4A3IK

Rna polymerase ii binary complex with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3iK00
2WB1L 5IYDC 3S1RK 4G7HA 5TMFA 5C4JC 4G7ZA 3WODA 2R7ZK 2JA8C 1I6VA 5M5XK 4A3CC 2PA8L 4G7OA 1I50C 2JA7K 2R93C 4YFXA 4A3KC 5IYBC 1TWGK 2E2JC 3S17C 3S1QK 2VUMK 1R9TC 3S14C 2E2HK 4C2MK 5IYCC 2NVTK 3M4OC 1ZYRA 4YFKA 2YU9C 3HOXK 4A3LK 4LK1A 5M5WK 5C4JK 1XPPA 5M3FK 4BBSC 4BBRC 3PO2K 4A3CK 1TWFC 2R93K 1I50K 4AYBL 5IYBK 3S17K 1I3QC 4KN7A 1R9TK 3EQLA 3S14K 2WAQD 3S1MC 3M4OK 4XLPA 2YU9K 5C4XC 4OIQA 2NVYC 5IP9C 4A3GK 4OIOA 3GTPC 5FJ8K 4Y52C 2NVQK 4BBRK 4BBSK 2JA5C 4ZH4A 1I3QK 2Y0SD 5TMCA 4GZYA 2PMZL 1TWHC 4Q5SA 3PO3C 3H3VD 4BY7C 4QIWD 1SFOC 5C4XK 3GTOC 3FKIC 2WB1D 2A68A 4C3HK 5IP9K 4XLNA 4QJVB 4A3IC 5IYDK 1IW7A 4A3DC 3GTPK 4LK0A 1TWAC 5C44C 2PA8D 2JA8K 4Y52K 1Y1VC 2B63K 4A3LC 2CW0A 4A3KK 3RZDC 2E2JK 3GTMC 3GTQC 5FLMC 3HOYC 3HOZC 1TWHK 3PO3K 3S2DC 4BY7K 5IYCK 4KMUA 3S2HC 1K83C 3GTKC 3FKIK 3GTOK 4XSZA 4NOIA 4A3IK 3DXJA 4C3JK 4OIRA 4A3DK 3HOVC 3HOUC 5C44K 3I4NC 4A93C 4A3JC 4AYBD 5C3EC 1TWFK 4Y7NC 1WCMC 3HOYK 5IP7C 4A3BC 3GTMK 3HKZL 4LLGA 4XSXA 5FLMK 4A3EC 2NVXC 3HOZK 4X6AC 3H0GC 3S1MK 1YNNA 4YFNA 3S2HK 3GTKK 3S15C 2NVYK 4MEYA 5M3MK 2JA6C 1BDFA 2O5IA 3K7AC 4LJZA 3M3YC 4BXXC 3HOVK 4JK1A 3HOUK 3I4NK 2Y0SL 4A3JK 3S16C 4A93K 3S1NC 2O5JA 5C3EK 3GTLC 4Y7NK 1WCMK 3CQZC 2JA5K 2PMZD 4BY1C 5IP7K 4A3BK 3RZOC 1Y1WC 4A3EK 1TWCC 2NVXK 4Q4ZA 4OIPA 2R92C 4X6AK 3H0GK 1I6HC 4A3FC 4KN4A 1SFOK 3I4MC 3S15K 3PO2C 1YNJA 3GTGC 4OINA 2JA6K 4A3MC 2E2IC 4BXXK 3K7AK 3M3YK 3HOWC 1TWAK 3GTJC 3S1NK 3S16K 1Y1VK 3GTLK 5M5YK 4YG2A 3CQZK 2WAQL 2PPBA 3RZDK 4BY1K 2B63C 3GTQK 1SMYA 3RZOK 1Y1WK 1TWCK 3S1RC 3S2DK 2A69A 2A6EA 2R92K 2R7ZC 4A3GC 1I6HK 4A3FK 3I4MK 1K83K 2BE5A 2NVQC 3GTGK 2JA7C 4C3IK 4MEXA 3S1QC 1TWGC 2A6HA 4A3MK 2E2IK 2VUMC 3HOWK 5D4DA 3GTJK 2E2HC 4QJVA 1HQMA 4MQ9A 2NVTC 3H3VL 3HKZD 3HOXC 4QIWL
chains in the Genus database with same CATH superfamily
3GEHA 4G7HA 5TMFA 4G7ZA 2R7ZK 1BJTA 5M5XK 4A3CC 2PA8L 4G7OA 1I50C 2JA7K 1J6WA 2VUMK 1O2FB 2E2HK 2NVTK 3VA7A 1B4BA 1ISEA 4KATA 3A8JA 3PO2K 1AB4A 3S17K 4KN7A 3EQLA 5HL8A 3M4OK 4KMHA 2NVYC 3TTGA 5IOTA 4C3HC 1ZQ1C 4A3GK 1SFOA 1WSVA 1F7VA 1DCOA 1I3QK 2Y0SD 3AD8C 1BS2A 4GTDA 3PO3C 3L4KA 5C4XK 5IP9K 4XLNA 5IYDK 3T00A 4AH6A 4A3DC 1TWAC 2JA8K 1F9NA 4A3KK 2E2JK 3HOYC 5FLMC 1VLOA 4BY7K 5IYCK 1IS1A 4KMUA 3GTOK 1F7UA 3FHZA 4J3NA 3BP3A 1JOEA 4Y7NC 3GSIA 3GTMK 1O28A 3GTLA 3S1MK 1XXBA 1YNNA 2FQOA 3CQZA 4PABA 5JFEA 3GTKK 1BDFA 4KMAA 1O29A 4GTCA 3S1NC 4A93K 1JQWA 4A3JK 2PHCB 3HXAA 3S16C 1XZQA 4DDQA 5IP7K 3RZOC 3GTJA 4A3EK 2NVXK 3OPFA 4X6AK 4A3FC 3G4CA 3PO2C 4C3IC 4BXXK 1WOPA 3M3YK 1INNA 1Y1VK 1VJEA 4KASA 3RZDK 1SMYA 3S0XA 3S1RC 4A3GC 2R92K 3BP8C 1I6HK 3I4MK 3ERED 4MEXA 1TWGC 2A6HA 5TJ3A 3SZYA 2E2IK 3HOWK 3CAGA 1I50A 1EQRA 3HKZD 4A3LC 2D6FC 3GEIA 5IYDC 5C4JC 3FKIA 2JA8C 1WOSA 2XCQA 4A3KC 2E2JC 3ADAC 1DCPA 1R9TC 3S14C 4C2MK 1J6VA 5IYCC 2RGRA 2YU9C 3HOXK 4FZBA 5L46A 1XZQB 2NVYA 4BBRC 2R93K 1L0WA 5IYBK 4BLBA 4GTEA 3S1MC 1PJ7A 3N0BA 4OIOA 5FJ8K 4BBSK 2JA6A 4GZYA 4KARA 1TWAA 5TMCA 1GE9A 3FKIC 1IQ0A 2WB1D 2A68A 3GTPK 4LK0A 3GTGA 4Y52K 1Y1VC 3AQOA 4M1XA 5EGEA 2CW0A 3RZDC 2KWAA 3HOZC 1TWHK 4ILDA 1UV7A 3FOEA 3S2HC 4KB2A 4NOIA 4GTAA 4A3IK 3DXJA 4C3JK 3HOUC 5C44K 1G51A 1TWFK 1WCMC 5IOQA 4GTFA 3HKZL 4LLGA 4XSXA 3LAPA 3H0GC 4YFNA 4MEYA 1IBAA 5M3MK 2JA6C 4LJZA 1O2BA 3AD7C 5CHPA 3K7AC 3OREA 3HOVK 3I4NK 3A8KA 5C3EK 2JA5K 4A3BK 1Y1WC 2JH3A 1TWCC 3JSTA 4OIPA 1WSRA 1WORA 3S15K 1YNJA 3GTGC 3GTLK 1TWGA 4YG2A 1I3QA 3CQZK 2PPBA 2ZUFA 4BY1K 2B63C 1VGXA 3GTQK 2XCOA 3S2DK 2R7ZC 1V5VA 1O2AA 4G0WA 1K83K 1WQHA 4BKWA 2JA7C 4A3MK 2VUMC 5D4DA 3GTJK 2E2HC 4QJVA 1HQMA 1WOOA 2NVTC 4LR2A 1R9TA 4P5AA 4KDDA 2WB1L 4WILA 2YU9A 1I6VA 4YFXA 3S1QK 1BGWA 1USOA 3S17C 1RU0A 4GT9A 4O2DA 3N0CA 3M4OC 1ZYRA 4KM9A 3GTMA 1C0AA 3AD9C 2ZUEA 4LK1A 2ZFZA 1XPPA 3GTKA 1XXCA 3N3YA 1TWFC 4A3CK 1I50K 1I3QC 1KQ4A 2WAQD 5C4XC 3GEEA 5IP9C 1ZXOA 1WIHA 2W7VA 1F93A 3AQPA 2NVQK 1PJ5A 2GAHC 2JA5C 2V6TA 4ZH4A 4Q5SA 1Y1VA 3H3VD 4BY7C 3GTOC 4C3HK 4QJVB 3GIRA 2GSNA 2B63K 1XZPA 2E2IA 2CFAA 3GTQC 2GSUA 5EGHA 2XCRB 3GTMC 1O24A 1O27A 3PO3K 3S2DC 1WCMA 5IORA 1K83C 3GTKC 3LAJA 4XSZA 1VH2A 2FQTA 3H0GA 3OEPA 3QX3A 4OIRA 1YCLA 4A3DK 4A93C 4A3JC 4P5BA 4AYBD 3HOYK 5IP7C 2GSOA 5FLMK 4A3EC 2NVXC 4BLAA 4LOWA 4X6AC 1IL2A 1Y1WA 5CJ9A 3LPXA 1TWCA 4BXXC 3M3YC 4P9SA 4Y7NK 2PMZD 1WQFA 2R92C 1I6HC 1SFOK 4KN4A 3I4MC 1O25A 2B63A 2EBBA 3T01A 4KAWX 4KB4A 2R7ZA 2E2IC 3HOWC 1EK8A 4KMDA 3S1NK 2Y3PA 3S16K 2P5MA 2JA7A 2WAQL 2VUMA 3RZOK 2E2HA 2GAGC 2A69A 2A6EA 1XZPB 2CFAB 4FM9A 1DCHA 4A3FK 2NVQC 4C3IK 3GTPA 1WQGA 3NUHA 4C2MC 4MQ9A 3H3VL 3HOXC 1TWHA 3S1RK 3WODA 2R93C 5IYBC 1TWGK 1YX2A 1TWFA 4YFKA 4A3LK 5M5WK 5C4JK 5M3FK 4WJ3M 4BBSC 1DD5A 4AYBL 3L4JA 1R9TK 3S14K 1HI9A 2JA5A 3A8IA 4XLPA 2YU9K 4OIQA 4KC6A 3GTPC 3GTOA 4Y52C 4BBRK 4GTLA 4WJ4A 1J98A 2PMZL 1TWHC 4KM8A 4QIWD 1SFOC 3GTQA 1PJ6A 1ZVUA 1EH1A 4GTBA 4A3IC 4C3JC 1IW7A 1K83A 5C44C 2PA8D 1B4AA 5E68A 2V6SA 1EFWA 3FKIK 4G0UA 2NVXA 2V6UA 3AH5A 3T02A 3FOFA 3HOVC 3I4NC 3IPJA 5C3EC 1IE0A 4A3BC 3HOZK 1O26A 5IOSA 3S2HK 3S15C 2P8TA 2NVYK 2R92A 3G4AA 2O5IA 4XCHA 3BUEA 1ZBSA 4JK1A 3HOUK 3TFHA 2Y0SL 2O5JA 3Q3QA 3GTLC 1WCMK 3CQZC 4BY1C 3MMLB 4Q4ZA 3H0GK 1XXAA 4LQYA 4OINA 2JA6K 3TFJA 4A3MC 3K7AK 3GDZA 1TWAK 4PAAA 3GTJC 1VRQC 5M5YK 4G0VA 1EI6A 1JVIA 2RH6A 1Y1WK 1TWCK 5JVOA 4RMFA 2BE5A 3TFIA 3V4GA 1USMA 3GTGK 4GFQA 3S1QC 4C45A 1X31C 1J6XA 2R93A 3SZZA 4QIWL
chains in the Genus database with same CATH topology
2WB1L 5IYDC 3S1RK 4G7HA 5TMFA 5C4JC 4G7ZA 3WODA 2R7ZK 2JA8C 1I6VA 5M5XK 4A3CC 2PA8L 4G7OA 1I50C 2JA7K 2R93C 4YFXA 4A3KC 5IYBC 1TWGK 2E2JC 3S17C 3S1QK 2VUMK 1R9TC 3S14C 2E2HK 4C2MK 5IYCC 2NVTK 3M4OC 1ZYRA 4YFKA 2YU9C 3HOXK 4A3LK 4LK1A 5M5WK 5C4JK 1XPPA 5M3FK 4BBSC 4BBRC 3PO2K 4A3CK 1TWFC 2R93K 1I50K 4AYBL 5IYBK 3S17K 1I3QC 4KN7A 1R9TK 3EQLA 3S14K 2WAQD 3S1MC 3M4OK 4XLPA 2YU9K 5C4XC 4OIQA 2NVYC 5IP9C 4A3GK 4OIOA 3GTPC 5FJ8K 4Y52C 2NVQK 4BBRK 4BBSK 2JA5C 4ZH4A 1I3QK 2Y0SD 5TMCA 4GZYA 2PMZL 1TWHC 4Q5SA 3PO3C 3H3VD 4BY7C 4QIWD 1SFOC 5C4XK 3GTOC 3FKIC 2WB1D 2A68A 4C3HK 5IP9K 4XLNA 4QJVB 4A3IC 5IYDK 1IW7A 4A3DC 3GTPK 4LK0A 1TWAC 5C44C 2PA8D 2JA8K 4Y52K 1Y1VC 2B63K 4A3LC 2CW0A 4A3KK 3RZDC 2E2JK 3GTMC 3GTQC 5FLMC 3HOYC 3HOZC 1TWHK 3PO3K 3S2DC 4BY7K 5IYCK 4KMUA 3S2HC 1K83C 3GTKC 3FKIK 3GTOK 4XSZA 4NOIA 4A3IK 3DXJA 4C3JK 4OIRA 4A3DK 3HOVC 3HOUC 5C44K 3I4NC 4A93C 4A3JC 4AYBD 5C3EC 1TWFK 4Y7NC 1WCMC 3HOYK 5IP7C 4A3BC 3GTMK 3HKZL 4LLGA 4XSXA 5FLMK 4A3EC 2NVXC 3HOZK 4X6AC 3H0GC 3S1MK 1YNNA 4YFNA 3S2HK 3GTKK 3S15C 2NVYK 4MEYA 5M3MK 2JA6C 1BDFA 2O5IA 3K7AC 4LJZA 3M3YC 4BXXC 3HOVK 4JK1A 3HOUK 3I4NK 2Y0SL 4A3JK 3S16C 4A93K 3S1NC 2O5JA 5C3EK 3GTLC 4Y7NK 1WCMK 3CQZC 2JA5K 2PMZD 4BY1C 5IP7K 4A3BK 3RZOC 1Y1WC 4A3EK 1TWCC 2NVXK 4Q4ZA 4OIPA 2R92C 4X6AK 3H0GK 1I6HC 4A3FC 4KN4A 1SFOK 3I4MC 3S15K 3PO2C 1YNJA 3GTGC 4OINA 2JA6K 4A3MC 2E2IC 4BXXK 3K7AK 3M3YK 3HOWC 1TWAK 3GTJC 3S1NK 3S16K 1Y1VK 3GTLK 5M5YK 4YG2A 3CQZK 2WAQL 2PPBA 3RZDK 4BY1K 2B63C 3GTQK 1SMYA 3RZOK 1Y1WK 1TWCK 3S1RC 3S2DK 2A69A 2A6EA 2R92K 2R7ZC 4A3GC 1I6HK 4A3FK 3I4MK 1K83K 2BE5A 2NVQC 3GTGK 2JA7C 4C3IK 4MEXA 3S1QC 1TWGC 2A6HA 4A3MK 2E2IK 2VUMC 3HOWK 5D4DA 3GTJK 2E2HC 4QJVA 1HQMA 4MQ9A 2NVTC 3H3VL 3HKZD 3HOXC 4QIWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 L;  5IYD C;  3S1R K;  4G7H A;  5TMF A;  5C4J C;  4G7Z A;  3WOD A;  2R7Z K;  2JA8 C;  1I6V A;  5M5X K;  4A3C C;  2PA8 L;  4G7O A;  1I50 C;  2JA7 K;  2R93 C;  4YFX A;  4A3K C;  5IYB C;  1TWG K;  2E2J C;  3S17 C;  3S1Q K;  2VUM K;  1R9T C;  3S14 C;  2E2H K;  4C2M K;  5IYC C;  2NVT K;  3M4O C;  1ZYR A;  4YFK A;  2YU9 C;  3HOX K;  4A3L K;  4LK1 A;  5M5W K;  5C4J K;  1XPP A;  5M3F K;  4BBS C;  4BBR C;  3PO2 K;  4A3C K;  1TWF C;  2R93 K;  1I50 K;  4AYB L;  5IYB K;  3S17 K;  1I3Q C;  4KN7 A;  1R9T K;  3EQL A;  3S14 K;  2WAQ D;  3S1M C;  3M4O K;  4XLP A;  2YU9 K;  5C4X C;  4OIQ A;  2NVY C;  5IP9 C;  4A3G K;  4OIO A;  3GTP C;  5FJ8 K;  4Y52 C;  2NVQ K;  4BBR K;  4BBS K;  2JA5 C;  4ZH4 A;  1I3Q K;  2Y0S D;  5TMC A;  4GZY A;  2PMZ L;  1TWH C;  4Q5S A;  3PO3 C;  3H3V D;  4BY7 C;  4QIW D;  1SFO C;  5C4X K;  3GTO C;  3FKI C;  2WB1 D;  2A68 A;  4C3H K;  5IP9 K;  4XLN A;  4QJV B;  4A3I C;  5IYD K;  1IW7 A;  4A3D C;  3GTP K;  4LK0 A;  1TWA C;  5C44 C;  2PA8 D;  2JA8 K;  4Y52 K;  1Y1V C;  2B63 K;  4A3L C;  2CW0 A;  4A3K K;  3RZD C;  2E2J K;  3GTM C;  3GTQ C;  5FLM C;  3HOY C;  3HOZ C;  1TWH K;  3PO3 K;  3S2D C;  4BY7 K;  5IYC K;  4KMU A;  3S2H C;  1K83 C;  3GTK C;  3FKI K;  3GTO K;  4XSZ A;  4NOI A;  4A3I K;  3DXJ A;  4C3J K;  4OIR A;  4A3D K;  3HOV C;  3HOU C;  5C44 K;  3I4N C;  4A93 C;  4A3J C;  4AYB D;  5C3E C;  1TWF K;  4Y7N C;  1WCM C;  3HOY K;  5IP7 C;  4A3B C;  3GTM K;  3HKZ L;  4LLG A;  4XSX A;  5FLM K;  4A3E C;  2NVX C;  3HOZ K;  4X6A C;  3H0G C;  3S1M K;  1YNN A;  4YFN A;  3S2H K;  3GTK K;  3S15 C;  2NVY K;  4MEY A;  5M3M K;  2JA6 C;  1BDF A;  2O5I A;  3K7A C;  4LJZ A;  3M3Y C;  4BXX C;  3HOV K;  4JK1 A;  3HOU K;  3I4N K;  2Y0S L;  4A3J K;  3S16 C;  4A93 K;  3S1N C;  2O5J A;  5C3E K;  3GTL C;  4Y7N K;  1WCM K;  3CQZ C;  2JA5 K;  2PMZ D;  4BY1 C;  5IP7 K;  4A3B K;  3RZO C;  1Y1W C;  4A3E K;  1TWC C;  2NVX K;  4Q4Z A;  4OIP A;  2R92 C;  4X6A K;  3H0G K;  1I6H C;  4A3F C;  4KN4 A;  1SFO K;  3I4M C;  3S15 K;  3PO2 C;  1YNJ A;  3GTG C;  4OIN A;  2JA6 K;  4A3M C;  2E2I C;  4BXX K;  3K7A K;  3M3Y K;  3HOW C;  1TWA K;  3GTJ C;  3S1N K;  3S16 K;  1Y1V K;  3GTL K;  5M5Y K;  4YG2 A;  3CQZ K;  2WAQ L;  2PPB A;  3RZD K;  4BY1 K;  2B63 C;  3GTQ K;  1SMY A;  3RZO K;  1Y1W K;  1TWC K;  3S1R C;  3S2D K;  2A69 A;  2A6E A;  2R92 K;  2R7Z C;  4A3G C;  1I6H K;  4A3F K;  3I4M K;  1K83 K;  2BE5 A;  2NVQ C;  3GTG K;  2JA7 C;  4C3I K;  4MEX A;  3S1Q C;  1TWG C;  2A6H A;  4A3M K;  2E2I K;  2VUM C;  3HOW K;  5D4D A;  3GTJ K;  2E2H C;  4QJV A;  1HQM A;  4MQ9 A;  2NVT C;  3H3V L;  3HKZ D;  3HOX C;  4QIW L; 
#chains in the Genus database with same CATH topology
 3GEH A;  4G7H A;  5TMF A;  4G7Z A;  2R7Z K;  1BJT A;  5M5X K;  4A3C C;  2PA8 L;  4G7O A;  1I50 C;  2JA7 K;  1J6W A;  2VUM K;  1O2F B;  2E2H K;  2NVT K;  3VA7 A;  1B4B A;  1ISE A;  4KAT A;  3A8J A;  3PO2 K;  1AB4 A;  3S17 K;  4KN7 A;  3EQL A;  5HL8 A;  3M4O K;  4KMH A;  2NVY C;  3TTG A;  5IOT A;  4C3H C;  1ZQ1 C;  4A3G K;  1SFO A;  1WSV A;  1F7V A;  1DCO A;  1I3Q K;  2Y0S D;  3AD8 C;  1BS2 A;  4GTD A;  3PO3 C;  3L4K A;  5C4X K;  5IP9 K;  4XLN A;  5IYD K;  3T00 A;  4AH6 A;  4A3D C;  1TWA C;  2JA8 K;  1F9N A;  4A3K K;  2E2J K;  3HOY C;  5FLM C;  1VLO A;  4BY7 K;  5IYC K;  1IS1 A;  4KMU A;  3GTO K;  1F7U A;  3FHZ A;  4J3N A;  3BP3 A;  1JOE A;  4Y7N C;  3GSI A;  3GTM K;  1O28 A;  3GTL A;  3S1M K;  1XXB A;  1YNN A;  2FQO A;  3CQZ A;  4PAB A;  5JFE A;  3GTK K;  1BDF A;  4KMA A;  1O29 A;  4GTC A;  3S1N C;  4A93 K;  1JQW A;  4A3J K;  2PHC B;  3HXA A;  3S16 C;  1XZQ A;  4DDQ A;  5IP7 K;  3RZO C;  3GTJ A;  4A3E K;  2NVX K;  3OPF A;  4X6A K;  4A3F C;  3G4C A;  3PO2 C;  4C3I C;  4BXX K;  1WOP A;  3M3Y K;  1INN A;  1Y1V K;  1VJE A;  4KAS A;  3RZD K;  1SMY A;  3S0X A;  3S1R C;  4A3G C;  2R92 K;  3BP8 C;  1I6H K;  3I4M K;  3ERE D;  4MEX A;  1TWG C;  2A6H A;  5TJ3 A;  3SZY A;  2E2I K;  3HOW K;  3CAG A;  1I50 A;  1EQR A;  3HKZ D;  4A3L C;  2D6F C;  3GEI A;  5IYD C;  5C4J C;  3FKI A;  2JA8 C;  1WOS A;  2XCQ A;  4A3K C;  2E2J C;  3ADA C;  1DCP A;  1R9T C;  3S14 C;  4C2M K;  1J6V A;  5IYC C;  2RGR A;  2YU9 C;  3HOX K;  4FZB A;  5L46 A;  1XZQ B;  2NVY A;  4BBR C;  2R93 K;  1L0W A;  5IYB K;  4BLB A;  4GTE A;  3S1M C;  1PJ7 A;  3N0B A;  4OIO A;  5FJ8 K;  4BBS K;  2JA6 A;  4GZY A;  4KAR A;  1TWA A;  5TMC A;  1GE9 A;  3FKI C;  1IQ0 A;  2WB1 D;  2A68 A;  3GTP K;  4LK0 A;  3GTG A;  4Y52 K;  1Y1V C;  3AQO A;  4M1X A;  5EGE A;  2CW0 A;  3RZD C;  2KWA A;  3HOZ C;  1TWH K;  4ILD A;  1UV7 A;  3FOE A;  3S2H C;  4KB2 A;  4NOI A;  4GTA A;  4A3I K;  3DXJ A;  4C3J K;  3HOU C;  5C44 K;  1G51 A;  1TWF K;  1WCM C;  5IOQ A;  4GTF A;  3HKZ L;  4LLG A;  4XSX A;  3LAP A;  3H0G C;  4YFN A;  4MEY A;  1IBA A;  5M3M K;  2JA6 C;  4LJZ A;  1O2B A;  3AD7 C;  5CHP A;  3K7A C;  3ORE A;  3HOV K;  3I4N K;  3A8K A;  5C3E K;  2JA5 K;  4A3B K;  1Y1W C;  2JH3 A;  1TWC C;  3JST A;  4OIP A;  1WSR A;  1WOR A;  3S15 K;  1YNJ A;  3GTG C;  3GTL K;  1TWG A;  4YG2 A;  1I3Q A;  3CQZ K;  2PPB A;  2ZUF A;  4BY1 K;  2B63 C;  1VGX A;  3GTQ K;  2XCO A;  3S2D K;  2R7Z C;  1V5V A;  1O2A A;  4G0W A;  1K83 K;  1WQH A;  4BKW A;  2JA7 C;  4A3M K;  2VUM C;  5D4D A;  3GTJ K;  2E2H C;  4QJV A;  1HQM A;  1WOO A;  2NVT C;  4LR2 A;  1R9T A;  4P5A A;  4KDD A;  2WB1 L;  4WIL A;  2YU9 A;  1I6V A;  4YFX A;  3S1Q K;  1BGW A;  1USO A;  3S17 C;  1RU0 A;  4GT9 A;  4O2D A;  3N0C A;  3M4O C;  1ZYR A;  4KM9 A;  3GTM A;  1C0A A;  3AD9 C;  2ZUE A;  4LK1 A;  2ZFZ A;  1XPP A;  3GTK A;  1XXC A;  3N3Y A;  1TWF C;  4A3C K;  1I50 K;  1I3Q C;  1KQ4 A;  2WAQ D;  5C4X C;  3GEE A;  5IP9 C;  1ZXO A;  1WIH A;  2W7V A;  1F93 A;  3AQP A;  2NVQ K;  1PJ5 A;  2GAH C;  2JA5 C;  2V6T A;  4ZH4 A;  4Q5S A;  1Y1V A;  3H3V D;  4BY7 C;  3GTO C;  4C3H K;  4QJV B;  3GIR A;  2GSN A;  2B63 K;  1XZP A;  2E2I A;  2CFA A;  3GTQ C;  2GSU A;  5EGH A;  2XCR B;  3GTM C;  1O24 A;  1O27 A;  3PO3 K;  3S2D C;  1WCM A;  5IOR A;  1K83 C;  3GTK C;  3LAJ A;  4XSZ A;  1VH2 A;  2FQT A;  3H0G A;  3OEP A;  3QX3 A;  4OIR A;  1YCL A;  4A3D K;  4A93 C;  4A3J C;  4P5B A;  4AYB D;  3HOY K;  5IP7 C;  2GSO A;  5FLM K;  4A3E C;  2NVX C;  4BLA A;  4LOW A;  4X6A C;  1IL2 A;  1Y1W A;  5CJ9 A;  3LPX A;  1TWC A;  4BXX C;  3M3Y C;  4P9S A;  4Y7N K;  2PMZ D;  1WQF A;  2R92 C;  1I6H C;  1SFO K;  4KN4 A;  3I4M C;  1O25 A;  2B63 A;  2EBB A;  3T01 A;  4KAW X;  4KB4 A;  2R7Z A;  2E2I C;  3HOW C;  1EK8 A;  4KMD A;  3S1N K;  2Y3P A;  3S16 K;  2P5M A;  2JA7 A;  2WAQ L;  2VUM A;  3RZO K;  2E2H A;  2GAG C;  2A69 A;  2A6E A;  1XZP B;  2CFA B;  4FM9 A;  1DCH A;  4A3F K;  2NVQ C;  4C3I K;  3GTP A;  1WQG A;  3NUH A;  4C2M C;  4MQ9 A;  3H3V L;  3HOX C;  1TWH A;  3S1R K;  3WOD A;  2R93 C;  5IYB C;  1TWG K;  1YX2 A;  1TWF A;  4YFK A;  4A3L K;  5M5W K;  5C4J K;  5M3F K;  4WJ3 M;  4BBS C;  1DD5 A;  4AYB L;  3L4J A;  1R9T K;  3S14 K;  1HI9 A;  2JA5 A;  3A8I A;  4XLP A;  2YU9 K;  4OIQ A;  4KC6 A;  3GTP C;  3GTO A;  4Y52 C;  4BBR K;  4GTL A;  4WJ4 A;  1J98 A;  2PMZ L;  1TWH C;  4KM8 A;  4QIW D;  1SFO C;  3GTQ A;  1PJ6 A;  1ZVU A;  1EH1 A;  4GTB A;  4A3I C;  4C3J C;  1IW7 A;  1K83 A;  5C44 C;  2PA8 D;  1B4A A;  5E68 A;  2V6S A;  1EFW A;  3FKI K;  4G0U A;  2NVX A;  2V6U A;  3AH5 A;  3T02 A;  3FOF A;  3HOV C;  3I4N C;  3IPJ A;  5C3E C;  1IE0 A;  4A3B C;  3HOZ K;  1O26 A;  5IOS A;  3S2H K;  3S15 C;  2P8T A;  2NVY K;  2R92 A;  3G4A A;  2O5I A;  4XCH A;  3BUE A;  1ZBS A;  4JK1 A;  3HOU K;  3TFH A;  2Y0S L;  2O5J A;  3Q3Q A;  3GTL C;  1WCM K;  3CQZ C;  4BY1 C;  3MML B;  4Q4Z A;  3H0G K;  1XXA A;  4LQY A;  4OIN A;  2JA6 K;  3TFJ A;  4A3M C;  3K7A K;  3GDZ A;  1TWA K;  4PAA A;  3GTJ C;  1VRQ C;  5M5Y K;  4G0V A;  1EI6 A;  1JVI A;  2RH6 A;  1Y1W K;  1TWC K;  5JVO A;  4RMF A;  2BE5 A;  3TFI A;  3V4G A;  1USM A;  3GTG K;  4GFQ A;  3S1Q C;  4C45 A;  1X31 C;  1J6X A;  2R93 A;  3SZZ A;  4QIW L; 
#chains in the Genus database with same CATH homology
 2WB1 L;  5IYD C;  3S1R K;  4G7H A;  5TMF A;  5C4J C;  4G7Z A;  3WOD A;  2R7Z K;  2JA8 C;  1I6V A;  5M5X K;  4A3C C;  2PA8 L;  4G7O A;  1I50 C;  2JA7 K;  2R93 C;  4YFX A;  4A3K C;  5IYB C;  1TWG K;  2E2J C;  3S17 C;  3S1Q K;  2VUM K;  1R9T C;  3S14 C;  2E2H K;  4C2M K;  5IYC C;  2NVT K;  3M4O C;  1ZYR A;  4YFK A;  2YU9 C;  3HOX K;  4A3L K;  4LK1 A;  5M5W K;  5C4J K;  1XPP A;  5M3F K;  4BBS C;  4BBR C;  3PO2 K;  4A3C K;  1TWF C;  2R93 K;  1I50 K;  4AYB L;  5IYB K;  3S17 K;  1I3Q C;  4KN7 A;  1R9T K;  3EQL A;  3S14 K;  2WAQ D;  3S1M C;  3M4O K;  4XLP A;  2YU9 K;  5C4X C;  4OIQ A;  2NVY C;  5IP9 C;  4A3G K;  4OIO A;  3GTP C;  5FJ8 K;  4Y52 C;  2NVQ K;  4BBR K;  4BBS K;  2JA5 C;  4ZH4 A;  1I3Q K;  2Y0S D;  5TMC A;  4GZY A;  2PMZ L;  1TWH C;  4Q5S A;  3PO3 C;  3H3V D;  4BY7 C;  4QIW D;  1SFO C;  5C4X K;  3GTO C;  3FKI C;  2WB1 D;  2A68 A;  4C3H K;  5IP9 K;  4XLN A;  4QJV B;  4A3I C;  5IYD K;  1IW7 A;  4A3D C;  3GTP K;  4LK0 A;  1TWA C;  5C44 C;  2PA8 D;  2JA8 K;  4Y52 K;  1Y1V C;  2B63 K;  4A3L C;  2CW0 A;  4A3K K;  3RZD C;  2E2J K;  3GTM C;  3GTQ C;  5FLM C;  3HOY C;  3HOZ C;  1TWH K;  3PO3 K;  3S2D C;  4BY7 K;  5IYC K;  4KMU A;  3S2H C;  1K83 C;  3GTK C;  3FKI K;  3GTO K;  4XSZ A;  4NOI A;  4A3I K;  3DXJ A;  4C3J K;  4OIR A;  4A3D K;  3HOV C;  3HOU C;  5C44 K;  3I4N C;  4A93 C;  4A3J C;  4AYB D;  5C3E C;  1TWF K;  4Y7N C;  1WCM C;  3HOY K;  5IP7 C;  4A3B C;  3GTM K;  3HKZ L;  4LLG A;  4XSX A;  5FLM K;  4A3E C;  2NVX C;  3HOZ K;  4X6A C;  3H0G C;  3S1M K;  1YNN A;  4YFN A;  3S2H K;  3GTK K;  3S15 C;  2NVY K;  4MEY A;  5M3M K;  2JA6 C;  1BDF A;  2O5I A;  3K7A C;  4LJZ A;  3M3Y C;  4BXX C;  3HOV K;  4JK1 A;  3HOU K;  3I4N K;  2Y0S L;  4A3J K;  3S16 C;  4A93 K;  3S1N C;  2O5J A;  5C3E K;  3GTL C;  4Y7N K;  1WCM K;  3CQZ C;  2JA5 K;  2PMZ D;  4BY1 C;  5IP7 K;  4A3B K;  3RZO C;  1Y1W C;  4A3E K;  1TWC C;  2NVX K;  4Q4Z A;  4OIP A;  2R92 C;  4X6A K;  3H0G K;  1I6H C;  4A3F C;  4KN4 A;  1SFO K;  3I4M C;  3S15 K;  3PO2 C;  1YNJ A;  3GTG C;  4OIN A;  2JA6 K;  4A3M C;  2E2I C;  4BXX K;  3K7A K;  3M3Y K;  3HOW C;  1TWA K;  3GTJ C;  3S1N K;  3S16 K;  1Y1V K;  3GTL K;  5M5Y K;  4YG2 A;  3CQZ K;  2WAQ L;  2PPB A;  3RZD K;  4BY1 K;  2B63 C;  3GTQ K;  1SMY A;  3RZO K;  1Y1W K;  1TWC K;  3S1R C;  3S2D K;  2A69 A;  2A6E A;  2R92 K;  2R7Z C;  4A3G C;  1I6H K;  4A3F K;  3I4M K;  1K83 K;  2BE5 A;  2NVQ C;  3GTG K;  2JA7 C;  4C3I K;  4MEX A;  3S1Q C;  1TWG C;  2A6H A;  4A3M K;  2E2I K;  2VUM C;  3HOW K;  5D4D A;  3GTJ K;  2E2H C;  4QJV A;  1HQM A;  4MQ9 A;  2NVT C;  3H3V L;  3HKZ D;  3HOX C;  4QIW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...