1B4AA

Structure of the arginine repressor from bacillus stearothermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
GQRHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYKYSLPSDQRFNPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE REPRESSOR
publication title Structure of the arginine repressor from Bacillus stearothermophilus.
pubmed doi rcsb
molecule tags Repressor
total genus 38
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1b4aA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1b4aA02
3GXOA 4EV0A 3BPVA 1YW7A 3CUQB 2CG4A 4RB1A 2COMA 2OA4A 3IHUA 1T38A 2K02A 4OMYA 1P4AA 3TO7A 3P9KA 3B02A 3O6BB 4B8XA 2W24A 4WCGA 3ZMVA 2HQNA 4AVPA 1IXRC 1QNTA 1XDUA 3HHHA 3LSTA 2L4AA 3IKVA 1S8NA 2CGPA 4G0WA 2X4HA 5FD5A 1J75A 3T1BA 2XAGA 3NUHA 3KP4A 5D4SA 4R1HA 4KUMA 3TDZC 3WTWC 4LLLA 4EM2A 5E18F 2XIGA 3H3UA 2WC2A 1W4MA 2V79A 5FO5A 1I6XA 1F5TA 3RPUA 3GLXA 2Y75A 1XGNA 5BPIA 3CLOA 3MZYA 2H6BA 4OINF 2HR3A 3GWZA 4L9NA 1S29A 3ZPLA 3WTVC 2EFWA 4ZYDA 5IT9Z 4M72A 2NS0A 2M8EA 3J81Z 1BIBA 3AAFA 2UXNA 2DI3A 2EWNA 2VBWA 4L0YB 5CVUA 3MQ0A 3WU0A 3WE2A 4UUVA 1WQ2A 3CDHA 2GZWA 5JI6A 1MJ9A 3WTTC 4NHJA 3WODF 4BAYA 2QVOA 2M87A 1D3YA 2W85A 3ZMDA 2VBYA 3GW2A 3BROA 1R5GA 5LRRA 1FX7A 3P9IA 2VE8A 1JXSA 2RGVA 4G7ZF 2HKOA 1U3EM 1H9TA 4U7DA 3I58A 3DV8A 3ZP5A 1IN5A 2MH2A 4KICA 4MNUA 1F9NA 1USTA 2LF8A 5EEHA 1FNNA 3ZMZA 3F23A 1WQHA 3I54A 3L7WA 4RGXA 2J5OA 3C18A 4HQEA 2P5VA 4U88A 3KFWX 5E20A 3W6KB 4OU0A 3GEZA 4L5JA 4FX4A 2XRNA 2IA1A 1SD7A 2FE3A 3J80Z 1T98A 2GWRA 4FX0A 4A5MA 2K86A 2ZO4A 2C6YA 2TDXA 2DFIA 2QQBA 5DD8A 5A2QZ 5CYVA 2P6TA 5ED4A 1ZGAA 2HZTA 3IL2A 1IN7A 2P8TA 3ISPA 4I0BA 2FNPA 4UVBA 4ENMA 3WGIA 3BJ6A 2FRHA 4XBFA 5DV5A 4HOBA 2EFNA 3I64A 2HS5A 4EGYA 3BPXA 4WX9A 3D0SA 4EGZA 2VXZA 3I4PA 4KDPA 4I7HA 2QLZA 1U5TC 4YFXF 3JTGA 4UNOA 1WKMA 4A6DA 2HGCA 2XROA 1BJAA 1T39A 1XMAA 2VODA 1LDDA 1JE8A 3ABUA 5LHIA 3RYPA 4ESFA 5FB2A 2QM3A 5LGTA 1KA8A 2QZ8A 2M45A 4MTDA 2VC1A 2LNBA 1DPRA 2FMYA 3ECHA 5E1WA 1IRGA 2JRTA 2X0LA 1YTYA 2BYVE 4KN7X 4I0AA 4IPAA 1WI9A 2ADUA 1D8KA 2BGCA 3F8BA 3RKXA 2L01A 3OV8A 1FYLA 1YG2A 4N0BA 2EA2A 3F22A 4ZZDA 5FGMA 4I01A 4EM0B 3HRUA 4Y15A 5CVIA 2RN7A 3L9FA 1O3TA 2JSCA 4CDGA 4EJVA 2FXAA 3TO6A 1O3RA 3GUDA 3IKTA 3HSFA 5HLHA 2UZKA 4IF4A 5FLXZ 3QU6A 1OPCA 4PDKA 1HW5A 3EDPA 5HS8A 3TKYA 1QZYA 3FM3A 1QBJA 4ETSA 2YR2A 4EJUA 4ESBA 3NQOA 3IWZA 5D5XB 1B1BA 2O61A 4HX8A 4NQWA 5HS9A 2Z9OA 3Q9VA 4L9VA 3K1MA 5BQTA 2BBYA 1W7PD 4KNYA 1S3JA 2H27A 2R3SA 5H20A 1QO0D 5JR3A 2PMHA 3EETA 3LFKA 3KETA 5H6QA 4OIQF 5TRDA 3CUQC 2STTA 1LQ1A 1FBUA 2OZ6A 4EJWA 4G0UA 2DLLA 2VBZA 3KP6A 2J5PA 2DQLA 2NAZA 1TW2A 3IC7A 2DTRA 3E6DA 3RPQA 3LA3A 2BE5F 1BI0A 2DT5A 4Y13A 3K1PA 4HA8A 3LQQA 3LA2A 1SAXA 1I5ZA 3ERED 4IXAA 4KFCA 5JVOA 1PP8F 2MC3A 3FMRA 3FOFA 4ENKA 3P7NA 3K69A 1XD7A 1GXQA 1RI7A 3SZPA 4XSZF 3G73A 1FYKA 1B6AA 3HUGA 3CTAA 4HYEA 4HAMA 1AWCA 4G6DA 1WQFA 1EV7A 3BOQA 1BI1A 3HSRA 2PFBA 2QWWA 3WTXC 2PJPA 1KU9A 5L3DA 2JPCA 3KP5A 1UCRA 2A3SA 2K4JA 4GYIA 1HKSA 3QP6A 5E8GA 2FBHA 4KIFA 5DEQA 4A0XA 4KDDA 4BXUA 3L4KA 2IRFG 1Z9CA 4WXCA 2KIFA 1ZG1A 4KMUX 5DCFA 3GO5A 2LSOA 4M6XA 3BJOA 3M8FA 1HSJA 1FSHA 1LNWA 5JVTA 2XAHA 1L0OC 2MA3A 2XAFA 3C1DA 4OMZA 3V7SA 3DEUA 4AIHA 2FMLA 1AOYA 4GGGA 4S05A 1Q1HA 3EUHA 5F6FA 1ODDA 1OKRA 1T6SA 3ZMTA 2M1BA 2XUBA 3VEPA 2ZNZA 4G6QA 4P5OA 1QGPA 5HDKA 2XVCA 3RIRA 2ISYA 3RKWA 1TNSA 4AIJA 1B4BA 1DPUA 1W7PA 3M7GA 2PMUA 5E17F 1O3QA 2KJCA 4KC6A 1IXSB 3F3XA 1B4AA 1ZYRF 5HS7A 2L3DA 2NRAC 1ZVUA 5EEGA 1EH6A 5HDNA 3RJPA 2DBBA 4CZZA 4LB6B 1BM9A 1I1SA 1XGSA 2CO5A 2EJRA 1R00A 1MD0A 3LAJA 2ESHA 2DW4A 4BHCA 3QPTA 2VONA 4KA4A 1MJBA 3ABTA 3I5UA 1EH7A 2NNYA 2DPUA 5D6FA 4OOIA 5DCMA 1HKQA 3FMSA 3F8CA 3QOPA 4ASNA 3OEPA 2YSRA 2GIVA 2VBXA 3CAGA 4R79A 3E3VA 3WTYC 3E5XA 4LK1F 1H9GA 1XGOA 1K7AA 1EH1A 3CUOA 4EMSA 4KB4A 1YW9A 2ZXJA 2D2WA 3QRFF 1SFXA 1IW7F 4O6JA 3KP2A 4RB2C 5D5WB 4GFQA 4IRHA 5K5QA 2GA1A 1LEAA 4MHGA 4RGUA 3V7CA 2QYOA 1BC7C 3KZYA 1OR7A 5ILVA 1P4WA 4G7OF 2WV0A 4YIFA 3FXUA 1RUNA 3BUEA 3PQKA 2Z99A 2P5MA 5LBQA 5CVRA 2GXBA 2R7FA 4NB5A 3Q5FA 3M9AA 2PBIA 1IAWA 1BIAA 3DPLC 2W84A 1P2FA 1XSVA 4YG2F 2G7HA 4HDVA 4LMYA 5K5OA 3GX4X 2RVCA 3IRRA 5LHHA 1DDNA 2IVMA 2V9VA 1IZ1A 3O3KA 3L4JA 3GFIA 1ON1A 4KAWX 4YFKF 1K78A 2E7XA 4EM1A 2R7DA 2RDPA 1I27A 1CF7A 1PUEE 3REOA 1PDNC 2BV6A 1RNLA 3I0TA 3TQNA 5DD4A 3JAMK 5IT3A 4GCVA 3ZQ7A 3SHFA 1MGTA 2QUFA 3KEQA 2ZMEA 2IA2A 2Q2EA 2CW0F 4PZJA 4RAYA 4LLNA 3MFKA 1S7OA 4CXFA 2IJLA 3TOBA 5JFRA 1T2KA 2GXGA 1J9IA 5L3CA 3BDDA 4RGRA 4A6EA 4A12A 5BMZA 1IF1A 2D1VA 3E6MA 1FP2A 3MZHA 5FD6A 3DP7A 2F5EA 1VTNC 2E1NA 1HXDA 4OIRF 1ULYA 5D5VB 5TJJA 1U78A 1T0FA 4IHSA 2D1HA 2DAOA 3W6JB 1KU7A 3FOEA 3ZN1A 2FF4A 1CF7B 4HX4A 4MQ9F 5CVVA 2M30A 2V1UA 1DUXC 4U0WA 4P55A 4KT5C 2BEOA 2OU2A 1OYWA 1WIHA 4L18B 3HRMA 5ERIA 4KN4X 4A0ZA 3V8KA 1IN8A 3CO6C 3K1NA 4RB0A 1MDMA 3I71A 2DPDA 4AIKA 5KK1A 2HDCA 2EA4A 3WTSC 1LB2A 4UVAA 4HF1A 1XSXA 2ISZA 3T5XA 3ROUA 3Q9SA 4JQFA 2UXXA 2EV6A 1YS7A 2XKPA 3S2WA 2GQQA 3CO7C 1QPMA 1SFEA 4H0EA 3HOTA 2HYFA 2O8XA 4GXOA 2H6CA 1KU2A 3VFZA 1BBYA 3WTUC 4L5IA 4U7BA 2ETHA 3K2ZA 1J5YA 1QZZA 1FSEA 3K9TA 5D6EA 2FU4A 4KMFA 4OIPF 1YS6A 4ZH4F 2FSWA 1HSTA 1XXCA 1J59A 2EV0A 2IPQX 4LGWA 1G3SA 2QQAA 2GA2A 3JAMZ 1TNTA 2E7WA 3HSEA 2P5KA 4J3NA 3ECOA 4IRGA 4XSXF 4KIGA 3OOPA 1DP7P 2YU3A 4WWCA 4ESJA 4KIBA 4UV8A 1ZN2A 2ZJ2A 1YO5C 2G9WA 4ZYHA 5HDGA 1CGPA 3J7AO 1U5TA 1Z1DA 4HW0A 2QBYA 2FQ3A 4FHTA 4HLYA 5BPDA 3ELKA 1F4KA 4E70A 1HW2A 5ICFA 4XLNF 1TQIA 1KGSA 1G3TA 5F1RA 3LAPA 4A0YA 3HRSA 4LG0A 3K0LA 1G3YA 5CVJA 1K6OA 3TDUC 3FXRA 4I2OA 2HTJA 3HTSB 3R6SA 2FBKA 1O3SA 4Q47A 1GE9A 1D8JA 1NHAA 4OIOF 2JZYA 1I1GA 2MLGA 1P4XA 1G4DA 2VE9A 4K2EA 3WGGA 2PLYA 1G6NA 1ISEA 2D45A 5LGNA 2EFQA 4MQVA 2EB7A 3SQNA 2NNNA 2QQ9A 3EQLF 1YYVA 3DQVC 3HIFA 3H92A 3KCCA 1HQCA 1FY7A 1XN7A 4RAZA 4UXNA 2F5CA 2O3FA 2O6GE 1DD5A 4LD5A 5J8CA 1OYIA 4L9JA 1U5TB 2DQRA 3GFMA 3KLOA 2VOOA 1R58A 1U8RA 1OYYA 6PAXA 1Z05A 1Z6RA 3EYIA 5HLGA 1XDSA 2WTEA 4LG0B 5ICCA 5ICGA 1FPQA 1ZGJA 2VN2A 4DDQA 1LVAA 1OMIA 1B9MA 4IJAA 4RS8A 3IWFA 4DNCA 2OBPA 1ZLJA 3P9CA 3JSOA 4D0PA 2XHKA 3HOSA 3HHGA 2V1XA 5K5RA 4U0VA 2NYXA 3GZ6A 1KQ9A 4FT8A 1GVJA 1MZBA 2KIMA 1ZH5A 1IN6A 2FNAA 2XV4S 2XGXA 3LA7A 4UHTA 4UV9A 4RB3C 5LLQA 2MH9A 5IT9K 5BS6A 4B09A 3FHZA 2HKXA 3CUQA 5AIPA 3F21A 3ZN0A 5L3FA 5D8KB 3MEXA 1KYZA 2WWYA 4Q5SF 3GF2A 3KEOA 2Z5UA 2PHCB 2A61A 4UVCA 2ESNA 3BWGA 1R5HA 2CSOA 3SZTA 2H09A 2DO7A 3U1DA 2FEZA 1UB9A 5D8LB 5LGUA 3DF8A 2A07F 3WGHA 5J8FA 4G94A 1USSA 2W25A 2IT0A 1HBXG 5LRSA 2OQGA 5ILSA 1R7JA 1EK8A 2DU9A 3E6CC 3F8MA 4L0ZB 4CICA 5ILUA 1RIOH 3C7JA 3QP5A 5KVRA 2AS5F 5H6RA 1R1UA 3BJAA 4WF2A 4AWXB 2RNJA 3BZ6A 2W57A 2OD5A 1U6GA 3MAJA 1WSUA 2HTSA 3ZMUA 1V4RA 1HW1A 1ZARA 1JHFA 3FMQA 3QPHA 2K27A 3DPTA 3O2PE 1FBSA 4M71A 3V7RA 1FOKA 3OPFA 1X3UA 5ICEA 3MCZA 3PQJA 2L4MA 2XAQA 4HBLA 1BI2A 2FA5A 3GZ5A 3J80K 2RKHA 4ON0A 4HF0A 1XMKA 2KIUA 2F5DA 4YIIA 4HDUA 5A2QK 3L2CA 1GXPA 1ZG5A 3NEUA 3F72A 4N9IA 1ZRFA 3FM5A 1W7PB 4LJZF 2KKOA 5DYMA 3G3ZA 2P4WA 2XCQA 3WE3A 3KP3A 2YX7A 1STZA 1W5TA 4HV6A 5DDGA 2H94A 4DQ2A 2QENA 4QWQA 2STWA 2Q0OA 2K7LA 3NRVA 2PEXA 2E1CA 1EH8A 1YFHA 3MWMA 1LDJA 2IA0A 3I53A 1J7KA 5BOXA 1ONVA 3WU1B 2RC4A 4MEXF 5CLSA 3T0YA 2FOKA 3OREA 3HRTA 4A5NA 5AONA 1IN4A 2F2EA 1E2XA 1O57A 3GVAA 5F64A 2LKPA 2OQRA 4LLGF 5DCMB 4F7ZA 5LEJA 4Z2YA 4FM9A 2XKOA 1ZAOA 2F5FA 3R0AA 1ON2A 3QU3A 4ZZLA 1SMTA 4EQQA 1WQGA 1R1VA 1P6RA 4M9XA 3DFGA 3N4MA 3E6BA 1XXAA 4WXHA 2A69F 2KRFA 3KZZA 4HX7A 1YIOA 5FFZA 5LEKA 4XRFA 2Z33A 2XCOA 1SD4A 3SFZA 2O03A 2AXLA 4ENNA 5FLXK 4L9TA 2O0YA 3ZMSA 1KYWA 3D5LA 4G7HF 4CO8A 2HYGD 1J0RA 4Q4ZF 3TGNA 3RDIA 1ZREA 5DUKA 1FWZA 4P9FA 1LEBA 4R8HA 2OAZA 1HKTA 2Y0MA 3U9GA 3E97A 1KU3A 1RZ4A 1XSDA 2IP2A 1R36A 3FF5A 1TQPA 4PGGA 4CHUA 1C0WA 2XASA 2VT2A 4BQAA 3R60A 4ZYGA 1BGWA 1K78B 4O5VA 1BI3A 1F1ZA 3GFLA 3FXQA 3F6OA 1L3LA 3MMLB 2P7CB 2EFOA 2V6CA 3I59A 3RI4A 2ACJA 3SXYA 2YPRA 3L00A 2VT3A 4EJOA 2A6EF 1SD5A 3VA7A 4XLPF 2P7VB 2ZMEB 4M6YA 2LF7A 1V3FA 4M9SA 2JT1A 1FP1D 2ZFWA 3F6VA 5FFXA 1PP7U 2A5YB 2OZUA 4P96A 1XXBA 3M1EA 3HTUA 4QLCU 3LPXA 4EVIA 3H3ZA 1FT9A 1RUOA 1ZRDA 3V8LA 3GYHX 5J6XA 3RKYA 5JHUA 1BN5A 1BC8C 4BH9A 1K79A 3DXJF 1S7AA 3WG9A 2JPBA 2UWMA 4KB2A 1LDKB 3IRQA 1AB4A 3B73A 1S6LA 2HFHA 3JTHA 4Q48A 2P5LC 1ZHFA 4O3MA 4EJTA 3FWEA 3V8JA 2JTVA 4A2UA 2XCRB 1LJ9A 4MEYF 2L54A 1REPC 2MD5A 4HF2A 4ZYEA 3I59B 1G3WA 3T8RA 1UHWA 1W5SA 1ZRCA 5D4RA 1XCBA 2YX4A 2RV8A 1IXCA 2PI0A 3GFJA 1KQ0A 3VB2A 1TTYA 4U0YA 4HZFA 4JBAA 1J2XA 1MJAA 5D5UB 1IUYA 1MKMA 3RTRA 1B9NA 1FYMA 5DUIA 1MDMB 4KYWA 2A68F 3KLNA 5AIQA 1P92A 5L3GA 1FBQA 4PGHA 2ZNYA 4BHPA 3F8FA 1YQAA 5L3EA 2G7UA 2CYYA 4TV7A 4IVNA 4PCQA 2HWVA 4LK0F 1FZPB 2KWAA 1TW3A 2CWEA 1BOAA 4P9UA 1GHCA 4HLXA 3LQRA 3R4KA 1BJTA 4HV5A 4WK8F 2B0LA 3KP7A 2P6SA 1Z7UA 1TQMA 4Y17A 2MLKA 2Z3YA 4AD9A 1XGMA 3C3WA 2CQKA 3KE2A 3U2RA 3VODA 2DK8A 3R61A 1TBXA 1H0MA 2CFXA 2HQRA 2LDUA 4HQMA 4WXDA 4BHBA 3BP8A 3ML6A 1XB4A 5E1XA 4LFUA 3COAC 1WRJA 4BNCA 1SFUA 1Z6TA 1A04A 2DK5A 4M73A 4CGZA 5K1YA 3V4GA 1Y0UA 1WWXA 3M8EA 3JSPA 2VC0A 4BYYA 2V1DA 3HYIA 2QBYB 2KJBA 1UHMA 2ZCWA 4MGRA 3F8NA 2Y3PA 5HVQC 3QX3A 4G0VA 3CJNA 4N9HA 2M5WA 1ZLKA 4ENJA 4G8XA 3VOEA 3FX3A 4M9ZA 2EV5A 2PN6A 1D5VA 1KQ8A 3R0JA 1SMYF 2ZFZA 3BY6A 3TOAA 1QQIA 1FLIA 3PFIA 2L02A 3LWFA 2XAJA 4YFNF 2ZBKA 2GAUA 1O7FA 5CJ9A 5HOOA 2MBFA 3WTZA 2RGRA 3RYRA 2RQPA 2ZKZA 4IRIA 2HOEA 1ZG3A 1B59A 2K4BA 3L09A 4G9YA 5HLIA 1YLFA 3J81K 3TO9A 2FBIA 1YW8A 3DKWA 2EK5A 4S04A 1R23A 3EYYA 4LB5A 2HEOA 3JW4A 2IW5A 1R22A 4GYGA 4I02A 1IRFA 3T8TA 3FZVA 4I09A 3N97A 1SD6A 1R1TA 5L3BA 1TLHB 4CYDA 4RGSA 4IHTA 1JGSA 3QAHA 5E1ZB 5E8IA 2A6HF 3E5QA 3ULQB 4GO1A 4MTEA 1UFMA 1FC3A 1Z91A 2EFPA 1IS1A 2PQ8A 5LHGA 1U2WA 2ELHA 1XCVA 2VOPA 2Q8KA 3E5UA 1E17A 1JHHA 2PG4A 1O7LA 4M74A 4I98B 2Y48A 4JK1X
chains in the Genus database with same CATH superfamily
3GXOA 2GXAA 4EV0A 3T00A 1D1BA 3BPVA 1YW7A 3AFHA 3CQZK 1NK3P 1Z67A 3CUQB 2CG4A 4RB1A 2COMA 2V6EA 2OA4A 1X1DA 2LKXA 3IHUA 2XPUA 4NBQA 5JHFA 1T38A 1YHQI 3S15C 3S1QC 3EPZA 2K02A 1XZQB 2KP6A 4OMYA 1T95A 4Q5SA 1P4AA 3TO7A 3P9KA 3FBNB 3B02A 3OIOA 4HEA2 5C44K 3O6BB 4B8XA 2EZHA 1FIAA 4C30A 2W24A 4WCGA 3ZMVA 2F48A 2HQNA 5FLMK 1YOVB 4AVPA 4KJZA 4EEFG 3QQAA 1IXRC 1QNTA 4B4CA 2R7WA 2NVQJ 1XDUA 2HYJA 3HHHA 2R7OA 3LSTA 2L4AA 1DQUA 3IKVA 1SVLA 3GTPC 3Q3SA 1S8NA 2CGPA 4G0WA 2X4HA 1Z3YA 3KEYA 2ZXHA 5FD5A 3DCFA 3G1LA 1J75A 3OL4A 3T1BA 2XAGA 3NUHA 3KP4A 1Z7LA 2HXOA 4JX4A 4KITB 2RNGA 4BL0B 4D7NA 2RH6A 3UR3C 2CV1A 4DGWB 4A3KK 2WAQA 5D4SA 4DBRA 4R1HA 2GAHC 5IYDK 4KUMA 3TDZC 2KFDA 4P5AA 4ITVA 3WTWC 1XPXA 2ZMEC 2Y9YA 3C2HA 4LLLA 4EM2A 5E18F 4UUSB 2XIGA 2CRGA 2JA6K 3H3UA 2WC2A 5DM7F 1O26A 2DMQA 3C2BA 1W4MA 2V79A 5FO5A 1I6XA 3LSIA 1F5TA 3RPUA 3GLXA 5K7FA 3DBHB 1TWHA 1MSEC 2Y75A 4A93K 1XGNA 4CCOA 3W2VA 3PO2K 1D1CA 5BPIA 3CLOA 3MZYA 2H6BA 4OINF 2ZSHB 4E7IA 4XLFA 2HR3A 2HPMA 2XF7A 3DEEA 3GWZA 4L9NA 1S29A 1VQ7I 5TJ3A 3GZNB 2ZUEA 3ZPLA 1M1EB 3WTVC 3S15J 3S1QJ 2EFWA 2BHZA 2MYSA 3BC8A 1U0JA 3QWLA 4ZYDA 2F4MB 3S3OA 4BY1C 5IT9Z 4M72A 1IQ0A 2NS0A 3H5RA 1PUFA 2M8EA 3J81Z 1BIBA 2VUMC 3S8PA 3AAFA 2UXNA 2DI3A 2EWNA 2VBWA 2ZJQF 3M8JA 1ZR2A 4L0YB 5CVUA 1WCMA 1NK2P 3MQ0A 3WU0A 3VWBA 2NS7A 3WE2A 1WQ2A 4UUVA 3CDHA 1T0FC 1N77A 2E2JC 5FLVA 2GZWA 3FXMA 1MBGA 5JI6A 1MJ9A 1WJ5A 3WTTC 1AA7A 4XONA 3WODF 4BAYA 4NHJA 2QVOA 2M87A 2AXTC 2XGCA 1IG7A 3ZGKA 1D3YA 2K9SA 1OCOH 2W85A 2Y31A 3GTPJ 1QU3A 3H0GK 3ZMDA 2VBYA 3PL8A 2AQFA 4IOCF 3GW2A 1R5ID 3BROA 1R5GA 1TWAA 5LRRA 5J1UA 3ZOBA 1FX7A 2BXYA 5D4DA 2LP0A 1PYVA 2E60A 1B72A 3G71I 4X0GA 1MIJA 3H35A 3K4KA 2BZTA 2KIQA 3P9IA 2VE8A 4BE2A 4HRIA 1JXSA 3L2WA 5EGEA 4XRSA 3AH5A 3H0DA 5C3EC 2RGVA 1K6YA 2XF6A 2DFFA 4Y52C 4G7ZF 1X4PA 2HKOA 4LJZA 1U3EM 1H9TA 2PPBA 4A3LC 2R93K 4QSHA 3GEIA 3MKYB 3NARA 4U7DA 3I58A 2NVXK 1JKOC 3DV8A 3ZP5A 1VQ5I 3PFYA 1IN5A 1U9OA 2MH2A 2Y30A 1VQPI 2L9NA 1Y39A 2CV0A 3BR3A 4KICA 2YU9C 1RRJA 4KM8A 1I50A 1INNA 4MNUA 1R49A 2WA0A 1F9NA 1V54H 4AVZA 1USTA 2LF8A 3ZRGA 5EEHA 1FNNA 1ZK8A 2ZJPF 1ORKA 3ZMZA 3F23A 9ANTA 2CFAB 1WQHA 3I54A 4BY1J 3L7WA 2VUMJ 1X2NA 1IL2A 1LFUP 2W48A 4RGXA 2P81A 1DU6A 2J5OA 4PK4A 1O4XA 3C18A 2XF5A 3QYBA 1H89C 4MEXA 4HQEA 2DA2A 3BQZA 4IEJA 3S0XA 2P5VA 4U88A 1MH3A 3KFWX 5E20A 4C45A 2E2JJ 3CC7I 3W6KB 4OU0A 3K4JA 3GEZA 1YJWI 4L5JA 3M4OK 4FX4A 2XRNA 1XS9A 2IA1A 4C2TA 3PSIA 2L9VA 1OCZH 3AL0C 1SD7A 2FE3A 4ZJZA 4B43A 4KMDA 3J80Z 2VQHA 2RREA 1SVMA 1T98A 2X6WA 3LSRA 4KMAA 2GWRA 4FX0A 4LLGA 3IH4A 4A5MA 2CV2A 2K86A 2E2IJ 2ZO4A 3TFHA 2Z1DA 4XNFA 2C6YA 5C3EJ 2TDXA 2DFIA 5GP9A 2QQBA 5DD8A 5A2QZ 3PJRA 4AM3A 5CYVA 4Y52J 3HEFA 3CC2I 5IOSA 1EA3A 2P6TA 2XRLA 4JK1X 5ED4A 1MMNA 4A3LJ 2EZKA 1ZGAA 4RAGA 1U8BA 4E4HA 2HZTA 3IL2A 1IN7A 4GTFA 2P8TA 3ISPA 4I0BA 4N4OB 2FNPA 2JN6A 2V4JC 4UVBA 4ENMA 3WGIA 3BJ6A 4A3CK 4IHWA 4IZZA 1PVEA 2FRHA 4XBFA 1UJ8A 5DV5A 2YU9J 4HOBA 3HOVK 4PUSA 4C2MC 1V5VA 2EFNA 2EIJH 3I64A 2A69A 1RETA 2GSNA 2HS5A 3SZYA 1R4NB 4EGYA 1HCRA 3BPXA 3T01A 3S1RC 2ME6A 3CLQA 3JRIA 4WX9A 3D0SA 4XK4A 4EGZA 2VXZA 3I4PA 4KDPA 1Y1VC 3Q0WA 3OMYA 4I7HA 2QLZA 2ID3A 1U5TC 4YFXF 2HPIA 2HU9A 3JTGA 1EQRA 4UNOA 1X3ZB 1WKMA 5B3SH 1LPQA 3SJMA 3ZQHA 4A6DA 2HGCA 2XROA 1BJAA 4G7HA 1T39A 2Y0SL 2M34A 2OJED 1XMAA 4YIRX 2VODA 2H8RA 2QKLB 4GFBA 4Q4ZA 4KT6A 1LDDA 1YCLA 3HOUK 4ZDOA 3K70D 1JE8A 1X1PA 2ICWG 3ABUA 1RESA 5LHIA 3RYPA 4ESFA 5FB2A 2XSJC 2QM3A 2KMUA 2QQ8A 3M1CA 1C0AA 5LGTA 4BBRC 1KA8A 1X1BA 2R7ZA 2X51A 3S32A 2QZ8A 2H1LA 3GTMA 2M45A 4MTDA 2VC1A 1I3AA 2LNBA 1DPRA 1DU0A 1OFCX 2L7MP 2OC6A 2FMYA 5EF6A 2VKHA 4A3EK 3GTKA 3JRFA 4CCJA 4XM3A 1BR2A 3ECHA 2M4KA 3QOEA 5HLTA 5E1WA 1IRGA 2JRTA 2X0LA 1HC8A 3TFIA 1WPKA 2JVGA 2X9DA 1YTYA 2HXIA 1ZTRA 2BYVE 4KN7X 3GTQA 3V42A 4I0AA 4PFOA 1WGXA 1Z3XA 4IPAA 5IOZA 4D1QA 1WI9A 2BHYA 5KAFC 2ADUA 3DKYA 4RLFA 1D8KA 1USOA 1T08B 2BGCA 3F8BA 3RKXA 3IH3A 2L01A 4XLEA 2IGNA 4C2MJ 3OV8A 1FYLA 1GVDA 4XR6A 1JTYA 4A3JC 3S2HK 1YG2A 1FMWA 4OWRB 1WJCA 2BY3A 2R7QA 3LSKA 3B6CA 3S1RJ 4X6AC 4IHYA 4N0BA 2EA2A 3HOYK 3F22A 2A6EA 4FZBA 3OSFA 4ZZDA 1Y1VJ 4XLPA 5FGMA 2F4OB 5E3NA 1LE8A 1LFBA 4I01A 1WHUA 3A0HC 3HRUA 4EM0B 4Y15A 5CVIA 2RN7A 3L9FA 1JUPA 2DFEA 1O3TA 2JSCA 2H8WA 3CP2A 4CDGA 3PUBA 5FKMA 4EJVA 2FXAA 3TO6A 3WHCA 2NVYC 5IYCK 3S14C 2GSUA 1O3RA 3GUDA 2R5ZB 3HSFA 5HLHA 3IKTA 2E5NA 3W6VA 2UZKA 3GCMA 4IF4A 5FLXZ 3QU6A 3GBGA 3OYMA 4XCHA 1OPCA 3N3YA 4PDKA 1HW5A 3EDPA 5HS8A 4AYBL 5B1AH 1A6IA 1IGNA 1ETWA 2XGDA 3TKYA 1BOBA 2V6TA 1XMXA 1J98A 1QZYA 3FM3A 1QBJA 2PMZL 4Z6YA 4BBRJ 3CCUI 2Y69H 3DXJA 2JA6A 3BG3A 4NC7A 1GDTA 3S1MC 4ETSA 3JRDA 2YR2A 4EJUA 3OY9A 4IX7A 4FCYA 4JP0A 2M9HA 5JVGF 4A3BK 4ESBA 2UUZA 3HBLA 3NQOA 2QGUA 3CZ6A 3IWZA 4NC6A 2NOGA 5D5XB 1B1BA 2O61A 3FK7A 4GTEA 3DWLE 2DMUA 3TW7A 3OIQA 1EJ9A 4HX8A 4NQWA 5HS9A 4XLHA 3Q9VA 2Z9OA 2VL8A 1VH2A 4L9VA 1SFOJ 3W2AA 3HPGA 1W0UA 3VPRA 3K1MA 3BR0A 5BQTA 1WJFA 4MEYA 2YS9A 1W7PD 2LK2A 4KNYA 3IH2A 1S3JA 1WCMK 5EDNA 2H27A 2MABA 1BW6A 2R3SA 2I8DA 5F0CA 1H88C 4A3JJ 1RPWA 5H20A 4P9SA 4A3IC 4BBSJ 4BY7C 4A3DC 1QO0D 1X4OA 5JR3A 2PMHA 3G4AA 3EETA 4XRSG 3LFKA 3AG2H 2KT0A 1Y6IA 1WJAA 2LC2A 3KETA 5H6QA 3I55I 4DIQA 4OIQF 5M5WK 5TRDA 3H3VD 3CUQC 2EIKH 3KYLA 3G1OA 2STTA 1LQ1A 5JFEA 2NVYJ 2D5VA 1FBUA 2OZ6A 1TWAK 1ERDA 1B8IA 1YX2A 4EJWA 4GZYA 3BG5A 3VYUB 4G0UA 3OYIA 2DLLA 2VBZA 2BXZA 3KP6A 2A68A 1O2FB 3HPHA 2LOOA 4E7LA 2J5PA 2DQLA 2E35A 2NAZA 2V9PA 3U21A 1TW2A 3B6AA 3CCMI 3IC7A 2LVSA 5EGHA 2DTRA 1JGGA 4IKFA 2DOEA 3E6DA 3RPQA 3S15K 3LA3A 3S1QK 1SFOA 2JA8C 1K83C 2B63C 3PIOF 3HM5A 2BE5F 1W36D 3GDZA 1TZLA 1BI0A 3S1MJ 1MH4A 4F3QA 2NVXA 2DT5A 4Y13A 4LK0A 2ELJA 4AIDA 3ABKH 3E0JB 4FISA 1I50K 3BR6A 3K1PA 1F7VA 4HA8A 1N25A 2IBDA 3LQQA 2TCTA 4QTRA 2R92J 5B1BH 1OCCH 3LA2A 1SAXA 1I5ZA 3FIWA 3ERED 3TP3A 3IPJA 3PNTA 4IXAA 4KFCA 5JVOA 1PP8F 3Q0VA 5M3MJ 3NAUA 2XC7A 3L2UA 1HDPA 2MC3A 3BCBA 3FMRA 3GEHA 4ENKA 3ADAC 2GBYA 3FOFA 4E7SA 5EGOB 3P7NA 3K69A 2VQGA 2D6FC 1XD7A 2AHQA 1D0ZA 2JUGA 4BDYA 1GXQA 1SFKA 4A3IJ 4BY7J 4A3DJ 4XLCA 1IRZA 3OYKA 2R5YB 1RI7A 2VASA 3SZPA 1JT6A 4XSZF 3G73A 1FYKA 1B6AA 1WOSA 1E3PA 3HUGA 3JRBA 3CTAA 4HYEA 3S16K 4HAMA 2DOFA 1AWCA 4G6DA 1B8IB 1I3QC 1YRNB 2DA1A 1WQFA 1EV7A 2E5ZA 3BOQA 4HSRA 1T8IA 5TGTA 1BI1A 2V7FA 3HSRA 2LBFA 2PFBA 4BUPA 2QWWA 3WTXC 1Y1WA 2X6OA 2PJPA 3ONQA 1KU9A 4CCNA 1VQMI 5IP7K 2O5JA 5L3DA 2JPCA 3KP5A 3TBIA 1UCRA 2A3SA 2FQ4A 2R92A 1AHDP 4M3DA 2XPWA 2K4JA 4GYIA 1HKSA 2E34A 3QP6A 5E8GA 2FBHA 4KIFA 1K83J 2B63J 4IQJA 2R7VA 5DEQA 4A0XA 4KDDA 4BXUA 2A6TA 5F0FA 2IRFG 3L4KA 5IYBK 1Z9CA 2WB1N 4WXCA 2JJ7A 2K9LA 2KIFA 4KMUX 1ZG1A 5DCFA 2W82A 3GO5A 2X48A 1N78A 1MBJA 5M3FJ 4NDLA 1NH3A 2LSOA 3HG9A 4M6XA 4DYCA 1I6VA 3BJOA 3M8FA 3W2WA 1HSJA 1SAUA 3OYJA 1FSHA 1ETYA 1WSRA 1LNWA 5IP9C 1SMYA 3A02A 5JVTA 1Y8QB 2KL4A 2KZGA 3GTGC 2XAHA 2JA7J 1L0OC 2WB1D 2MA3A 3H9QA 2XAFA 2CUZA 3C1DA 3MD2A 3DEUA 4OMZA 3V7SA 4QJVB 1JTXA 2FMLA 4AIHA 1AOYA 1X1CA 1R9TC 4A3GC 4GGGA 2E2IK 2KLOA 4Y4RA 4S05A 2X6XA 5EZHA 1LVKA 1WFXA 1Q1HA 3RZOK 4YFNA 3EUHA 5F6FA 4FE4A 1ODDA 1OKRA 1SC7A 1T6SA 3DBRB 3ZMTA 2M1BA 3K7AC 2XUBA 5IOTA 1I3QJ 3VYRB 4J01A 3HOZC 2R7ZK 2DFHA 3VEPA 3ZQLA 2M7AA 1VQ9I 4BACA 2ZNZA 1YJ9I 5M5YK 2M0CA 4G6QA 4P5OA 1QGPA 2VPRA 5HDKA 1JT0A 1WOOA 1DGRM 2FJ1A 2YU9K 3GTKK 2GOXB 2XVCA 5DTDA 2ZJRF 3RIRA 1O24A 4C3IC 1XC5A 2ISYA 2E36A 4XKWA 3PNYA 3RKWA 3CCRI 1TNSA 2R7UA 1HA8A 3CDIA 1X19A 4AIJA 3GTQK 3H1CA 2WV1A 3BT9A 1B4BA 2EINH 1DPUA 1W7PA 5J4VA 4JK1A 3M7GA 2PMUA 5E17F 1P7JA 1O3QA 1TWFA 2BW3B 3L2RA 2KJCA 4KC6A 1IXSB 3F3XA 2JA7A 4BKXA 1B4AA 4M1XA 1ZYRF 5HS7A 3OIPA 2L3DA 5K7ZA 2NRAC 4LG3A 4PFPA 1ZVUA 4B3AA 1RR7A 2W4SA 5EEGA 1EH6A 5HDNA 2PJRB 2KZVA 5GPCA 1WSVA 5C4XC 3RJPA 3SEQA 1ZELA 2WAQL 4BQQA 2MW8A 2CFOA 1VQ6I 2DBBA 1K61A 2ZUFA 1WJDA 3K2AA 3GTGJ 3HGGA 5FKOA 4CZZA 3GTJJ 4LB6B 4NNJA 1S5LC 1BM9A 3CMYA 5GAHJ 1I1SA 2A6HA 3CCJI 2JVHA 2M0MA 4A3GJ 4M6VA 2X6YA 3OR2C 1R9TJ 1XGSA 3HKZL 5KCMA 2CO5A 1TL8A 2EJRA 3H36A 1R00A 2LMDA 5EYRA 1MD0A 4NC8A 1G2HA 1TWCC 2NVTC 1MNDA 3LAJA 4E7JA 1A36A 3S93A 3M3YC 2DMTA 3K7AJ 4XKBA 3DLLF 1S9HA 2ESHA 3EUKL 2DW4A 3HOZJ 4BHCA 3QPTA 2VONA 1A6QA 4KA4A 1FOXA 1MJBA 1U9NA 3CCLI 1UELB 2NVUB 3ABTA 3HZJA 3I5UA 1EH7A 2NNYA 2DPUA 4DZJA 4YELA 4C3IJ 5D6FA 2LYCA 3SFIA 3GIRA 4OOIA 5DCMA 4AU7A 4CUGA 1HKQA 1AU7A 3FMSA 3F8CA 3QOPA 4ASNA 3OEPA 4FQGA 3S1RK 2YSRA 4XQFA 1IUFA 3I4NK 2GIVA 2Y0SN 2VBXA 3OYLA 2V6UA 3BTJA 4ZTFA 4XL9A 1YX3A 3CAGA 1IBAA 3IAM2 4R79A 2L7ZA 1WI3A 3E3VA 3WTYC 3E5XA 4E7ZA 3QPLA 2AO9A 4LK1F 3ZQGA 1H9GA 1XGOA 3SDBA 1K7AA 1EH1A 3GTJA 3CUOA 4EMSA 3FDYA 4KB4A 5HNHA 2IS2A 1YW9A 1MMAA 2ZXJA 1I6HC 4C3HC 4PSWA 1YJNI 2Z2SB 1V5GA 2D2WA 3QRFF 1CQTA 4C3JC 1SFXA 1IW7F 4O6JA 3KP2A 4RB2C 5C4XJ 5D5WB 1WH5A 4ANJA 3WHBA 3UNGC 1IDZA 2ZXIA 4GFQA 4IRHA 2FQOA 4E6KG 1UG2A 1FIPA 5K5QA 1O29A 1X3WB 3SYTA 1FOWA 2GA1A 1LEAA 4BU2A 2EZLA 4MHGA 2ZC2A 3S1NK 3OL3A 4RGUA 3V7CA 1J6WA 4GTDA 1UAAA 2QYOA 5EJCA 1BC7C 3KZYA 1OR7A 2ECBA 5ILVA 1P4WA 4G7OF 2WV0A 5E3MA 3BP3A 1ZGWA 4YIFA 2EIMH 3FXUA 1TWCJ 3VSLA 1RUNA 2PA8D 2NVTJ 3M3YJ 1XTAA 3BUEA 3PQKA 1ZQ3P 1E0EA 1UHSA 2Z99A 4A3IK 2P5MA 5JLXA 5KHDA 5CVRA 5LBQA 2GXBA 2R7FA 4IQ4A 4NB5A 3TFJA 1SFOK 3Q5FA 4BXXK 3M9AA 4Y7NC 5FKNA 1V5FA 2PBIA 1IAWA 1WJEA 3GTOC 1BIAA 3DPLC 1VQ8I 1O25A 4A3MC 2W84A 3I4MC 1P2FA 1XSVA 4YG2F 2G7HA 4HDVA 4LMYA 5K5OA 3GX4X 5M5XK 2RVCA 1KONA 3IRRA 5LHHA 1DDNA 4BBSK 3HL2A 2VB6A 2IVMA 2QA4I 3S2DC 4BDZA 4HF2A 3G4CA 4KISA 3BZCA 3LOCA 1TWGC 4OINA 2V9VA 1IZ1A 1BW5A 3O3KA 1UMQA 2R4GA 3L4JA 2WB1A 3GFIA 1ON1A 4KAWX 4YFKF 4AYBN 3HOXC 1PUFB 1NG7A 3BG9A 4LOCA 1K78A 2E7XA 3GTPA 2PMZN 4EM1A 2R7DA 3RQIA 2RDPA 3RKQA 1FTTA 2CUEA 1I6HJ 4C3HJ 4C3JJ 1I27A 3CCSI 2GIZA 3KPHA 4AC0A 2QEXI 1CF7A 1IDYA 1PUEE 3FKIC 3REOA 3H9GA 3HOWC 1PDNC 3GEEA 1VQOI 4JYKA 2OTJI 2BV6A 1RNLA 2WAEA 2DMPA 3I0TA 3TQNA 5DD4A 3JAMK 5IT3A 3JRAA 4GCVA 3ZQFA 3ZQ7A 3SHFA 1MGTA 1V55H 3HGYA 3WODA 4LQYA 3MZ8A 1XX5A 2QUFA 2VJIA 3KEQA 5DM6F 2ZMEA 3MN2A 4UB8C 2IA2A 2Q2EA 3SZGA 4V19K 4XKCA 2CW0F 4JX5A 3L2QA 3DLAA 2DA3A 4PZJA 4RAYA 4LLNA 4OAZA 2OUMA 1VQ4I 2LD5A 1YNNA 3MFKA 1S7OA 1Y1WK 1B72B 4CXFA 1WJBA 2DXIA 2IJLA 3TOBA 5JFRA 4XKVA 1T2KA 1DCOA 3BR5A 5C44C 3FXLA 4DYQA 2GXGA 1J9IA 2R92K 4BGDA 1N75A 5L3CA 2CW8A 2DCEA 2LRDA 3BDDA 4RGRA 4Y3OA 4A6EA 4A12A 4Y7NJ 5BMZA 4G7ZA 5M3MK 3JRHA 1O27A 2LFBA 1NTCA 4A3MJ 1IF1A 4PJMA 2D1VA 3E6MA 3I4MJ 4FASD 1POGA 5FJ8J 3K4LA 1QPIA 1FP2A 3MZHA 3ZQCA 5FD6A 3DP7A 2VUMA 2F5EA 2QSHX 1VTNC 1OQYA 4HNVA 4BY7K 2E1MB 1AKHA 4A3DK 2E1NA 3S2DJ 1HXDA 3HC7A 4OIRF 1ULYA 1TWGJ 5D5VB 4IL6C 5TJJA 1U78A 3MVPA 1T0FA 4IHSA 2WY8Q 2D1HA 1W5CC 2DAOA 3K4MA 1ETKA 2VI6A 4CCKA 3W6JB 3HOXJ 1KU7A 5IYDC 2LTPA 3FOEA 3ZN1A 2IGKA 4MO7A 2FF4A 4GT9A 4XOTA 1CF7B 1WZ2A 4X1EA 4HG2A 3FKIJ 4HX4A 3HOWJ 4E7HA 4J19A 4MQ9F 3PO3K 5CVVA 2E2IA 2VJ5A 2W00A 1WORA 2M30A 3PO2C 2V1UA 1DUXC 4U0WA 2NVXC 4P55A 4KT5C 2KDOA 2E2HC 2BEOA 5E3LA 1K83K 2OU2A 1OYWA 3QYEA 4AH6A 3FK6A 5LFAA 1WIHA 1USMA 4L18B 3HRMA 3PIPF 5ERIA 1VNDA 1F7UA 2E71A 4KN4X 4A0ZA 4RA2A 4KARA 3V8KA 1IN8A 5C44J 2B7EA 3K1NA 4RB0A 3CO6C 1MDMA 3I71A 4GDFA 1A35A 2DPDA 4AIKA 3OYGA 2YU9A 5KK1A 2HDCA 2EA4A 4BJ5C 3WTSC 2KRCA 1LB2A 2VKVA 2VKDA 3BQYA 3J7YJ 4UVAA 4HF1A 1TWFK 1ZQ1C 4B48A 5FLXK 1XSXA 3IV5A 2ISZA 3T5XA 2FQTA 3BP8C 3H0GC 2I10A 3ROUA 3Q9SA 2JA7K 2L2OA 1G51A 1HDDC 4JQFA 2UXXA 3HJEA 2EV6A 1YS7A 2CQNA 2XKPA 3DU5A 3S2WA 2MC4A 5GADJ 2GQQA 4KN7A 3DBLB 3CO7C 1QPMA 1SFEA 4H0EA 3G4SI 3HOTA 2HYFA 3H3VK 1G8XA 2DJIA 2O8XA 4GXOA 3CQZC 2H6CA 1KU2A 2K85A 4BEHA 3VFZA 1BBYA 5IYDJ 3WTUC 1BR4A 5CQEA 4L5IA 2LG4A 4U7BA 1I3QK 2ETHA 4DW6A 4YFXA 3K2ZA 5BNGA 4KMHA 1J5YA 1QZZA 2MSYA 2R93C 2GOMA 1FSEA 3K9TA 5D6EA 2FU4A 4ZDPA 4KMFA 2VQCA 4OIPF 1O2AA 1YS6A 4ZH4F 2FSWA 3RSNA 2M7BA 1ETQA 3A01A 1HSTA 1Z0XA 4IHVA 3PO2J 1XXCA 1J59A 2E2HJ 2EV0A 2IPQX 2X1DA 2OCCH 5HL8A 3OYDA 2O7OA 1R6RA 2F5VA 1G3SA 4LGWA 2QQAA 1HF0A 1VRQC 2GA2A 4KASA 3HB9A 1K4SA 3JAMZ 1TNTA 2E7WA 3HSEA 4B3XA 2P5KA 4J3NA 3RZDC 3ECOA 4IRGA 2IXSA 1Z21A 4XSXF 3CJTB 5EG0A 3QPSA 5F08A 4KIGA 3LSJA 3CDLA 3OOPA 1DP7P 1GUUA 1D5YA 3LSHA 3HXLA 4GRIA 2YU3A 4WWCA 4ESJA 4KIBA 4UV8A 4IO9F 1YITI 1ZN2A 2ZJ2A 5C4JC 5DS9A 1YO5C 2G9WA 2NVQK 2BVMA 2ELKA 4ZYHA 3CD6I 5HDGA 1TP4A 3H0GJ 1Y1VA 1CGPA 4WJ4A 4CYCA 1JVIA 3J7AO 1U5TA 3GTJK 1UZCA 1Z1DA 3OYFA 4M3EA 3A8IA 4HW0A 3CMAI 2QBYA 2HOTA 2FQ3A 3LSGA 4FHTA 4HLYA 5BPDA 3ELKA 2EZIA 3EUAA 1F4KA 4E70A 1HW2A 2JA5C 2DJNA 5ICFA 4XLNF 1TQIA 3CQZJ 1KGSA 2KISA 4X6AJ 2VPLA 1G3TA 5F1RA 4BBRK 3LAPA 2I5UA 1MNEA 1OISA 3JSTA 4A0YA 3HRSA 4LG0A 1LE8B 3K0LA 1G3YA 1RKTA 3KYCB 1BS2A 3K7AK 5CVJA 1K6OA 3K4CA 3TDUC 3FXRA 3AG3H 4I2OA 2GM4A 1XPPA 3HOZK 2HTJA 3HTSB 1SVOA 3CCVI 3R6SA 2FBKA 1O3SA 2R93J 4Q47A 4M3FA 4Y33A 1GE9A 1D8JA 1NHAA 4OIOF 2JZYA 1I1GA 3S14J 2MLGA 1P4XA 3VSKA 1IC8A 3O8HA 4FE7A 2K9NA 4C3IK 1G4DA 3TL4X 2VE9A 4K2EA 2ZSIB 3BG6A 1UG0A 3WGGA 2PLYA 1G6NA 1ISEA 4XLAA 2D45A 5LGNA 3WG7H 2EFQA 4MQVA 3TEDA 1L0WA 2EB7A 3SQNA 3OYAA 2NNNA 1ZKGA 3CCYA 3GTLC 2QQ9A 3EQLF 3LNQA 1VF9A 1RIOH 1YYVA 4W97A 3RZDJ 3DQVC 3HIFA 3H92A 3KCCA 1HQCA 4C9YA 5EG0B 1FY7A 5JLWA 3LSPA 1XN7A 4HPQA 4RAZA 4UXNA 4MIMA 2F5CA 2OTLI 2O3FA 1BL0A 2O6GE 1DD5A 3HKZN 5C4XK 1IRXA 2P0WA 4RM3A 5C4JJ 4LD5A 5J8CA 4NQWB 1OYIA 3H5NA 2O5IA 4L9JA 5IPAA 4CYCB 1U5TB 2DQRA 3HOUC 5FRMA 2HOSA 3GFMA 3GTPK 3KLOA 2VOOA 5CKTA 2K40A 1R58A 1U8RA 1OYYA 6PAXA 1Z05A 1Z6RA 1XZPA 2NVYA 2OV7A 3EYIA 2JA5J 5HLGA 2XSDC 3HKZD 1XDSA 3DTIA 2WTEA 4LG0B 3JRCA 5ICCA 2CUFA 5ICGA 4A3EC 2NVTK 2Q1ZB 1VGXA 4QIWL 1FPQA 1ZGJA 2VN2A 3GLLA 4QPQA 4F93B 4KATA 4DDQA 1LVAA 3RQ4A 4OIQA 1OMIA 1B9MA 4IJAA 4RS8A 2DT7B 3OS2A 4OAYA 2BVLA 1OCRH 2ZFUA 2MFZA 3IWFA 4DNCA 3TP0A 2V6SA 1ETXA 2OBPA 2A5WA 4I76A 1ZLJA 4J00A 3P9CA 1RR8C 3JSOA 2DTZA 1T56A 3DTKA 4D0PA 3S2HC 2LY2A 2XHKA 3F9KA 3HOSA 3GTLJ 3HHGA 1Q1VA 3CJQB 3HOYC 5FKKA 2V1XA 1UV7A 4F52A 5K5RA 1F36A 4U0VA 2NYXA 2JA8J 1OCTC 3VYSB 3OS1A 4BY1K 3GZ6A 2VUMK 1KQ9A 4FT8A 2BE5A 1GVJA 4XRMA 1MZBA 4A3FC 3I3LA 2ZB9A 2KIMA 4PJJA 1X1AA 4C3HK 4C3JK 5IYCC 1ETVA 1ZH5A 1IN6A 5F27A 2FNAA 2XV4S 2XGXA 3KIOA 2JA5A 4L5EA 1KQ4A 2KHMA 2L7KA 2E2JK 1ZXOA 3LA7A 4UHTA 2HOAA 4UV9A 1R4MB 4RB3C 5LLQA 3BZKA 2MH9A 3HOUJ 5IT9K 5BS6A 3AD9C 4B09A 3FHZA 1JOEA 2R0QC 2HKXA 3CUQA 3DU6A 5AIPA 2W7NA 1RU0A 3F21A 3H5AA 3ZN0A 1EFWA 5L3FA 5D8KB 2XB5A 4II2A 2HNHA 4GTBA 3MEXA 1KYZA 1H8AC 2WWYA 4Q5SF 1TWHC 3GF2A 3KEOA 2Z5UA 2PHCB 2A61A 4UVCA 2ESNA 2LY1A 3BG7A 3BTCA 4RM2A 3BWGA 1R5HA 4A3BC 3DKXA 5C3EK 2CSOA 4XSZA 3SZTA 3HUGB 1MBHA 4ZDLA 2H09A 2DO7A 4Y52K 3ESWB 3U1DA 4GTCA 2FEZA 1UB9A 5J3LA 5D8LB 5LGUA 2IGOA 4A3LK 2X1CA 3DF8A 2BOLA 2A07F 4LITA 2XPVA 3FISA 3PNVA 3WGHA 1K83A 2B63A 5J8FA 4G94A 1USSA 2LBFB 2W25A 2IT0A 1HBXG 1VQNI 1WCMC 5LRSA 2Y9ZA 3S2HJ 2OQGA 5ILSA 1R7JA 1TWGK 1WH7A 3OOUA 2IS4A 1EK8A 2DU9A 3E6CC 3F8MA 3JREA 4L0ZB 3HOYJ 3H3VL 2QCOA 4CICA 4CSWA 4HNTA 5ILUA 3LMMA 2X1EA 3C7JA 3QP5A 5KVRA 3WU2C 1GV5A 4PAAA 2AS5F 4HSTA 4U87A 5H6RA 3FXKA 1R1UA 3BJAA 4WF2A 4AWXB 2RNJA 2VJ4A 1GT0C 4A3FJ 1YX5A 3S3NA 5TMCA 5IYCJ 1PJ7A 2BY0A 5IY5H 1TWAC 2R7XA 3FKIK 2XAUA 2LH9A 3BZ6A 1JKRC 3LSMA 5CHPA 2CUJA 2HQ5A 1IV8A 2W57A 2OD5A 1ENHA 3SEZA 1U6GA 4BS9A 2LKSA 1Y0NA 1JQWA 1Y56A 3MAJA 5IP9J 1WSUA 4LOWA 2HTSA 3ZMUA 1QVTA 1HW1A 1V4RA 1ZARA 1RC9A 2RQQA 1JHFA 2F6CA 3FMQA 3QPHA 2K27A 3DPTA 1I3QA 4PJNA 3O2PE 2M8GX 1VLOA 1FBSA 1TWHJ 2EPFA 4M71A 3V7RA 1MNMC 1FOKA 3OPFA 1O2BA 4CCMA 4A3BJ 1X3UA 3KYDB 3P5JA 1JJ6C 5IORA 5ICEA 1YNJA 2E1MC 3MCZA 2E19A 2MG4A 3PQJA 1I50C 2L4MA 4BLAA 3AQPA 2XAQA 4HBLA 1BDFA 1BI2A 2FA5A 3GZ5A 4JX6A 3J80K 2RKHA 4ON0A 4HF0A 3CMEI 1XMKA 2KIUA 2F5DA 4LIVA 4YIIA 1WCMJ 1J09A 4HDUA 5A2QK 3L2CA 1FJLA 4B44A 1P9QC 3CMMA 4M3GA 2EBBA 1GXPA 4C2MK 2O5RA 4DYRA 1ZG5A 3NEUA 3F72A 2O9LA 2MGQA 3AD8C 4N9IA 3IAS2 2DDAA 3FM5A 1ZRFA 1W7PB 2FUG2 3OYEA 1Y1VK 3QYFA 5M5WJ 2EH3A 3C2GA 3H9JA 3S16C 4LJZF 2Z16A 4ZYAA 5E3OA 1TWAJ 3GTGA 4BQNA 4CZCA 2KKOA 4PABA 3HKZA 5DYMA 3G3ZA 2DA5A 2P4WA 1VZ0A 2XCQA 3WE3A 1ZYRA 1ETOA 2YX7A 3KP3A 1R9TA 1STZA 1W5TA 4HV6A 4WILA 1F93A 2JQ7A 5DDGA 2H94A 4DQ2A 2QENA 5E68A 5IP7C 2E2HK 2Y0SD 4QWQA 2STWA 2Q0OA 2K7LA 3S17C 1JI8A 2M2EA 3NRVA 2LREA 4BLBA 2M3AA 2PEXA 4P1WA 2E1CA 3PSFA 1EH8A 1YFHA 3MWMA 1LDJA 1EI6A 4B1RA 2IA0A 3I53A 2CFAA 1J7KA 3PUFA 5E79C 5BOXA 2ID6A 2UV1A 2W1OA 5IYBC 3A03A 1ONVA 1NG6A 3TMOA 3WU1B 2RC4A 2CQ7A 4MEXF 2K3FA 1I50J 5CLSA 3T0YA 3F0CA 4XICA 2FOKA 3DTEA 3OREA 3HRTA 4G12A 3TTGA 3CCQI 5F0HA 5FROA 5AONA 4A5NA 4I99C 3A1YA 1DP3A 1P7IA 5IP6A 2WB1L 2V26A 4CA0A 1IN4A 2Y2ZA 2CH0A 2F2EA 1E2XA 1RKWA 1QZEA 1O57A 3GVAA 5F64A 2GLOA 1LKXA 2LKPA 2OQRA 3AG1H 4LLGF 5DCMB 4ABZA 5J4YA 4F7ZA 4XN3A 5LEJA 1FEXA 3AQOA 4Z2YA 4A3JK 3HDDA 4FM9A 2XKOA 3A8KA 1ZAOA 4X6AK 2F5FA 1DGWY 4BE1A 5J40A 3R0AA 1QRYA 1KZHA 1ON2A 1JKPC 5L46A 1YIJI 3OYCA 3RZOC 3A0BC 3N0CA 2DA6A 5CQGA 3S16J 3QU3A 4ZZLA 1SMTA 4MFEA 5K7HA 4MFDA 2HDDA 4EQQA 3OYNA 1WQGA 1R1VA 1P6RA 4LK1A 2NVYK 3S14K 2R7ZC 3MKLA 3GTMC 4M9XA 2WBMA 3DFGA 2R7TA 2N8GA 3N4MA 2MD0A 3GTKC 3IP4B 3E1SA 3OSGA 1VQLI 1IW7A 3E6BA 1XXAA 5IP7J 4WXHA 3ASNH 2A69F 2KRFA 3FKJA 1GV2A 3KZZA 4UY8I 4IHXA 4HX7A 3S17J 1TWCA 2KQRA 3NWSA 2VXDA 3K6GA 1YIOA 5FFZA 4RMFA 5LEKA 2JK3A 4XRFA 2Z33A 3GTQC 2YUSA 1S72I 2XCOA 4AYBD 3RZDK 1SD4A 4BJ6C 3SFZA 1ITYA 2QF7A 1MBKA 2AXLA 2CMPA 2O03A 2TRTA 4JOMA 4XORA 5IYBJ 4ENNA 2RAEA 1QHGA 2IS1A 2PMZD 1OJLA 4L9TA 2O0YA 3S1MK 3ZMSA 5KAIC 3L2VA 1KYWA 1ACIA 4G7OA 1E3HA 3D5LA 4G7HF 4CO8A 5C4JK 2HYGD 2X85A 1J0RA 1JKQC 4DBQA 5B5EC 4Q4ZF 3ERMA 3UKGA 3TGNA 3BR1A 5FLMC 3MKZA 2NXNB 2VJJA 3DPUA 2HVRA 3RDIA 1ZREA 3GTOJ 5DUKA 1FWZA 4P9FA 1LEBA 2XB0X 4R8HA 2L0KA 2OAZA 2HDWA 3BTLA 1HKTA 4YG2A 4FTHA 2Y0MA 3OS0A 3U9GA 2JA5K 2DMNA 1KU3A 3E97A 1RZ4A 2BY1A 4BQOA 1XSDA 2IP2A 5GPAA 3A2KA 1PJRA 4WJ3M 1R36A 3FF5A 3ZCOA 1TQPA 4PGGA 1QHHD 5J1RA 4CHUA 1C0WA 1K4TA 2XASA 3RZOJ 4GTAA 2XGEA 2K3PA 4CH7A 2VT2A 4PSXA 4RBOA 4BQAA 3R60A 1JUMA 4C2UA 4A3KC 4NUBA 4ZYGA 1BGWA 1G59A 4LR2A 4YFKA 1K78B 4O5VA 2WAFA 1BI3A 1F1ZA 2R7ZJ 1HQMA 2BY2A 4AUXA 2WADA 3GFLA 2JA2A 1SEUA 4W1UA 3GTMJ 2JA6C 5M5YJ 1D0YA 3F6OA 3FXQA 1L3LA 2CJJA 2P7CB 3MMLB 1IV6A 3GTKJ 2EFOA 2V6CA 3G1MA 4O2DA 3I59A 3RI4A 1MBEA 2ACJA 2PX9A 3SXYA 2YPRA 3L00A 2OCEA 4A93C 1I39A 2VT3A 3GTLK 3I4NC 4EJOA 2A6EF 1SD5A 3VA7A 4XLPF 2P7VB 2ZMEB 3GTQJ 4M6YA 2Q2EB 3T02A 2LF7A 3D5SC 2K9MA 1V3FA 1PJ5A 2LR8A 4M9SA 2JA8K 2B63K 2JT1A 1FP1D 5KNLA 2CW0A 3GTOA 5GTHC 1BA5A 2ZFWA 3F6VA 2A05A 5FFXA 1PP7U 3FXOA 2JUCA 4D5FA 4D9JA 2A5YB 2OZUA 5FRNA 2FD5A 4P96A 1XXBA 3M1EA 3HTUA 4EATA 5M3FK 4QLCU 3LPXA 2R5ZA 4EVIA 3H3ZA 3E7LA 4FETA 1FT9A 1RUOA 1ZRDA 2R7SA 4A69C 3CP8A 3V8LA 2IEKA 2K9QA 5FLMJ 1TWGA 3GYHX 3JR9A 2HZDA 4HNUA 3ASOH 5J6XA 3RKYA 1ZR4A 2GSOA 4KN4A 4QIWN 2VKEA 5JHUA 1BN5A 1BC8C 2CU7A 4BH9A 1K79A 3S1NC 3DXJF 4B47A 1S7AA 3WG9A 1AKHB 1DCPA 2JPBA 2PA8L 1QVUA 2CS3A 2UWMA 1HOMA 3K10A 4KB2A 5IOYA 1LDKB 2Y0SA 3FKIA 4OIRA 4YRVA 3AKZA 3IRQA 1VJEA 1YE9A 2VIXA 4XMYA 2FOWA 1AB4A 3B73A 1S6LA 3Q0UA 2HFHA 4A3KJ 4H4KC 1EKEA 3JTHA 2DDBA 4Q48A 2DODA 1ZHFA 3TW6A 2P5LC 1HLVA 4O3MA 4EJTA 3FWEA 2DT6A 1E3OC 4QIWD 3V8JA 1S7EA 4DOZA 1X31C 1SFOC 3LL7A 2DYSH 2FX0A 2JTVA 4A2UA 2JA6J 2XCRB 4BXXC 1FOYA 1LJ9A 4MEYF 4F55A 4S0HB 2L54A 1REPC 1T33A 2MD5A 4M3BA 2HQAA 4ZYEA 3I59B 1G3WA 2DOAA 4N4NB 3T8RA 3S3MA 1UHWA 1W5SA 1ZRCA 4D5CA 2VLAA 3ABLH 5D4RA 1XCBA 3J7AY 1TT0A 1OLTA 2YX4A 2EQRA 4A93J 4MQ9A 4BBSC 3AD7C 2RV8A 1IXCA 3QODA 3GFJA 1KQ0A 5HODA 2PI0A 3I4NJ 3VB2A 2WY7Q 1TTYA 2V1NA 3KZIC 4HZFA 4U0YA 1MSFC 3JRGA 2ME0A 4JBAA 1A31A 1D0XA 1J2XA 1MJAA 2IGMA 1DCHA 5D5UB 1IUYA 1MKMA 1BJZA 4A3FK 3RTRA 3ZQQA 2CQXA 2COBA 1PJ6A 2DYRH 1B9NA 1FYMA 4XOPA 5FKLA 5DUIA 1Z77A 1MDMB 4KYWA 4ILDA 3DEWA 1R71A 1MMDA 2A68F 3KLNA 4QPOA 3CCEI 1J6VA 5AIQA 1P92A 5L3GA 3K70C 4ZTJA 2JWTA 1FBQA 1IJWC 4PGHA 3VDXA 3FHNA 4UB6C 5IP9K 3OYHA 1WVRA 2ZNYA 4ZC3A 4BHPA 3M4OC 1X2MA 3F8FA 1ZBSA 3GTGK 1YQAA 3S1NJ 3BCAA 3N05A 5L3EA 2G7UA 3K4BA 2CYYA 3SDGA 1TWHK 4KM9A 4A3GK 4TV7A 4IVNA 4LIUA 2H1KA 1R9TK 4PCQA 4PJLA 5CPRB 3MKWB 3CF5F 2HWVA 4LK0F 1FZPB 2KWAA 1Y1WC 1TW3A 2OPTA 4RAFA 2CWEA 4BEHB 1BOAA 5GAEJ 4P9UA 1GHCA 4HLXA 3OYBA 2QSFX 3LQRA 2R92C 3OR1C 4AYBA 3R4KA 1FTZA 1BJTA 4HV5A 3AL0B 4WK8F 2B0LA 3GSIA 3KP7A 2E2HA 3K4NA 1A5JA 4BXXJ 2PMZA 2L5QA 2P6SA 1Z7UA 1VI0A 1TQMA 4Y17A 2MLKA 2Z3YA 5H2FC 3A8JA 4AD9A 1XGMA 3C3WA 2CQKA 3L1PA 2NVXJ 4IOAF 3KE2A 5EGOA 1MMSA 5M5XJ 1JUSA 3U2RA 3FXJA 3A01B 3VODA 4OIPA 4A3CC 4ZH4A 4NOIA 3D1NI 2DK8A 3R61A 3HOVC 1TBXA 1H0MA 3RCOA 2GAGC 2CFXA 5EZGA 2HQRA 3M07A 2R5YA 5TMFA 4I6ZA 2LDUA 2O8KA 4HQMA 2WAQN 4WXDA 3ZR8X 5GTIC 2DA4A 4BHBA 1W0TA 4V2GA 3BP8A 2VQLA 1XB4A 3IUOA 3ML6A 4LFUA 4PJ0C 5E1XA 4BJTA 2HVQA 3COAC 3H0GA 3G2BA 1YI2I 1TT5B 2K5CA 5HNFA 1YRNA 2DN0A 1WRJA 5F04A 4BNCA 4XSXA 4DZPA 1MBFA 1SFUA 1Z6TA 1A04A 1LUJB 2KRHA 1JJ8C 3N0BA 2HVSA 1F43A 2DK5A 4M73A 4CGZA 5K1YA 5F1JA 4F91B 3EUHC 2CQQA 3CQZA 3PO3C 2AQEA 3PM1A 3V4GA 4II3A 3M4OJ 4E7KA 1Y0UA 1WWXA 2L7FP 1MMGA 3M8EA 2WAQD 3JSPA 2EILH 2VC0A 4BYYA 2V1DA 2B9SA 3HYIA 1VFCA 2QBYB 2KJBA 5B66C 1UHMA 2ZCWA 3BTIA 1O28A 2R93A 4MGRA 3ZXSA 1SANA 3OWTA 3F8NA 2Y3PA 5HVQC 3QX3A 3FBIB 1Y1WJ 4G0VA 3CJNA 4F92B 5TISC 5J1YA 4N9HA 3ZQIA 2M5WA 1ZLKA 4UUTA 1HI9A 2KDZA 4ENJA 3NWTA 4RDUA 4G8XA 4XLNA 2V9KA 3VOEA 3FX3A 4M9ZA 3RPUD 1TWCK 3I9V2 2G0EA 2EV5A 2PN6A 3M3YK 1D5VA 1V5EA 3R0JA 5GAGJ 1KQ8A 4GTLA 4RMNA 3AG4H 3I56I 1SMYF 5EEAA 1OCPA 1W1WE 1TWFC 2R7RA 5LD2C 3CC4I 2ZFZA 4OIOA 3BY6A 3TOAA 2JA7C 1QQIA 4A3CJ 1IE0A 3JCUC 1FLIA 3PFIA 3HOVJ 4QJVA 1TC3C 3D5RC 1IO2A 2L02A 2QKMB 3LWFA 2XAJA 2IAIA 2OF7A 4YFNF 5IOQA 2ZBKA 4V2FA 4XN0A 5J47A 2M4GA 3MMYB 2GAUA 1O7FA 3EQLA 5CJ9A 5HOOA 2MBFA 1EF4A 3Q3QA 2DA7A 4MLOA 3G6EI 2LLKA 4BKWA 3WTZA 3X2QH 3RYRA 2RGRA 3VYTB 3LFUA 2EBIA 1I6HK 2RQPA 4DJAA 3ABMH 2ZKZA 3CESA 3U1KA 2ZXWH 2QSGX 1J6XA 3PO3J 4IRIA 2HOEA 1ZG3A 3S17K 1B59A 3HXAA 2K4BA 3L09A 4KMUA 4G9YA 5HLIA 1W36C 1YLFA 3J81K 4P5BA 2IS6A 2E1OA 3CJRB 3TO9A 3A4CA 2FBIA 2KPMA 2F4IA 2HI3A 1YW8A 3DKWA 1XZPB 1GLNA 1X58A 2BW3A 3W3CA 2EK5A 4S04A 2LY9A 1XZQA 1R23A 3EYYA 4LB5A 3BLYA 2JH3A 2JMWA 1BR1A 3JW4A 4A3EJ 2HEOA 2IW5A 1R22A 1XG1A 4GYGA 4I02A 1IRFA 3T8TA 2PJRA 2E2IC 3FZVA 1D1AA 4I09A 3N97A 2NS8A 1VQKI 1SD6A 1R1TA 5L3BA 1TLHB 4Y7NK 1MW7A 4YEJA 3O8GA 3GTLA 1TWFJ 4CYDA 3J7ZI 2NVQC 3GTOK 4A3MK 3GMEA 3I4MK 5FJ8K 2JRMA 4RGSA 4IHTA 1JGSA 4D7MA 3QAHA 3GTJC 4BE0A 5E1ZB 5E8IA 2L9RA 2A6HF 3E5QA 4CCLA 2CW7A 2JSPA 4XIDA 3ULQB 4GO1A 1LFPA 1WOPA 2ECCA 3S2DK 4RLQA 4MTEA 2XDVA 1UFMA 3KX2A 1FC3A 1FMVA 3CF2A 1Z91A 4BXFA 3SZZA 2EFPA 1APLC 3BR2A 1IS1A 2PQ8A 5LHGA 2NOJB 3HOXK 4G6TB 1U2WA 2ELHA 1XCVA 3GTMK 2VOPA 4UUSA 2Q8KA 1Y8RB 3E5UA 1E17A 1JHHA 2L9SA 1OR7C 2W7VA 2PG4A 1O7LA 4M74A 1QA6A 3HOWK 4I98B 2Y48A 2BBYA
chains in the Genus database with same CATH topology
3GXOA 4EV0A 3BPVA 1YW7A 3CUQB 2CG4A 4RB1A 2COMA 2OA4A 3IHUA 1T38A 2K02A 4OMYA 1P4AA 3TO7A 3P9KA 3B02A 3O6BB 4B8XA 2W24A 4WCGA 3ZMVA 2HQNA 4AVPA 1IXRC 1QNTA 1XDUA 3HHHA 3LSTA 2L4AA 3IKVA 1S8NA 2CGPA 4G0WA 2X4HA 5FD5A 1J75A 3T1BA 2XAGA 3NUHA 3KP4A 2RH6A 5D4SA 4R1HA 4KUMA 3TDZC 4P5AA 3WTWC 4LLLA 4EM2A 5E18F 2XIGA 3H3UA 2WC2A 1O26A 1W4MA 2V79A 5FO5A 1I6XA 1F5TA 3RPUA 3GLXA 1TWHA 2Y75A 1XGNA 5BPIA 3CLOA 3MZYA 2H6BA 4OINF 2HR3A 3GWZA 4L9NA 5TJ3A 1S29A 3ZPLA 3WTVC 2EFWA 4ZYDA 5IT9Z 4M72A 2NS0A 2M8EA 3J81Z 1BIBA 3AAFA 2UXNA 2DI3A 2EWNA 2VBWA 4L0YB 1WCMA 5CVUA 3MQ0A 3WU0A 3WE2A 4UUVA 1WQ2A 3CDHA 2GZWA 5JI6A 1MJ9A 3WTTC 4NHJA 3WODF 4BAYA 2QVOA 2M87A 1D3YA 2W85A 3ZMDA 2VBYA 3GW2A 3BROA 1R5GA 1TWAA 5LRRA 1FX7A 3P9IA 2VE8A 5EGEA 1JXSA 3AH5A 2RGVA 4G7ZF 2HKOA 1U3EM 1H9TA 4U7DA 3I58A 3DV8A 3ZP5A 1IN5A 2MH2A 4KICA 4KM8A 1I50A 4MNUA 1F9NA 1USTA 2LF8A 5EEHA 1FNNA 3ZMZA 3F23A 2CFAB 1WQHA 3I54A 3L7WA 4RGXA 2J5OA 3C18A 4HQEA 3S0XA 2P5VA 4U88A 3KFWX 5E20A 3W6KB 4OU0A 3GEZA 4L5JA 4FX4A 2XRNA 2IA1A 1SD7A 2FE3A 4KMDA 3J80Z 1T98A 4KMAA 2GWRA 4FX0A 4A5MA 2K86A 2ZO4A 2C6YA 2TDXA 2DFIA 2QQBA 5DD8A 5A2QZ 5CYVA 5IOSA 2P6TA 5ED4A 1ZGAA 2HZTA 3IL2A 1IN7A 4GTFA 2P8TA 3ISPA 4I0BA 2FNPA 4UVBA 4ENMA 3WGIA 3BJ6A 2FRHA 4XBFA 5DV5A 4HOBA 4C2MC 2EFNA 3I64A 2GSNA 2HS5A 4EGYA 3BPXA 4WX9A 3D0SA 4EGZA 2VXZA 3I4PA 4KDPA 4I7HA 2QLZA 1U5TC 4YFXF 3JTGA 4UNOA 1WKMA 4A6DA 2HGCA 2XROA 1BJAA 1T39A 1XMAA 2VODA 1LDDA 1JE8A 3ABUA 5LHIA 3RYPA 4ESFA 5FB2A 2QM3A 5LGTA 1KA8A 2R7ZA 2QZ8A 3GTMA 2M45A 4MTDA 2VC1A 2LNBA 1DPRA 2FMYA 3GTKA 3ECHA 5E1WA 1IRGA 2JRTA 2X0LA 1YTYA 3GTQA 2BYVE 4KN7X 4I0AA 4IPAA 1WI9A 2ADUA 1D8KA 2BGCA 3F8BA 3RKXA 2L01A 3OV8A 1FYLA 1YG2A 4N0BA 2EA2A 3F22A 4FZBA 4ZZDA 5FGMA 4I01A 4EM0B 3HRUA 4Y15A 5CVIA 2RN7A 3L9FA 1O3TA 2JSCA 4CDGA 4EJVA 2FXAA 3TO6A 2GSUA 1O3RA 3GUDA 3IKTA 3HSFA 5HLHA 2UZKA 4IF4A 5FLXZ 3QU6A 1OPCA 3N3YA 4PDKA 1HW5A 3EDPA 5HS8A 3TKYA 1QZYA 3FM3A 1QBJA 2JA6A 4ETSA 2YR2A 4EJUA 4ESBA 3NQOA 3IWZA 5D5XB 1B1BA 2O61A 4GTEA 4HX8A 4NQWA 5HS9A 2Z9OA 3Q9VA 4L9VA 3K1MA 5BQTA 2BBYA 1W7PD 4KNYA 1S3JA 2H27A 2R3SA 5H20A 1QO0D 5JR3A 2PMHA 3G4AA 3EETA 3LFKA 3KETA 5H6QA 4OIQF 5TRDA 3CUQC 2STTA 1LQ1A 5JFEA 1FBUA 2OZ6A 4EJWA 4G0UA 2DLLA 2VBZA 3KP6A 2J5PA 2DQLA 2NAZA 1TW2A 3IC7A 5EGHA 2DTRA 3E6DA 3RPQA 3LA3A 1SFOA 2BE5F 1BI0A 2NVXA 2DT5A 4Y13A 3K1PA 4HA8A 3LQQA 3LA2A 1SAXA 1I5ZA 3ERED 4IXAA 4KFCA 5JVOA 1PP8F 2MC3A 3FMRA 3FOFA 4ENKA 3P7NA 3K69A 1XD7A 1GXQA 1RI7A 3SZPA 4XSZF 3G73A 1FYKA 1B6AA 3HUGA 3CTAA 4HYEA 4HAMA 1AWCA 4G6DA 1WQFA 1EV7A 3BOQA 1BI1A 3HSRA 2PFBA 2QWWA 3WTXC 1Y1WA 2PJPA 1KU9A 5L3DA 2JPCA 3KP5A 1UCRA 2A3SA 2R92A 2K4JA 4GYIA 1HKSA 3QP6A 5E8GA 2FBHA 4KIFA 5DEQA 4A0XA 4KDDA 4BXUA 3L4KA 2IRFG 1Z9CA 4WXCA 2KIFA 1ZG1A 4KMUX 5DCFA 3GO5A 2LSOA 4M6XA 3BJOA 3M8FA 1HSJA 1FSHA 1LNWA 5JVTA 2XAHA 1L0OC 2MA3A 2XAFA 3C1DA 4OMZA 3V7SA 3DEUA 4AIHA 2FMLA 1AOYA 4GGGA 4S05A 1Q1HA 3EUHA 5F6FA 1ODDA 1OKRA 1T6SA 3ZMTA 2M1BA 5IOTA 2XUBA 3VEPA 2ZNZA 4G6QA 4P5OA 1QGPA 5HDKA 2XVCA 3RIRA 1O24A 4C3IC 2ISYA 3RKWA 1TNSA 4AIJA 1B4BA 1DPUA 1W7PA 3M7GA 2PMUA 5E17F 1O3QA 1TWFA 2KJCA 4KC6A 1IXSB 3F3XA 2JA7A 1B4AA 4M1XA 1ZYRF 5HS7A 2L3DA 2NRAC 1ZVUA 5EEGA 1EH6A 5HDNA 3RJPA 2DBBA 4CZZA 4LB6B 1BM9A 1I1SA 1XGSA 2CO5A 2EJRA 1R00A 1MD0A 3LAJA 2ESHA 2DW4A 4BHCA 3QPTA 2VONA 4KA4A 1MJBA 3ABTA 3I5UA 1EH7A 2NNYA 2DPUA 5D6FA 4OOIA 5DCMA 1HKQA 3FMSA 3F8CA 3QOPA 4ASNA 3OEPA 2YSRA 2GIVA 2VBXA 3CAGA 4R79A 3E3VA 3WTYC 3E5XA 4LK1F 1H9GA 1XGOA 1K7AA 1EH1A 3GTJA 3CUOA 4EMSA 4KB4A 1YW9A 2ZXJA 4C3HC 4C3JC 2D2WA 3QRFF 1SFXA 1IW7F 4O6JA 3KP2A 4RB2C 5D5WB 4GFQA 4IRHA 1O29A 5K5QA 2GA1A 1LEAA 4MHGA 4RGUA 4GTDA 3V7CA 2QYOA 1BC7C 3KZYA 1OR7A 5ILVA 1P4WA 4G7OF 2WV0A 4YIFA 3FXUA 1RUNA 3BUEA 3PQKA 2Z99A 2P5MA 5LBQA 5CVRA 2GXBA 2R7FA 4NB5A 3Q5FA 3M9AA 2PBIA 1IAWA 1BIAA 3DPLC 1O25A 2W84A 1P2FA 1XSVA 4YG2F 2G7HA 4HDVA 4LMYA 5K5OA 3GX4X 2RVCA 3IRRA 5LHHA 1DDNA 2IVMA 3G4CA 2V9VA 1IZ1A 3O3KA 3L4JA 3GFIA 1ON1A 4KAWX 4YFKF 1K78A 2E7XA 3GTPA 4EM1A 2R7DA 2RDPA 1I27A 1CF7A 1PUEE 3REOA 1PDNC 2BV6A 1RNLA 3I0TA 3TQNA 5DD4A 3JAMK 5IT3A 4GCVA 3ZQ7A 3SHFA 1MGTA 4LQYA 2QUFA 3KEQA 2ZMEA 2IA2A 2Q2EA 2CW0F 4PZJA 4RAYA 4LLNA 3MFKA 1S7OA 4CXFA 2IJLA 3TOBA 5JFRA 1T2KA 2GXGA 1J9IA 5L3CA 3BDDA 4RGRA 4A6EA 4A12A 5BMZA 1O27A 1IF1A 2D1VA 3E6MA 1FP2A 3MZHA 5FD6A 3DP7A 2VUMA 2F5EA 1VTNC 2E1NA 1HXDA 4OIRF 1ULYA 5D5VB 5TJJA 1U78A 1T0FA 4IHSA 2D1HA 2DAOA 3W6JB 1KU7A 3FOEA 3ZN1A 2FF4A 4GT9A 1CF7B 4HX4A 4MQ9F 5CVVA 2E2IA 2M30A 2V1UA 1DUXC 4U0WA 4P55A 4KT5C 2BEOA 2OU2A 1OYWA 1WIHA 4L18B 3HRMA 5ERIA 4KN4X 4A0ZA 4KARA 3V8KA 1IN8A 3CO6C 3K1NA 4RB0A 1MDMA 3I71A 2DPDA 4AIKA 2YU9A 5KK1A 2HDCA 2EA4A 3WTSC 1LB2A 4UVAA 4HF1A 1XSXA 2ISZA 3T5XA 3ROUA 3Q9SA 4JQFA 2UXXA 2EV6A 1YS7A 2XKPA 3S2WA 2GQQA 3CO7C 1QPMA 1SFEA 4H0EA 3HOTA 2HYFA 2O8XA 4GXOA 2H6CA 1KU2A 3VFZA 1BBYA 3WTUC 4L5IA 4U7BA 2ETHA 3K2ZA 4KMHA 1J5YA 1QZZA 1FSEA 3K9TA 5D6EA 2FU4A 4KMFA 4OIPF 1O2AA 1YS6A 4ZH4F 2FSWA 1HSTA 1XXCA 1J59A 2EV0A 2IPQX 4LGWA 1G3SA 4KASA 2QQAA 2GA2A 3JAMZ 1TNTA 2E7WA 3HSEA 2P5KA 4J3NA 3ECOA 4IRGA 4XSXF 4KIGA 3OOPA 1DP7P 2YU3A 4WWCA 4ESJA 4KIBA 4UV8A 1ZN2A 2ZJ2A 1YO5C 2G9WA 4ZYHA 5HDGA 1Y1VA 1CGPA 3J7AO 1U5TA 1Z1DA 4HW0A 2QBYA 2FQ3A 4FHTA 4HLYA 5BPDA 3ELKA 1F4KA 4E70A 1HW2A 5ICFA 4XLNF 1TQIA 1KGSA 1G3TA 5F1RA 3LAPA 4A0YA 3HRSA 4LG0A 3K0LA 1G3YA 5CVJA 1K6OA 3TDUC 3FXRA 4I2OA 2HTJA 3HTSB 3R6SA 2FBKA 1O3SA 4Q47A 1GE9A 1D8JA 1NHAA 4OIOF 2JZYA 1I1GA 2MLGA 1P4XA 1G4DA 2VE9A 4K2EA 3WGGA 2PLYA 1G6NA 1ISEA 2D45A 5LGNA 2EFQA 4MQVA 2EB7A 3SQNA 2NNNA 2QQ9A 3EQLF 1YYVA 3DQVC 3HIFA 3H92A 3KCCA 1HQCA 1FY7A 1XN7A 4RAZA 4UXNA 2F5CA 2O3FA 2O6GE 1DD5A 4LD5A 5J8CA 1OYIA 4L9JA 1U5TB 2DQRA 3GFMA 3KLOA 2VOOA 1R58A 1U8RA 1OYYA 6PAXA 1Z05A 1Z6RA 2NVYA 3EYIA 5HLGA 1XDSA 2WTEA 4LG0B 5ICCA 5ICGA 1FPQA 1ZGJA 2VN2A 4KATA 4DDQA 1LVAA 1OMIA 1B9MA 4IJAA 4RS8A 3IWFA 4DNCA 2OBPA 1ZLJA 3P9CA 3JSOA 4D0PA 2XHKA 3HOSA 3HHGA 2V1XA 5K5RA 4U0VA 2NYXA 3GZ6A 1KQ9A 4FT8A 1GVJA 1MZBA 2KIMA 1ZH5A 1IN6A 2FNAA 2XV4S 2XGXA 2JA5A 1KQ4A 1ZXOA 3LA7A 4UHTA 4UV9A 4RB3C 5LLQA 2MH9A 5IT9K 5BS6A 4B09A 3FHZA 2HKXA 3CUQA 5AIPA 3F21A 3ZN0A 5L3FA 5D8KB 4GTBA 3MEXA 1KYZA 2WWYA 4Q5SF 3GF2A 3KEOA 2Z5UA 2PHCB 2A61A 4UVCA 2ESNA 3BWGA 1R5HA 2CSOA 3SZTA 2H09A 2DO7A 3U1DA 4GTCA 2FEZA 1UB9A 5D8LB 5LGUA 3DF8A 2A07F 3WGHA 1K83A 2B63A 5J8FA 4G94A 1USSA 2W25A 2IT0A 1HBXG 5LRSA 2OQGA 5ILSA 1R7JA 1EK8A 2DU9A 3E6CC 3F8MA 4L0ZB 4CICA 5ILUA 1RIOH 3C7JA 3QP5A 5KVRA 2AS5F 5H6RA 1R1UA 3BJAA 4WF2A 4AWXB 2RNJA 3BZ6A 5CHPA 2W57A 2OD5A 1U6GA 3MAJA 1WSUA 2HTSA 3ZMUA 1V4RA 1HW1A 1ZARA 1JHFA 3FMQA 3QPHA 2K27A 3DPTA 1I3QA 3O2PE 1FBSA 4M71A 3V7RA 1FOKA 3OPFA 1O2BA 5IORA 1X3UA 5ICEA 3MCZA 3PQJA 2L4MA 4BLAA 3AQPA 2XAQA 4HBLA 1BI2A 2FA5A 3GZ5A 3J80K 2RKHA 4ON0A 4HF0A 1XMKA 2KIUA 2F5DA 4YIIA 4HDUA 5A2QK 3L2CA 1GXPA 1ZG5A 3NEUA 3F72A 4N9IA 1ZRFA 3FM5A 1W7PB 4LJZF 3GTGA 2KKOA 5DYMA 3G3ZA 2P4WA 2XCQA 3WE3A 3KP3A 2YX7A 1R9TA 1STZA 1W5TA 4HV6A 5DDGA 2H94A 4DQ2A 2QENA 4QWQA 2STWA 2Q0OA 2K7LA 3NRVA 4BLBA 2PEXA 2E1CA 1EH8A 1YFHA 3MWMA 1LDJA 2CFAA 2IA0A 3I53A 1J7KA 5BOXA 1ONVA 3WU1B 2RC4A 4MEXF 5CLSA 3T0YA 2FOKA 3OREA 3HRTA 4A5NA 5AONA 1IN4A 2F2EA 1E2XA 1O57A 3GVAA 5F64A 2LKPA 2OQRA 4LLGF 5DCMB 4F7ZA 5LEJA 3AQOA 4Z2YA 4FM9A 2XKOA 1ZAOA 2F5FA 3R0AA 1ON2A 3N0CA 3QU3A 4ZZLA 1SMTA 4EQQA 1WQGA 1R1VA 1P6RA 4M9XA 3DFGA 3N4MA 3E6BA 1XXAA 4WXHA 2A69F 2KRFA 3KZZA 4HX7A 1TWCA 1YIOA 5FFZA 5LEKA 4XRFA 2Z33A 2XCOA 1SD4A 3SFZA 2O03A 2AXLA 4ENNA 5FLXK 4L9TA 2O0YA 3ZMSA 1KYWA 3D5LA 4G7HF 4CO8A 2HYGD 1J0RA 4Q4ZF 3TGNA 3RDIA 1ZREA 5DUKA 1FWZA 4P9FA 1LEBA 4R8HA 2OAZA 1HKTA 2Y0MA 3U9GA 3E97A 1KU3A 1RZ4A 1XSDA 2IP2A 1R36A 3FF5A 1TQPA 4PGGA 4CHUA 1C0WA 2XASA 4GTAA 2VT2A 4BQAA 3R60A 4ZYGA 1BGWA 4LR2A 1K78B 4O5VA 1BI3A 1F1ZA 3GFLA 3FXQA 3F6OA 1L3LA 3MMLB 2P7CB 2EFOA 2V6CA 3I59A 3RI4A 2ACJA 3SXYA 2YPRA 3L00A 2VT3A 4EJOA 2A6EF 1SD5A 3VA7A 4XLPF 2P7VB 2ZMEB 4M6YA 2LF7A 1V3FA 4M9SA 2JT1A 1FP1D 3GTOA 2ZFWA 3F6VA 5FFXA 1PP7U 2A5YB 2OZUA 4P96A 1XXBA 3M1EA 3HTUA 4QLCU 3LPXA 4EVIA 3H3ZA 1FT9A 1RUOA 1ZRDA 3V8LA 1TWGA 3GYHX 2GSOA 5J6XA 3RKYA 5JHUA 1BN5A 1BC8C 4BH9A 1K79A 3DXJF 1S7AA 3WG9A 2JPBA 2UWMA 4KB2A 1LDKB 3FKIA 3IRQA 1AB4A 3B73A 1S6LA 2HFHA 3JTHA 4Q48A 2P5LC 1ZHFA 4O3MA 4EJTA 3FWEA 3V8JA 2JTVA 4A2UA 2XCRB 1LJ9A 4MEYF