C 2ZCWA 1ZQ1C 3SJMA 2XPUA 4M3EA 1O4XA 3M4OK 1HF0A 4BXXK 1ZQ3P 2V6CA 4UHTA 4JK1A 3HDDA 1R9TA 4BY7J 1RETA 2IXSA 2D1HA 1IN7A 4D7NA 1TWGJ 5J40A 1FWZA 1F36A 1OMIA 4ZZLA 1PJRA 3VYRB 4XQFA 3NUHA 1PYVA 1ETOA 3S3NA 1ZG3A 2NS0A 1SD6A 4RB3C 2M4GA 1YG2A 1Z0XA 4LJZF 3J7YJ 2X4HA 2O8KA 3ZOBA 2JVHA 3FX3A 2Q2EA 4C2MJ 1J6XA 2P4WA 3J80Z 3KP6A 1Z3XA 2E2IC 3WE3A 2O5JA 2A05A 5HVQC 3DLAA 1Y1WK 2Y48A 4PUSA 1B72A 4GXOA 4Y7NJ 1I1SA 3PSFA 5D6EA 4GTCA 1K78B 4A69C 4B4CA 3RKWA 3JRCA 5JVOA 2DK5A 2QSGX 5C4XC 1VQ9I 3CCSI 1FMVA 4A3FC 4NC6A 3LQQA 4MFDA 1X1AA 5IT9Z 2V26A 2PJRB 1FBQA 3HSRA 3EQLF 3PNVA 5DUKA 2LH9A 1IF1A 4BXXC 1T98A 2HVQA 2LYCA 1VQ5I 1AWCA 4WJ3M 2L4MA 1J2XA 3A1YA 3LMMA 3HOWC 4IHSA 2HTSA 3H5RA 1SMYF 3GDZA 5DS9A 2GIZA 4IHTA 3LAPA 1P92A 2XASA 1TWHA 2P0WA 3A03A 3WHBA 2M2EA 2D2WA 2A3SA 5LHGA 3M8FA 2LP0A 3CJQB 4YIRX 2CWEA
chains in the Genus database with same CATH topology
1YS7A 3HYIA 4IRGA 2F5EA 3GXOA 3FMRA 2XROA 4KDPA 4BYYA 2CO5A 5FB2A 5L3GA 3GFLA 4I01A 3U9GA 3CO7C 2GA1A 3O6BB 3T8TA 2Y0MA 2Z5UA 2OA4A 3L4JA 3V8KA 5EEGA 5TJJA 1AB4A 2QYOA 5BPDA 3F22A 4O3MA 3IL2A 5FFXA 3C3WA 3JTGA 3EUHA 1TWAA 3IHUA 2HOEA 6PAXA 2MD5A 2XAFA 2L4AA 3FMSA 3GO5A 3J7AO 3FXQA 2V1XA 3QPHA 1ZLJA 5DV5A 2WWYA 2P6TA 3TOAA 2C6YA 2XCRB 5E1XA 4TV7A 5KK1A 2RV8A 5LBQA 2RKHA 1S8NA 3I58A 3GFMA 4ZZDA 5IORA 3S2WA 1ZRFA 2W25A 2GSUA 2B0LA 3BJAA 3TDUC 5D5WB 3DXJF 3GYHX 1FOKA 5HLIA 3RTRA 3WE2A 1LVAA 4ASNA 4M9XA 4P5BA 1HKTA 1WIHA 2GA2A 5KVRA 4KM9A 3HRTA 4LK1F 1O57A 1W7PA 2VUMA 3BZ6A 3NRVA 4L9VA 1ON2A 3BWGA 4XLNF 1H9TA 1UB9A 4XRFA 3DEUA 1IXSB 3KEQA 3CDHA 4G7HF 3WTSC 4CYDA 1FPQA 2IA0A 3C1DA 3SQNA 5K1YA 3E6CC 3U2RA 1U5TA 2UXXA 3DF8A 3GW2A 4IJAA 3RI4A 5EEHA 4FX0A 3GTGA 4GO1A 2BGCA 1I6XA 1LEBA 5LRSA 4HAMA 3R0JA 3FXRA 2JZYA 1U78A 1TQIA 3WU0A 2ESHA 2ZJ2A 1P4XA 5D5VB 3C18A 4GYIA 4GFQA 4BKWA 2ZNZA 3CUQC 2LSOA 4KM8A 2RNJA 1KQ9A 3K2ZA 5F6FA 2FMLA 4ESBA 1O2BA 3J81Z 1O24A 2IT0A 1KA8A 4WWCA 3MEXA 2E2HA 2G9WA 4LB5A 3L00A 3GEZA 2NNYA 2NVXA 2XKOA 1IXCA 4MEXF 4HQMA 3KCCA 1P6RA 1F1ZA 5ICEA 4KB4A 2FQ3A 2F5CA 2PMUA 3LWFA 4RB1A 3F6VA 3RYPA 1K7AA 1TWCA 5HS8A 4Y15A 5TRDA 5LHIA 2ZO4A 1BIBA 2R7DA 4OU0A 1BIAA 3OPFA 4CDGA 2HYFA 4C3JC 1FC3A 4P5AA 4KARA 3I71A 2PMHA 3D0SA 1O27A 1V3FA 1YO5C 2DU9A 5A2QK 4P5OA 1G4DA 1ZG1A 4P55A 3P9KA 4FZBA 3TO6A 2QUFA 3FXUA 1U5TC 5J8CA 4MQ9F 4LG0A 4AIKA 2L3DA 5IOTA 1Z6TA 3OEPA 2CGPA 3IRQA 2JPBA 5ILVA 3QU6A 2W84A 3GTJA 2PQ8A 1R1UA 3AAFA 4KASA 2E7WA 1F5TA 2CFAA 1U3EM 4CGZA 1P4WA 2O61A 3KEOA 1T38A 3BROA 4IRHA 2EWNA 4HLYA 3KZYA 4XLPF 1XMAA 4RAZA 2KKOA 4L5IA 2A61A 1QQIA 5DDGA 3ERED 2NRAC 2O8XA 3L9FA 3ML6A 1O29A 5L3FA 3GWZA 4GCVA 2GWRA 2PBIA 2EJRA 1YLFA 2O6GE 3I5UA 1FYLA 1Y1VA 1R36A 2ESNA 3E5UA 4L9TA 1SD7A 3HRMA 1HW2A 1XXAA 1SFEA 4GT9A 2MBFA 1WI9A 4ETSA 1XGNA 1BI3A 4A12A 2JA5A 1ZAOA 3W6KB 1FLIA 5LGNA 2VBWA 2MH9A 5CVVA 2VBZA 4WXCA 2FBIA 4ZYDA 4HX4A 3CLOA 1MJAA 4I2OA 5E8IA 3OOPA 1U8RA 1HKQA 4O6JA 1H0MA 4M73A 4PCQA 1FZPB 4ENMA 4IXAA 2JRTA 3VB2A 3FMQA 2DPDA 4MTDA 1QZZA 1S7OA 5FGMA 5LEKA 1ZRDA 2ADUA 2K7LA 2J5OA 4BAYA 5F1RA 2OQGA 3JAMZ 1S6LA 4RGSA 1K6OA 1RI7A 2P7VB 3ZMSA 4N9HA 4RS8A 2PI0A 5BPIA 2W24A 4KUMA 3TO7A 4EJOA 2O3FA 2DLLA 3KE2A 4RGXA 4WX9A 2H09A 3M9AA 1LJ9A 1ZN2A 2XKPA 4LD5A 1NHAA 2HFHA 4OIPF 3FOEA 2QENA 1HW1A 2AXLA 4BQAA 5JVTA 2JA6A 3QU3A 3N4MA 4HDUA 1RNLA 4UVCA 2IRFG 3BUEA 1OYWA 1EH7A 1FX7A 4GTEA 3W6JB 2VBYA 2XVCA 3GLXA 3GF2A 3RPUA 4G6DA 2W57A 1EV7A 4G7OF 3NQOA 2JA7A 2LF7A 4GYGA 2F2EA 5E8GA 1KGSA 2VXZA 5CYVA 1ZGAA 3I4PA 1HKSA 4HX7A 5DUIA 3LQRA 1TLHB 2BBYA 2EFOA 4L9NA 3LA2A 2A5YB 2FOKA 3JSOA 2RH6A 1OR7A 2TDXA 5CVIA 2EFWA 2Z99A 4LR2A 1XDSA 1ON1A 2MH2A 1R1VA 2MLGA 2P7CB 5HOOA 2EA2A 4BXUA 1LQ1A 3MCZA 2KJCA 4HF0A 1XSVA 2NNNA 4AIJA 2XRNA 1DPRA 4Z2YA 1O25A 5K5OA 4HF2A 1XGOA 4G0UA 3WGIA 4R79A 2PHCB 3BJ6A 4BH9A 2DI3A 3HTUA 5ILUA 2L02A 2YPRA 5BQTA 3WGHA 1YW7A 4LLGF 1XXCA 3DPTA 4DNCA 4F7ZA 5FD6A 2DO7A 4WF2A 1B4AA 1PDNC 4BLBA 4KIGA 1G3YA 1K83A 3TO9A 3AQOA 1O2AA 1KQ4A 3ULQB 2DK8A 1R00A 4P9FA 4UVBA 1SD5A 2OZ6A 1LEAA 4WXDA 2PN6A 1BGWA 2JPCA 1E2XA 2EK5A 1QO0D 3VODA 2R7ZA 4ZYEA 4DDQA 5F64A 2VODA 2HTJA 3F3XA 2V1DA 1AOYA 1H9GA 1MDMB 4ILDA 4UUVA 1G3SA 3V7CA 1WSUA 3RKXA 4HLXA 2IA1A 4I0BA 4ESJA 4HYEA 1F4KA 1ZLKA 1S3JA 1XSXA 1FSEA 1FY7A 2VC1A 3BPXA 4I98B 4G7ZF 4KT5C 4KMDA 4CICA 3GZ5A 1YIOA 2AS5F 1ZG5A 1XGSA 3SFZA 2STTA 1KYWA 2EFNA 4ZYGA 4KNYA 2XIGA 3G3ZA 3T5XA 4KC6A 3PQKA 3VFZA 2HEOA 5HDKA 5JFEA 1JHFA 3V8JA 4IPAA 5EGEA 2F5FA 3WG9A 2P5MA 4A5MA 2EFPA 3ZN0A 2P8TA 3RDIA 4QLCU 1TNTA 1T6SA 1MGTA 2UZKA 2M8EA 3Q9SA 1BI2A 2LNBA 1OPCA 3E6BA 2QQBA 2IJLA 2ZFZA 3P9CA 1IN5A 2VE8A 3KP2A 3T0YA 4N0BA 2VOPA 2FU4A 5IOQA 4JQFA 2ISYA 3KLOA 5D5XB 3E3VA 2FA5A 1OYYA 1YQAA 1L0OC 2FSWA 2QWWA 3EETA 5E20A 1BJTA 2RC4A 1BI0A 3M7GA 2RN7A 1BC7C 4EJTA 4PGHA 1WQFA 4WCGA 2L01A 4FHTA 5D6FA 3HTSB 2A68F 3N0CA 3ROUA 2VT3A 3N97A 1IAWA 4XBFA 2Z3YA 4EM2A 1S7AA 4KMUX 1QBJA 3WTVC 2MA3A 1WQGA 1SMTA 4M6XA 3G4AA 4G6QA 4MNUA 2G7HA 4NHJA 1GHCA 4AIHA 2DT5A 2RGRA 2HKXA 1U2WA 4M72A 1EH1A 4Y13A 2MC3A 2K4BA 4PDKA 4U7DA 4KYWA 3JSPA 3P9IA 4Q47A 2UWMA 2RDPA 3I0TA 2G7UA 2ETHA 1TWFA 2UXNA 4H0EA 3QX3A 1ZXOA 1G3WA 1WCMA 3HHGA 2ACJA 1D3YA 3Q5FA 4KN4X 5AONA 3O3KA 2EV0A 2IVMA 2VT2A 3IC7A 1XMKA 2ZXJA 3L09A 1K79A 1D8JA 3CUOA 5HDNA 2QM3A 2ELHA 1TQPA 3AH5A 1XD7A 4G0VA 2H94A 3WU1B 1I5ZA 3JTHA 4OIRF 3FHZA 1JXSA 2COMA 5IT3A 1FYMA 3R6SA 2IA2A 1XB4A 2Z33A 2M1BA 5L3BA 2GSNA 2YX4A 3VOEA 3HRUA 1Z91A 5JI6A 5ILSA 1IN4A 4U0VA 1UHMA 1P2FA 2OU2A 1SAXA 4WK8F 2JSCA 2CSOA 4P9UA 3HOSA 1J5YA 3RKYA 1TW3A 2R3SA 3L7WA 3QAHA 4RAYA 5D5UB 3CAGA 1I50A 5J8FA 3C7JA 2A6HF 1IN8A 3KP3A 5AIQA 3MZHA 1E17A 3HHHA 2GXBA 1BM9A 1BBYA 1FYKA 3FF5A 1MKMA 5K5QA 4HF1A 1LB2A 1IRGA 2X0LA 3ZQ7A 4G9YA 1R58A 4A0YA 4ENKA 1SFUA 2Z9OA 3I59A 2HGCA 4A2UA 3SZPA 2BYVE 3TQNA 4EJUA 3R61A 4KIBA 1MJ9A 5D4RA 1HXDA 2EA4A 3KZZA 4JBAA 3IWZA 3KP5A 4UV9A 3MQ0A 3PFIA 1X3UA 4ENJA 1C0WA 2CFXA 2GQQA 1R22A 3GVAA 5H6RA 4LLLA 1XN7A 1W5TA 2L54A 3FM5A 5D8KB 2YSRA 4Q5SF 4OMZA 5ICGA 3QRFF 3J80K 2J5PA 4CHUA 2BE5F 3IKTA 3ZPLA 3RPQA 2FRHA 4LFUA 2YU9A 2LDUA 3E6DA 5IT9K 5E18F 1J75A 3E5XA 3BJOA 5JHUA 3DP7A 3QOPA 3GTOA 5HLHA 4JK1X 5DD8A 1HW5A 1XXBA 1ZBSA 1G6NA 1XCVA 5D8LB 1Q1HA 3F6OA 1MZBA 4KDDA 1OKRA 4M9SA 3QP5A 4YFXF 4UVAA 3FM3A 2GXGA 3U1DA 3R60A 3G4CA 2DAOA 3E5QA 5A2QZ 2CYYA 2OQRA 3SHFA 5L3DA 2ZNYA 3GTLA 1XDUA 1FNNA 1G3TA 1W7PD 3WTWC 3TKYA 3HRSA 5LLQA 2A69F 4OOIA 1Y0UA 2K02A 3H3ZA 2P5LC 1B1BA 3LA3A 1ZRCA 3EYIA 4U7BA 4HZFA 3F8FA 1FP2A 2FXAA 3M1EA 5H20A 3I59B 4MGRA 2V9VA 1IRFA 1QNTA 4HBLA 5EGHA 1O3SA 1CF7B 4J3NA 3WGGA 1PP7U 3G73A 1O3QA 1XGMA 2KIMA 4L0ZB 1W5SA 4G8XA 2FNAA 4HV6A 3L4KA 3WTUC 1MDMA 4HDVA 1EK8A 1IW7F 4Y17A 2HZTA 3GFJA 3I64A 2P5VA 4AD9A 1T0FA 2NVYA 2YX7A 2CG4A 3FWEA 4C3IC 2OAZA 5IOSA 2W85A 3F8NA 1ODDA 1GXQA 1LDJA 3REOA 1Z1DA 2PJPA 1B4BA 5LHHA 2HQRA 3RJPA 1Z6RA 2DBBA 3ZN1A 2QQAA 5FLXK 3V7RA 5JFRA 2FE3A 2LF8A 4MHGA 1REPC 4O5VA 4M1XA 1LDDA 1OYIA 1BN5A 4LLNA 3GZ6A 5DYMA 1FBUA 3D5LA 2XHKA 1XCBA 3ABUA 4QWQA 1IN6A 2R92A 4MEYF 4RB0A 3WTYC 4LB6B 4EV0A 1USTA 5DCMB 5CVRA 1BOAA 3O2PE 2OD5A 4L9JA 1DDNA 1YFHA 1ISEA 3N0BA 1BI1A 1LDKB 2Y75A 2XCOA 4A6EA 2EFQA 2FBHA 1BJAA 1S29A 3DKWA 3F8BA 1UHWA 2FEZA 3Q9VA 1RIOH 3EYYA 2KIUA 4ZH4F 3GTPA 3TDZC 2NYXA 2DFIA 2DPUA 3ECOA 3VEPA 5L3CA 1B59A 3E97A 4B09A 1P4AA 2WV0A 2O03A 2KWAA 2XAHA 4B8XA 4YG2F 3P7NA 4EMSA 2XCQA 2HWVA 1O3TA 3I53A 5DEQA 1R5HA 2PFBA 5FFZA 4AWXB 4HV5A 1STZA 1KU9A 3J81K 4L0YB 3RIRA 4KMAA 3F8CA 5CHPA 3CJNA 4M71A 4EVIA 4FX4A 1SFXA 2ZKZA 1CGPA 2BV6A 1R1TA 4OINF 1TW2A 2H6BA 2VE9A 1YTYA 2R7FA 4RGRA 5TJ3A 2R93A 5D4SA 5HS7A 5LGTA 3SZTA 4AVPA 3T8RA 3GTKA 3HSFA 3ZMTA 1IXRC 4ESFA 1B9NA 5CVJA 4UNOA 4RGUA 2E1CA 4R1HA 3BP8A 3OV8A 3V7SA 5ED4A 1O3RA 5K5RA 3HOTA 4MTEA 2V79A 2F5DA 3CQZA 3CUQA 3HSEA 2ISZA 1J59A 1YW8A 4HOBA 2QVOA 4KAWX 3ECHA 2H6CA 5AIPA 1KYZA 4EJWA 1DUXC 2B63A 4LQYA 3S0XA 3LAJA 1Z05A 2FBKA 3ISPA 5HDGA 2CQKA 4IVNA 3WTTC 3TOBA 1LNWA 3F8MA 4R8HA 1UFMA 2OZUA 2PEXA 4OMYA 4D0PA 5FLXZ 3WTZA 1D8KA 2RQPA 1MD0A 4MQVA 3SXYA 4E70A 1DPUA 4KB2A 4N9IA 1R7JA 1YS6A 4EJVA 2RGVA 3H0GA 2O0YA 5HLGA 3LPXA 5DD4A 3F23A 3B73A 1V4RA 1MJBA 3ABTA 3KFWX 3ZMVA 4S04A 2M5WA 3HUGA 2QLZA 2MLKA 2XGXA 3ZP5A 2QBYA 3BPVA 1ZH5A 4I09A 2ZFWA 3GUDA 4HA8A 4LGWA 1QGPA 3MWMA 2HDCA 1JE8A 1VTNC 4M74A 1WRJA 2E7XA 3E6MA 1ZHFA 2FF4A 3R4KA 1J0RA 3WTXC 3OREA 2YU3A 2D45A 2XAJA 3DPLC 4EGYA 5LRRA 1JHHA 4M6YA 2HYGD 3WODF 1ZVUA 3MMLB 1QPMA 3K1PA 4BHCA 5BS6A 4BNCA 1DP7P 3ZMDA 1IS1A 3LFKA 5J6XA 4NB5A 3K9TA 3MAJA 5JR3A 3GTMA 2A07F 3VA7A 3GX4X 2GZWA 2K86A 3CUQB 1WQHA 2XAQA 4YIFA 1L3LA 1YW9A 1RUNA 3HIFA 3QPTA 4GTBA 1FT9A 3K0LA 4NQWA 2FMYA 2VN2A 4KMFA 4FM9A 3BDDA 1PP8F 2E1NA 2FNPA 2KRFA 2M30A 2XV4S 1RUOA 1O26A 1R23A 1TTYA 5DCFA 4ZYHA 1SFOA 4A6DA 4HX8A 2DTRA 3FOFA 4OIOF 2WC2A 1TBXA 2V1UA 3V4GA 3IWFA 1O7LA 5LGUA 3TGNA 2IP2A 2OBPA 2HKOA 1W7PB 2HS5A 2K27A 1I1GA 4GTFA 1TWGA 2M87A 1BC8C 5E17F 4BHBA 3AQPA 3NEUA 1ZYRF 4L18B 1FSHA 1R5GA 3I54A 4EM0B 4UV8A 3ZMZA 1QZYA 4LMYA 3JAMK 2HR3A 4EM1A 4C3HC 4S05A 1O7FA 5FD5A 2KIFA 3Q3QA 1W4MA 2EV6A 1Z7UA 4G0WA 3MZYA 1T2KA 2QBYB 1XSDA 1T39A 4CZZA 3K1MA 4KA4A 2M45A 3V8LA 1U5TB 1PUEE 4PZJA 5CJ9A 4ON0A 4YFKF 2GAUA 1GE9A 3L2CA 4CO8A 1TNSA 2K4JA 4KFCA 1UCRA 3ZMUA 4WXHA 1ULYA 2DW4A 5HS9A 2ZMEA 3JW4A