4A3IK

Rna polymerase ii binary complex with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3iK00
5IYBK 4A3GK 4A3FK 3H3VL 2R7ZC 2BE5A 4A3IK 1I6VA 4LK0A 5M3FK 4A3FC 4A3GC 1Y1VK 4A3KK 1BDFA 4A3IC 3WODA 4A3CK 1Y1VC 1TWGK 4A3KC 2PA8L 4A3CC 4QJVA 5C4XK 5M5WK 2NVTK 3S16C 3M4OK 1IW7A 4QIWD 4AYBD 1TWAK 4XSZA 5C4XC 2NVTC 3M4OC 4BY7K 4KN4A 2R7ZK 4LJZA 2NVXK 1TWAC 5C4JK 4BY1K 3S15K 4GZYA 4QJVB 2NVXC 2B63K 5C4JC 4BY1C 2WB1D 1YNNA 3HOXK 3S15C 5IYDK 4JK1A 4A3LK 4KN7A 4A93K 4OINA 2B63C 3DXJA 3GTJK 3HOXC 5IYDC 3S1RK 4Q4ZA 4A3LC 2PMZL 1HQMA 3I4NK 3HOZK 4A93C 4Y7NK 3GTJC 4XLPA 3PO2K 3S1RC 1K83K 2VUMK 3HKZL 2R92K 3HOZC 3I4NC 3EQLA 4Y7NC 1TWCK 4C2MK 2E2JC 1XPPA 3H3VD 3PO2C 1K83C 3S2HK 4MQ9A 2VUMC 4Y52C 4C3JK 2R92C 3S1NK 1TWCC 3S2HC 4X6AK 4BXXK 3S16K 2Y0SL 3HOYK 3I4MK 3S1NC 4X6AC 4OIOA 3RZOK 4BXXC 3S1QK 5TMCA 2PA8D 3HOYC 3I4MC 4XSXA 4NOIA 3RZOC 3S1QC 2NVYK 3HOWC 4BBSK 5TMFA 4OIPA 4Q5SA 2WAQL 3CQZK 2NVYC 2PPBA 3GTQC 4BBSC 1I3QK 2NVQK 5D4DA 3HOVC 3CQZC 4G7OA 2A6HA 4KMUA 3GTOK 5FLMK 1I3QC 2NVQC 1I6HK 2JA8K 5IP7K 5M5XK 3GTOC 5FLMC 1I6HC 2JA8C 4A3DK 5M3MK 5IP7C 4A3JK 3FKIK 2E2JK 2O5IA 1I50C 2PMZD 3S14K 4A3DC 4A3JC 4A3BK 3FKIC 4QIWL 1R9TK 3HKZD 5C3EK 3GTPK 3S14C 4A3BC 1R9TC 4YG2A 5C3EC 3GTPC 3HOWK 2Y0SD 3S17K 3HOUC 1YNJA 4YFXA 3RZDK 3GTMK 4C3IK 1ZYRA 3GTQK 4XLNA 4A3MK 2E2IK 1TWHK 5IYCK 3S17C 3RZDC 3GTMC 4OIQA 3PO3K 3K7AK 4A3MC 2E2HK 2A69A 1TWHC 2WAQD 5IYCC 2E2IC 2JA6K 2A68A 2YU9K 1SMYA 1Y1WK 3GTGK 3K7AC 3PO3C 2E2HC 5IYBC 2JA6C 2YU9C 1Y1WC 3GTGC 3H0GK 1I50K 3M3YK 4MEXA 2A6EA 1TWFK 3S2DK 3H0GC 3M3YC 3GTKK 5M5YK 1WCMK 4BBRK 4AYBL 1TWFC 1TWGC 5FJ8K 4OIRA 3S2DC 3GTKC 1WCMC 4LK1A 4BBRC 4ZH4A 4Y52K 4LLGA 2JA7K 2CW0A 3S1MK 4MEYA 4A3EK 2JA5K 3HOUK 5C44K 2WB1L 2JA7C 3GTLK 3S1MC 4BY7C 2O5JA 4A3EC 4G7HA 4YFKA 2JA5C 2R93K 5C44C 5IP9K 3GTLC 4G7ZA 1SFOK 3HOVK 4C3HK 4YFNA 2R93C 5IP9C 1SFOC
chains in the Genus database with same CATH superfamily
4GTDA 4A3GK 3H3VL 3GTLA 4A3FC 1EI6A 2XCQA 4A3IC 3TFJA 3GEEA 3WODA 1Y1VC 1TWGK 3NUHA 2PA8L 4A3CC 1IQ0A 5C4XK 1IE0A 4AYBD 1AB4A 2NVTC 2R92A 1EQRA 1TWCA 4ILDA 2NVXC 4WJ3M 5C4JC 1WIHA 4KN7A 4DDQA 4KMDA 2B63C 3GEIA 2PMZL 1HQMA 3I4NK 2NVYA 3ERED 3HOZK 2ZUEA 1O24A 3TFIA 3S1RC 3HKZL 2R92K 3EQLA 1TWCK 3A8JA 3H3VD 4GTLA 2VUMC 1O2BA 4BXXK 3S16K 2Y0SL 4C3JC 3I4MK 3S1NC 1PJ5A 1ZXOA 4OIOA 3TFHA 5TMCA 2PA8D 3HOYC 1K83A 5CHPA 2NVYK 4GTCA 4J3NA 1R9TA 1I3QK 4GTAA 2GAGC 5FLMK 5IOSA 3FKIK 2PMZD 4A3DC 1R9TK 2JA6A 3HKZD 2YU9A 1WQGA 2EBBA 4YG2A 4KARA 5C3EC 3GTPC 1I50A 2GSOA 3AQPA 2Y0SD 1YNJA 3RZDK 3GTMK 4KM8A 1DD5A 3BUEA 4A3MK 3S17C 1JVIA 3JSTA 1UV7A 4OIQA 3AQOA 1TWHC 2JA6K 2JA7A 1XZPA 2A68A 2YU9K 1VLOA 1Y1WK 3PO3C 4G0VA 3K7AC 1IL2A 1I50K 1G51A 4KATA 1WOOA 3OEPA 3M3YC 4LR2A 1XZPB 4KASA 1TWFC 3S2DC 5FJ8K 3T01A 4LK1A 4ZH4A 2CFAA 4LLGA 2JA7K 1Y1VA 4MEYA 3H0GA 5C44K 2WB1L 3S1MC 4A3EC 1WSVA 2JA5C 3V4GA 4PAAA 4G7ZA 3HOVK 2R93C 4WILA 2CFAB 1B4AA 1SFOC 5IYBK 4A3FK 1DCHA 2R7ZC 2NVXA 4A3IK 1Y1VK 3HXAA 1BDFA 2B63A 4A3CK 3LAPA 4C2MC 4KB4A 1XXBA 4QJVA 2V6TA 2NVTK 4XSZA 2VUMA 4KC6A 3M4OC 4BY7K 2NVXK 5C4JK 3GSIA 3ADAC 4QJVB 5IORA 2B63K 3S15C 2WB1D 4G0UA 3HOXC 3GDZA 3S1RK 4A3LC 3AD7C 3GTJC 2VUMK 2ZUFA 4Y7NC 2P8TA 1XPPA 4GTBA 4C3JK 3S1NK 3HOYK 1F93A 3QX3A 2GSNA 5JFEA 1EH1A 4XSXA 4BLAA 3S1QC 3HOWC 1XZQB 5TMFA 3GTPA 4BBSC 5D4DA 3CQZC 4KMUA 1O28A 4AH6A 2NVQC 5M5XK 4BKWA 2RH6A 1I6HC 4A3DK 3LPXA 3GTQA 2E2JK 1WORA 1TWHA 5EGEA 4QIWL 1I3QA 5EGHA 3A8IA 1RU0A 5C3EK 3GTPK 1O25A 4BLBA 3Q3QA 1YCLA 3FKIA 1TWFA 3S17K 3GTQK 1TWHK 4C3IC 3PO3K 3K7AK 2A69A 2E2IC 3OPFA 2JA5A 2GAHC 2E2HC 3GTGC 4P5AA 5IOQA 3M3YK 3GTMA 2PHCB 1SFOA 1TWFK 3S2DK 1VH2A 1WQHA 5M5YK 2R7ZA 1TWGC 4OIRA 3GTKC 1ISEA 1WCMC 1Y1WA 4LQYA 1VRQC 1J98A 3S1MK 2W7VA 4A3EK 2JA5K 3HOUK 2FQOA 1O2AA 2R93K 3GTLC 1V5VA 1SFOK 5IP9C 5HL8A 2R7ZK 4C3HC 3S0XA 3AD8C 1HI9A 1ZBSA 4P9SA 5IOTA 2BE5A 5CJ9A 3BP3A 4LK0A 5M3FK 1YX2A 4A3KC 4WJ4A 3S16C 3M4OK 3N0BA 3GEHA 4XCHA 4KN4A 4LJZA 1TWAC 3S15K 4G0WA 2V6SA 4BY1C 1WQFA 3HOXK 1EK8A 4A3LK 3CAGA 4OINA 3DXJA 3GTJK 5IYDC 4Q4ZA 4A93C 4Y7NK 4XLPA 1WOPA 3PO2C 1IS1A 1K83C 1O29A 4Y52C 3S2HC 1VJEA 4X6AC 2KWAA 2V6UA 3S1QK 3T00A 3RZOC 1PJ6A 1INNA 4BBSK 4Q5SA 3G4AA 3CQZK 1B4BA 2PPBA 4KAWX 2NVQK 4G7OA 2A6HA 1I6HK 1WOSA 3GTOC 2JA8C 5M3MK 5IP7C 2E2IA 1I50C 4KM9A 4A3JC 3AH5A 1XZQA 3S14C 1WSRA 4A3BC 3LAJA 3T02A 2GSUA 1BGWA 5E68A 4LOWA 1J6XA 2FQTA 3GIRA 3GTKA 4YFXA 1O26A 1WCMA 4C3IK 4XLNA 2E2IK 1J6VA 1X31C 1O27A 3IPJA 2E2HK 5IYCC 1XXAA 4M1XA 3GTGK 3FHZA 5IYBC 4MEXA 3H0GC 3GTKK 1WCMK 4BBRC 1C0AA 1J6WA 2ZFZA 3GTLK 4BY7C 4G7HA 4YFKA 5IP9K 4RMFA 4C3HK 4FM9A 1TWAA 3L4JA 4PABA 2XCOA 1I6VA 3N0CA 4A3GC 1XXCA 4A3KK 2R93A 5L46A 3VA7A 4GTFA 1DCPA 5M5WK 4GT9A 1IW7A 4QIWD 1USMA 1TWAK 3SZYA 5C4XC 2XCRB 1PJ7A 1USOA 4BY1K 4GZYA 1O2FB 4KDDA 3TTGA 1YNNA 1F7VA 5IYDK 4JK1A 4A93K 2P5MA 3PO2K 1K83K 3N3YA 3I4NC 3HOZC 4Y52K 3S2HK 4C2MK 2E2JC 4MQ9A 2R92C 1IBAA 3GTOA 1TWCC 4X6AK 1GE9A 3GTJA 3RZOK 4BXXC 3I4MC 3A8KA 4NOIA 4OIPA 1JOEA 2WAQL 2NVYC 1ZQ1C 1JQWA 1EFWA 3GTQC 3L4KA 3GTOK 1BS2A 4GFQA 1I3QC 3G4CA 3FOEA 2JA8K 4O2DA 5IP7K 5FLMC 1DCOA 1KQ4A 4A3JK 1BJTA 2O5IA 3SZZA 3BP8C 3FOFA 3CQZA 4KMAA 3S14K 4A3BK 3FKIC 4GTEA 1R9TC 1ZVUA 3HOWK 4FZBA 3HOUC 5JVOA 1ZYRA 5IYCK 3RZDC 3OREA 3GTMC 4A3MC 2WAQD 1SMYA 2JA6C 4KMHA 3MMLB 2YU9C 4KB2A 1Y1WC 3H0GK 2A6EA 1VGXA 5TJ3A 4BBRK 4AYBL 2E2HA 4C45A 3GTGA 1L0WA 2CW0A 2JH3A 2JA7C 2O5JA 3AD9C 2RGRA 4P5BA 1TWGA 1F7UA 2D6FC 5C44C 1F9NA 4YFNA 2Y3PA 3HOVC
chains in the Genus database with same CATH topology
5IYBK 4A3GK 4A3FK 3H3VL 2R7ZC 2BE5A 4A3IK 1I6VA 4LK0A 5M3FK 4A3FC 4A3GC 1Y1VK 4A3KK 1BDFA 4A3IC 3WODA 4A3CK 1Y1VC 1TWGK 4A3KC 2PA8L 4A3CC 4QJVA 5C4XK 5M5WK 2NVTK 3S16C 3M4OK 1IW7A 4QIWD 4AYBD 1TWAK 4XSZA 5C4XC 2NVTC 3M4OC 4BY7K 4KN4A 2R7ZK 4LJZA 2NVXK 1TWAC 5C4JK 4BY1K 3S15K 4GZYA 4QJVB 2NVXC 2B63K 5C4JC 4BY1C 2WB1D 1YNNA 3HOXK 3S15C 5IYDK 4JK1A 4A3LK 4KN7A 4A93K 4OINA 2B63C 3DXJA 3GTJK 3HOXC 5IYDC 3S1RK 4Q4ZA 4A3LC 2PMZL 1HQMA 3I4NK 3HOZK 4A93C 4Y7NK 3GTJC 4XLPA 3PO2K 3S1RC 1K83K 2VUMK 3HKZL 2R92K 3HOZC 3I4NC 3EQLA 4Y7NC 1TWCK 4C2MK 2E2JC 1XPPA 3H3VD 3PO2C 1K83C 3S2HK 4MQ9A 2VUMC 4Y52C 4C3JK 2R92C 3S1NK 1TWCC 3S2HC 4X6AK 4BXXK 3S16K 2Y0SL 3HOYK 3I4MK 3S1NC 4X6AC 4OIOA 3RZOK 4BXXC 3S1QK 5TMCA 2PA8D 3HOYC 3I4MC 4XSXA 4NOIA 3RZOC 3S1QC 2NVYK 3HOWC 4BBSK 5TMFA 4OIPA 4Q5SA 2WAQL 3CQZK 2NVYC 2PPBA 3GTQC 4BBSC 1I3QK 2NVQK 5D4DA 3HOVC 3CQZC 4G7OA 2A6HA 4KMUA 3GTOK 5FLMK 1I3QC 2NVQC 1I6HK 2JA8K 5IP7K 5M5XK 3GTOC 5FLMC 1I6HC 2JA8C 4A3DK 5M3MK 5IP7C 4A3JK 3FKIK 2E2JK 2O5IA 1I50C 2PMZD 3S14K 4A3DC 4A3JC 4A3BK 3FKIC 4QIWL 1R9TK 3HKZD 5C3EK 3GTPK 3S14C 4A3BC 1R9TC 4YG2A 5C3EC 3GTPC 3HOWK 2Y0SD 3S17K 3HOUC 1YNJA 4YFXA 3RZDK 3GTMK 4C3IK 1ZYRA 3GTQK 4XLNA 4A3MK 2E2IK 1TWHK 5IYCK 3S17C 3RZDC 3GTMC 4OIQA 3PO3K 3K7AK 4A3MC 2E2HK 2A69A 1TWHC 2WAQD 5IYCC 2E2IC 2JA6K 2A68A 2YU9K 1SMYA 1Y1WK 3GTGK 3K7AC 3PO3C 2E2HC 5IYBC 2JA6C 2YU9C 1Y1WC 3GTGC 3H0GK 1I50K 3M3YK 4MEXA 2A6EA 1TWFK 3S2DK 3H0GC 3M3YC 3GTKK 5M5YK 1WCMK 4BBRK 4AYBL 1TWFC 1TWGC 5FJ8K 4OIRA 3S2DC 3GTKC 1WCMC 4LK1A 4BBRC 4ZH4A 4Y52K 4LLGA 2JA7K 2CW0A 3S1MK 4MEYA 4A3EK 2JA5K 3HOUK 5C44K 2WB1L 2JA7C 3GTLK 3S1MC 4BY7C 2O5JA 4A3EC 4G7HA 4YFKA 2JA5C 2R93K 5C44C 5IP9K 3GTLC 4G7ZA 1SFOK 3HOVK 4C3HK 4YFNA 2R93C 5IP9C 1SFOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB K;  4A3G K;  4A3F K;  3H3V L;  2R7Z C;  2BE5 A;  4A3I K;  1I6V A;  4LK0 A;  5M3F K;  4A3F C;  4A3G C;  1Y1V K;  4A3K K;  1BDF A;  4A3I C;  3WOD A;  4A3C K;  1Y1V C;  1TWG K;  4A3K C;  2PA8 L;  4A3C C;  4QJV A;  5C4X K;  5M5W K;  2NVT K;  3S16 C;  3M4O K;  1IW7 A;  4QIW D;  4AYB D;  1TWA K;  4XSZ A;  5C4X C;  2NVT C;  3M4O C;  4BY7 K;  4KN4 A;  2R7Z K;  4LJZ A;  2NVX K;  1TWA C;  5C4J K;  4BY1 K;  3S15 K;  4GZY A;  4QJV B;  2NVX C;  2B63 K;  5C4J C;  4BY1 C;  2WB1 D;  1YNN A;  3HOX K;  3S15 C;  5IYD K;  4JK1 A;  4A3L K;  4KN7 A;  4A93 K;  4OIN A;  2B63 C;  3DXJ A;  3GTJ K;  3HOX C;  5IYD C;  3S1R K;  4Q4Z A;  4A3L C;  2PMZ L;  1HQM A;  3I4N K;  3HOZ K;  4A93 C;  4Y7N K;  3GTJ C;  4XLP A;  3PO2 K;  3S1R C;  1K83 K;  2VUM K;  3HKZ L;  2R92 K;  3HOZ C;  3I4N C;  3EQL A;  4Y7N C;  1TWC K;  4C2M K;  2E2J C;  1XPP A;  3H3V D;  3PO2 C;  1K83 C;  3S2H K;  4MQ9 A;  2VUM C;  4Y52 C;  4C3J K;  2R92 C;  3S1N K;  1TWC C;  3S2H C;  4X6A K;  4BXX K;  3S16 K;  2Y0S L;  3HOY K;  3I4M K;  3S1N C;  4X6A C;  4OIO A;  3RZO K;  4BXX C;  3S1Q K;  5TMC A;  2PA8 D;  3HOY C;  3I4M C;  4XSX A;  4NOI A;  3RZO C;  3S1Q C;  2NVY K;  3HOW C;  4BBS K;  5TMF A;  4OIP A;  4Q5S A;  2WAQ L;  3CQZ K;  2NVY C;  2PPB A;  3GTQ C;  4BBS C;  1I3Q K;  2NVQ K;  5D4D A;  3HOV C;  3CQZ C;  4G7O A;  2A6H A;  4KMU A;  3GTO K;  5FLM K;  1I3Q C;  2NVQ C;  1I6H K;  2JA8 K;  5IP7 K;  5M5X K;  3GTO C;  5FLM C;  1I6H C;  2JA8 C;  4A3D K;  5M3M K;  5IP7 C;  4A3J K;  3FKI K;  2E2J K;  2O5I A;  1I50 C;  2PMZ D;  3S14 K;  4A3D C;  4A3J C;  4A3B K;  3FKI C;  4QIW L;  1R9T K;  3HKZ D;  5C3E K;  3GTP K;  3S14 C;  4A3B C;  1R9T C;  4YG2 A;  5C3E C;  3GTP C;  3HOW K;  2Y0S D;  3S17 K;  3HOU C;  1YNJ A;  4YFX A;  3RZD K;  3GTM K;  4C3I K;  1ZYR A;  3GTQ K;  4XLN A;  4A3M K;  2E2I K;  1TWH K;  5IYC K;  3S17 C;  3RZD C;  3GTM C;  4OIQ A;  3PO3 K;  3K7A K;  4A3M C;  2E2H K;  2A69 A;  1TWH C;  2WAQ D;  5IYC C;  2E2I C;  2JA6 K;  2A68 A;  2YU9 K;  1SMY A;  1Y1W K;  3GTG K;  3K7A C;  3PO3 C;  2E2H C;  5IYB C;  2JA6 C;  2YU9 C;  1Y1W C;  3GTG C;  3H0G K;  1I50 K;  3M3Y K;  4MEX A;  2A6E A;  1TWF K;  3S2D K;  3H0G C;  3M3Y C;  3GTK K;  5M5Y K;  1WCM K;  4BBR K;  4AYB L;  1TWF C;  1TWG C;  5FJ8 K;  4OIR A;  3S2D C;  3GTK C;  1WCM C;  4LK1 A;  4BBR C;  4ZH4 A;  4Y52 K;  4LLG A;  2JA7 K;  2CW0 A;  3S1M K;  4MEY A;  4A3E K;  2JA5 K;  3HOU K;  5C44 K;  2WB1 L;  2JA7 C;  3GTL K;  3S1M C;  4BY7 C;  2O5J A;  4A3E C;  4G7H A;  4YFK A;  2JA5 C;  2R93 K;  5C44 C;  5IP9 K;  3GTL C;  4G7Z A;  1SFO K;  3HOV K;  4C3H K;  4YFN A;  2R93 C;  5IP9 C;  1SFO C; 
#chains in the Genus database with same CATH topology
 4GTD A;  4A3G K;  3H3V L;  3GTL A;  4A3F C;  1EI6 A;  2XCQ A;  4A3I C;  3TFJ A;  3GEE A;  3WOD A;  1Y1V C;  1TWG K;  3NUH A;  2PA8 L;  4A3C C;  1IQ0 A;  5C4X K;  1IE0 A;  4AYB D;  1AB4 A;  2NVT C;  2R92 A;  1EQR A;  1TWC A;  4ILD A;  2NVX C;  4WJ3 M;  5C4J C;  1WIH A;  4KN7 A;  4DDQ A;  4KMD A;  2B63 C;  3GEI A;  2PMZ L;  1HQM A;  3I4N K;  2NVY A;  3ERE D;  3HOZ K;  2ZUE A;  1O24 A;  3TFI A;  3S1R C;  3HKZ L;  2R92 K;  3EQL A;  1TWC K;  3A8J A;  3H3V D;  4GTL A;  2VUM C;  1O2B A;  4BXX K;  3S16 K;  2Y0S L;  4C3J C;  3I4M K;  3S1N C;  1PJ5 A;  1ZXO A;  4OIO A;  3TFH A;  5TMC A;  2PA8 D;  3HOY C;  1K83 A;  5CHP A;  2NVY K;  4GTC A;  4J3N A;  1R9T A;  1I3Q K;  4GTA A;  2GAG C;  5FLM K;  5IOS A;  3FKI K;  2PMZ D;  4A3D C;  1R9T K;  2JA6 A;  3HKZ D;  2YU9 A;  1WQG A;  2EBB A;  4YG2 A;  4KAR A;  5C3E C;  3GTP C;  1I50 A;  2GSO A;  3AQP A;  2Y0S D;  1YNJ A;  3RZD K;  3GTM K;  4KM8 A;  1DD5 A;  3BUE A;  4A3M K;  3S17 C;  1JVI A;  3JST A;  1UV7 A;  4OIQ A;  3AQO A;  1TWH C;  2JA6 K;  2JA7 A;  1XZP A;  2A68 A;  2YU9 K;  1VLO A;  1Y1W K;  3PO3 C;  4G0V A;  3K7A C;  1IL2 A;  1I50 K;  1G51 A;  4KAT A;  1WOO A;  3OEP A;  3M3Y C;  4LR2 A;  1XZP B;  4KAS A;  1TWF C;  3S2D C;  5FJ8 K;  3T01 A;  4LK1 A;  4ZH4 A;  2CFA A;  4LLG A;  2JA7 K;  1Y1V A;  4MEY A;  3H0G A;  5C44 K;  2WB1 L;  3S1M C;  4A3E C;  1WSV A;  2JA5 C;  3V4G A;  4PAA A;  4G7Z A;  3HOV K;  2R93 C;  4WIL A;  2CFA B;  1B4A A;  1SFO C;  5IYB K;  4A3F K;  1DCH A;  2R7Z C;  2NVX A;  4A3I K;  1Y1V K;  3HXA A;  1BDF A;  2B63 A;  4A3C K;  3LAP A;  4C2M C;  4KB4 A;  1XXB A;  4QJV A;  2V6T A;  2NVT K;  4XSZ A;  2VUM A;  4KC6 A;  3M4O C;  4BY7 K;  2NVX K;  5C4J K;  3GSI A;  3ADA C;  4QJV B;  5IOR A;  2B63 K;  3S15 C;  2WB1 D;  4G0U A;  3HOX C;  3GDZ A;  3S1R K;  4A3L C;  3AD7 C;  3GTJ C;  2VUM K;  2ZUF A;  4Y7N C;  2P8T A;  1XPP A;  4GTB A;  4C3J K;  3S1N K;  3HOY K;  1F93 A;  3QX3 A;  2GSN A;  5JFE A;  1EH1 A;  4XSX A;  4BLA A;  3S1Q C;  3HOW C;  1XZQ B;  5TMF A;  3GTP A;  4BBS C;  5D4D A;  3CQZ C;  4KMU A;  1O28 A;  4AH6 A;  2NVQ C;  5M5X K;  4BKW A;  2RH6 A;  1I6H C;  4A3D K;  3LPX A;  3GTQ A;  2E2J K;  1WOR A;  1TWH A;  5EGE A;  4QIW L;  1I3Q A;  5EGH A;  3A8I A;  1RU0 A;  5C3E K;  3GTP K;  1O25 A;  4BLB A;  3Q3Q A;  1YCL A;  3FKI A;  1TWF A;  3S17 K;  3GTQ K;  1TWH K;  4C3I C;  3PO3 K;  3K7A K;  2A69 A;  2E2I C;  3OPF A;  2JA5 A;  2GAH C;  2E2H C;  3GTG C;  4P5A A;  5IOQ A;  3M3Y K;  3GTM A;  2PHC B;  1SFO A;  1TWF K;  3S2D K;  1VH2 A;  1WQH A;  5M5Y K;  2R7Z A;  1TWG C;  4OIR A;  3GTK C;  1ISE A;  1WCM C;  1Y1W A;  4LQY A;  1VRQ C;  1J98 A;  3S1M K;  2W7V A;  4A3E K;  2JA5 K;  3HOU K;  2FQO A;  1O2A A;  2R93 K;  3GTL C;  1V5V A;  1SFO K;  5IP9 C;  5HL8 A;  2R7Z K;  4C3H C;  3S0X A;  3AD8 C;  1HI9 A;  1ZBS A;  4P9S A;  5IOT A;  2BE5 A;  5CJ9 A;  3BP3 A;  4LK0 A;  5M3F K;  1YX2 A;  4A3K C;  4WJ4 A;  3S16 C;  3M4O K;  3N0B A;  3GEH A;  4XCH A;  4KN4 A;  4LJZ A;  1TWA C;  3S15 K;  4G0W A;  2V6S A;  4BY1 C;  1WQF A;  3HOX K;  1EK8 A;  4A3L K;  3CAG A;  4OIN A;  3DXJ A;  3GTJ K;  5IYD C;  4Q4Z A;  4A93 C;  4Y7N K;  4XLP A;  1WOP A;  3PO2 C;  1IS1 A;  1K83 C;  1O29 A;  4Y52 C;  3S2H C;  1VJE A;  4X6A C;  2KWA A;  2V6U A;  3S1Q K;  3T00 A;  3RZO C;  1PJ6 A;  1INN A;  4BBS K;  4Q5S A;  3G4A A;  3CQZ K;  1B4B A;  2PPB A;  4KAW X;  2NVQ K;  4G7O A;  2A6H A;  1I6H K;  1WOS A;  3GTO C;  2JA8 C;  5M3M K;  5IP7 C;  2E2I A;  1I50 C;  4KM9 A;  4A3J C;  3AH5 A;  1XZQ A;  3S14 C;  1WSR A;  4A3B C;  3LAJ A;  3T02 A;  2GSU A;  1BGW A;  5E68 A;  4LOW A;  1J6X A;  2FQT A;  3GIR A;  3GTK A;  4YFX A;  1O26 A;  1WCM A;  4C3I K;  4XLN A;  2E2I K;  1J6V A;  1X31 C;  1O27 A;  3IPJ A;  2E2H K;  5IYC C;  1XXA A;  4M1X A;  3GTG K;  3FHZ A;  5IYB C;  4MEX A;  3H0G C;  3GTK K;  1WCM K;  4BBR C;  1C0A A;  1J6W A;  2ZFZ A;  3GTL K;  4BY7 C;  4G7H A;  4YFK A;  5IP9 K;  4RMF A;  4C3H K;  4FM9 A;  1TWA A;  3L4J A;  4PAB A;  2XCO A;  1I6V A;  3N0C A;  4A3G C;  1XXC A;  4A3K K;  2R93 A;  5L46 A;  3VA7 A;  4GTF A;  1DCP A;  5M5W K;  4GT9 A;  1IW7 A;  4QIW D;  1USM A;  1TWA K;  3SZY A;  5C4X C;  2XCR B;  1PJ7 A;  1USO A;  4BY1 K;  4GZY A;  1O2F B;  4KDD A;  3TTG A;  1YNN A;  1F7V A;  5IYD K;  4JK1 A;  4A93 K;  2P5M A;  3PO2 K;  1K83 K;  3N3Y A;  3I4N C;  3HOZ C;  4Y52 K;  3S2H K;  4C2M K;  2E2J C;  4MQ9 A;  2R92 C;  1IBA A;  3GTO A;  1TWC C;  4X6A K;  1GE9 A;  3GTJ A;  3RZO K;  4BXX C;  3I4M C;  3A8K A;  4NOI A;  4OIP A;  1JOE A;  2WAQ L;  2NVY C;  1ZQ1 C;  1JQW A;  1EFW A;  3GTQ C;  3L4K A;  3GTO K;  1BS2 A;  4GFQ A;  1I3Q C;  3G4C A;  3FOE A;  2JA8 K;  4O2D A;  5IP7 K;  5FLM C;  1DCO A;  1KQ4 A;  4A3J K;  1BJT A;  2O5I A;  3SZZ A;  3BP8 C;  3FOF A;  3CQZ A;  4KMA A;  3S14 K;  4A3B K;  3FKI C;  4GTE A;  1R9T C;  1ZVU A;  3HOW K;  4FZB A;  3HOU C;  5JVO A;  1ZYR A;  5IYC K;  3RZD C;  3ORE A;  3GTM C;  4A3M C;  2WAQ D;  1SMY A;  2JA6 C;  4KMH A;  3MML B;  2YU9 C;  4KB2 A;  1Y1W C;  3H0G K;  2A6E A;  1VGX A;  5TJ3 A;  4BBR K;  4AYB L;  2E2H A;  4C45 A;  3GTG A;  1L0W A;  2CW0 A;  2JH3 A;  2JA7 C;  2O5J A;  3AD9 C;  2RGR A;  4P5B A;  1TWG A;  1F7U A;  2D6F C;  5C44 C;  1F9N A;  4YFN A;  2Y3P A;  3HOV C; 
#chains in the Genus database with same CATH homology
 5IYB K;  4A3G K;  4A3F K;  3H3V L;  2R7Z C;  2BE5 A;  4A3I K;  1I6V A;  4LK0 A;  5M3F K;  4A3F C;  4A3G C;  1Y1V K;  4A3K K;  1BDF A;  4A3I C;  3WOD A;  4A3C K;  1Y1V C;  1TWG K;  4A3K C;  2PA8 L;  4A3C C;  4QJV A;  5C4X K;  5M5W K;  2NVT K;  3S16 C;  3M4O K;  1IW7 A;  4QIW D;  4AYB D;  1TWA K;  4XSZ A;  5C4X C;  2NVT C;  3M4O C;  4BY7 K;  4KN4 A;  2R7Z K;  4LJZ A;  2NVX K;  1TWA C;  5C4J K;  4BY1 K;  3S15 K;  4GZY A;  4QJV B;  2NVX C;  2B63 K;  5C4J C;  4BY1 C;  2WB1 D;  1YNN A;  3HOX K;  3S15 C;  5IYD K;  4JK1 A;  4A3L K;  4KN7 A;  4A93 K;  4OIN A;  2B63 C;  3DXJ A;  3GTJ K;  3HOX C;  5IYD C;  3S1R K;  4Q4Z A;  4A3L C;  2PMZ L;  1HQM A;  3I4N K;  3HOZ K;  4A93 C;  4Y7N K;  3GTJ C;  4XLP A;  3PO2 K;  3S1R C;  1K83 K;  2VUM K;  3HKZ L;  2R92 K;  3HOZ C;  3I4N C;  3EQL A;  4Y7N C;  1TWC K;  4C2M K;  2E2J C;  1XPP A;  3H3V D;  3PO2 C;  1K83 C;  3S2H K;  4MQ9 A;  2VUM C;  4Y52 C;  4C3J K;  2R92 C;  3S1N K;  1TWC C;  3S2H C;  4X6A K;  4BXX K;  3S16 K;  2Y0S L;  3HOY K;  3I4M K;  3S1N C;  4X6A C;  4OIO A;  3RZO K;  4BXX C;  3S1Q K;  5TMC A;  2PA8 D;  3HOY C;  3I4M C;  4XSX A;  4NOI A;  3RZO C;  3S1Q C;  2NVY K;  3HOW C;  4BBS K;  5TMF A;  4OIP A;  4Q5S A;  2WAQ L;  3CQZ K;  2NVY C;  2PPB A;  3GTQ C;  4BBS C;  1I3Q K;  2NVQ K;  5D4D A;  3HOV C;  3CQZ C;  4G7O A;  2A6H A;  4KMU A;  3GTO K;  5FLM K;  1I3Q C;  2NVQ C;  1I6H K;  2JA8 K;  5IP7 K;  5M5X K;  3GTO C;  5FLM C;  1I6H C;  2JA8 C;  4A3D K;  5M3M K;  5IP7 C;  4A3J K;  3FKI K;  2E2J K;  2O5I A;  1I50 C;  2PMZ D;  3S14 K;  4A3D C;  4A3J C;  4A3B K;  3FKI C;  4QIW L;  1R9T K;  3HKZ D;  5C3E K;  3GTP K;  3S14 C;  4A3B C;  1R9T C;  4YG2 A;  5C3E C;  3GTP C;  3HOW K;  2Y0S D;  3S17 K;  3HOU C;  1YNJ A;  4YFX A;  3RZD K;  3GTM K;  4C3I K;  1ZYR A;  3GTQ K;  4XLN A;  4A3M K;  2E2I K;  1TWH K;  5IYC K;  3S17 C;  3RZD C;  3GTM C;  4OIQ A;  3PO3 K;  3K7A K;  4A3M C;  2E2H K;  2A69 A;  1TWH C;  2WAQ D;  5IYC C;  2E2I C;  2JA6 K;  2A68 A;  2YU9 K;  1SMY A;  1Y1W K;  3GTG K;  3K7A C;  3PO3 C;  2E2H C;  5IYB C;  2JA6 C;  2YU9 C;  1Y1W C;  3GTG C;  3H0G K;  1I50 K;  3M3Y K;  4MEX A;  2A6E A;  1TWF K;  3S2D K;  3H0G C;  3M3Y C;  3GTK K;  5M5Y K;  1WCM K;  4BBR K;  4AYB L;  1TWF C;  1TWG C;  5FJ8 K;  4OIR A;  3S2D C;  3GTK C;  1WCM C;  4LK1 A;  4BBR C;  4ZH4 A;  4Y52 K;  4LLG A;  2JA7 K;  2CW0 A;  3S1M K;  4MEY A;  4A3E K;  2JA5 K;  3HOU K;  5C44 K;  2WB1 L;  2JA7 C;  3GTL K;  3S1M C;  4BY7 C;  2O5J A;  4A3E C;  4G7H A;  4YFK A;  2JA5 C;  2R93 K;  5C44 C;  5IP9 K;  3GTL C;  4G7Z A;  1SFO K;  3HOV K;  4C3H K;  4YFN A;  2R93 C;  5IP9 C;  1SFO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...