4A3IK

Rna polymerase ii binary complex with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3iK00
2B63K 4LK1A 4BBSK 1Y1WC 5IYCC 4A3IC 3HOVC 4GZYA 2JA5C 4YFXA 1R9TK 1TWHC 4A3JK 4KMUA 2R92K 2JA5K 2JA7C 2WB1L 3GTQK 4C3JK 3S17K 2O5JA 3GTLK 4NOIA 1K83C 5FLMC 3PO2K 5IP7C 4A3CK 4A3CC 3K7AK 3HOUC 4A93K 2PMZD 2VUMC 3S17C 3GTMC 3S15C 1I50K 3CQZK 4A3EK 2JA7K 4A3LK 4X6AK 3I4MC 2R92C 2NVQC 2Y0SL 4XLNA 2JA8C 3DXJA 3S1RK 4MEYA 4A3GK 2YU9K 3GTJC 2A69A 4A3IK 1TWGC 3HOVK 4KN4A 2NVYK 2NVYC 1TWGK 4G7ZA 5C44C 4A3KK 4C2MK 3H0GC 3GTJK 3RZDK 5IYBK 4QJVA 2E2JC 2YU9C 3GTGK 4A3GC 2R7ZK 4BY7K 2PA8D 4OIQA 2JA8K 1WCMC 4XSXA 3CQZC 4JK1A 3GTMK 3PO3K 3GTKK 2VUMK 4BXXC 3HOZK 5IYDK 1IW7A 5C3EK 4LK0A 2E2IC 3RZOK 5M5WK 3HOXC 5FLMK 2CW0A 3GTLC 1I3QK 1XPPA 3GTQC 3WODA 4MEXA 3S2HC 3S14K 4OIOA 4A3DC 3HOYK 5D4DA 3FKIK 2NVXC 1R9TC 2PMZL 3FKIC 2NVXK 5IYCK 1YNJA 1ZYRA 4BBSC 2O5IA 4BBRC 4A3MC 1TWFK 4Y7NC 3GTPC 4A3FC 3I4NK 2A6HA 5M3MK 1TWCC 4QIWL 1SFOK 3H3VL 3HOWC 5IP9K 3HOXK 4YFNA 3HKZD 5C3EC 4OIRA 3M4OC 3S1MC 3HOZC 5C4XK 5C4XC 3GTOC 1I6HK 1Y1VK 1BDFA 2PA8L 4XLPA 2JA6K 1TWCK 2WAQD 3S2DK 4A3FK 4AYBD 5IYBC 2E2JK 4Q4ZA 2E2HC 3GTGC 4BY1K 4BBRK 4A3MK 2E2HK 3M3YK 4XSZA 2NVTK 4C3HK 4QJVB 2WAQL 4LLGA 5C4JK 4AYBL 4A3BK 4Q5SA 1Y1VC 1YNNA 4OINA 3GTOK 1I6HC 4A3DK 3S1NK 2NVQK 2A68A 4Y52C 2Y0SD 2PPBA 3I4MK 3S14C 4MQ9A 4OIPA 2R93K 3S15K 5FJ8K 4A93C 4KN7A 1SFOC 3H3VD 4ZH4A 2E2IK 3HOWK 4Y7NK 3GTPK 3RZOC 1K83K 3PO2C 5IYDC 3I4NC 1TWFC 5TMFA 5M5XK 3GTKC 3PO3C 4BXXK 2WB1D 2R93C 4Y52K 1WCMK 5C4JC 4A3BC 2R7ZC 3HKZL 2NVTC 3HOYC 1TWHK 4A3JC 3M3YC 4A3KC 5C44K 3S1NC 3S2HK 4BY1C 3RZDC 1Y1WK 3EQLA 2B63C 3S2DC 1I3QC 4C3IK 4YFKA 2JA6C 1TWAC 3S1MK 5TMCA 5M3FK 3S1RC 1HQMA 4YG2A 5M5YK 4A3LC 3S16K 1SMYA 4G7HA 1I50C 4A3EC 3S1QC 3S1QK 3M4OK 4X6AC 3S16C 4LJZA 2A6EA 5IP9C 4G7OA 1I6VA 2BE5A 4BY7C 3K7AC 3HOUK 5IP7K 1TWAK 3H0GK 4QIWD
chains in the Genus database with same CATH superfamily
1Y1WC 4DDQA 4KASA 2JA5C 1DCPA 3AD8C 1PJ6A 2R92A 1IQ0A 3CQZA 1F7UA 1DCHA 2JA7C 2WB1L 4GTAA 1TWHA 3BUEA 3S17K 2O5JA 3Q3QA 2B63A 2P8TA 1WQHA 3S17C 1ZBSA 2JA7K 4A3LK 3I4MC 2NVQC 3DXJA 2FQOA 4PABA 3GTLA 1TWGK 4G7ZA 5C44C 3GTJK 4GFQA 3CAGA 4A3GC 1ZQ1C 2PA8D 1VRQC 4KMAA 1WQFA 1WSRA 3GTOA 1F93A 3GEHA 4KC6A 4BLAA 4G0WA 1I3QK 2NVYA 1BGWA 5IOQA 4G0UA 3HOYK 5D4DA 3G4AA 4GTBA 2PMZL 2NVXK 1EI6A 1L0WA 3T01A 5IYCK 4BBSC 1TWFK 4Y7NC 4A3FC 4P5BA 5M3MK 1TWCC 3SZZA 3HOXK 3HKZD 3VA7A 3M4OC 5C4XK 5C4XC 3OPFA 1JOEA 1Y1VK 1TWCK 2WAQD 4A3FK 5IYBC 4C2MC 2E2HK 2NVTK 4Q5SA 1GE9A 1O28A 4OINA 3TFIA 1I6HC 2A68A 4Y52C 3T02A 1O25A 1XZQA 1JVIA 4KMHA 2Y3PA 3A8KA 3GEEA 3G4CA 3H3VD 3HOWK 3AD9C 3GTPK 3PO2C 1O2FB 1VGXA 4C3JC 3TFJA 4Y52K 1IS1A 1IL2A 3HKZL 2NVTC 4P5AA 5C44K 3S2HK 1YCLA 2R7ZA 1KQ4A 5TMCA 5IORA 3QX3A 1R9TA 4A3LC 4G7HA 3S1QC 3M4OK 3S16C 3GIRA 3JSTA 4LOWA 1I6VA 3H0GK 3RZDC 2B63K 4BBSK 5IYCC 1PJ5A 3HOVC 4GZYA 2E2IA 1TWHC 4A3JK 3FHZA 4KMUA 1IE0A 5L46A 2JA5K 2ZUFA 1K83C 3K7AK 3H0GA 4A93K 3N3YA 1RU0A 3S15C 1DD5A 3A8IA 3S1RK 4FZBA 1WIHA 4A3GK 4GTLA 3GTJC 4C3IC 2A69A 1TWGC 4A3KK 3S1NK 1V5VA 1O29A 4OIQA 1VLOA 1X31C 1ZVUA 1PJ7A 1IW7A 5C3EK 2E2IC 3RZOK 1VH2A 2E2HA 5E68A 3SZYA 1ZXOA 5TJ3A 4A3DC 1WCMA 3FKIC 4GTCA 1ZYRA 4WJ3M 3AH5A 2VUMA 4A3MC 1BS2A 2W7VA 5HL8A 3GDZA 4QIWL 3V4GA 3H3VL 1XXBA 4OIRA 3HOZC 2NVXA 4GTFA 1UV7A 3GTOC 2JA6A 1WORA 1BDFA 4XLPA 1TWAA 4XCHA 2E2JK 4Q4ZA 3GTGC 4BY1K 2JH3A 4BBRK 3TTGA 3HXAA 4C3HK 2WAQL 5C4JK 4AYBL 1IBAA 4OIPA 3ERED 1SFOC 3I4NC 4BXXK 5TMFA 1O27A 3GTKC 3NUHA 3PO3C 2WB1D 2R93C 1WCMK 4C45A 4A3BC 3GSIA 2GAGC 2R7ZC 4KM8A 3M3YC 4ILDA 1O24A 1Y1WA 2JA6C 1TWAC 1HQMA 5M5YK 1I50C 4A3EC 4X6AC 5IP9C 4BY7C 2BE5A 5IP7K 1TWAK 4KB2A 4LK1A 4A3IC 5EGEA 4WILA 2XCRB 1R9TK 2CFAA 2R92K 1WOSA 1J6VA 2R93A 3GTKA 3GTLK 4NOIA 3GEIA 4A3CK 4A3CC 3HOUC 2PMZD 2VUMC 1INNA 4LR2A 4FM9A 2R92C 1F7VA 4XLNA 3BP8C 4MEYA 2YU9K 4A3IK 1AB4A 2NVYK 3GTPA 2V6SA 3IPJA 5CHPA 2GAHC 3GTGK 3A8JA 4QJVA 2E2JC 4GTEA 4BY7K 2JA8K 2FQTA 3CQZC 3GTMK 1F9NA 5CJ9A 3GTQA 5IYDK 3HOZK 4LK0A 5M5WK 1I3QA 5FLMK 2RGRA 1XPPA 4KM9A 3GTQC 3S14K 1O2BA 4GTDA 3FKIK 1O2AA 1YNJA 2GSNA 3GTMA 2O5IA 4P9SA 3BP3A 4PAAA 3AQOA 3I4NK 1SFOK 4G0VA 5C3EC 3ADAC 2JA7A 2P5MA 2V6UA 4LQYA 4M1XA 2PA8L 5JFEA 4C3HC 3S2DK 4AYBD 1K83A 4GT9A 2EBBA 1XZPA 3OREA 4LLGA 1EH1A 1YNNA 4BKWA 3GTOK 2Y0SD 2PPBA 3S14C 3S15K 1O26A 1XZQB 4A93C 4KN7A 1K83K 5IYDC 5M5XK 2ZFZA 1B4BA 2XCOA 4KB4A 1TWHK 3AD7C 4A3JC 3LPXA 3EQLA 2B63C 4KARA 3LAPA 3S2DC 3N0BA 5M3FK 4KMDA 4YG2A 3S16K 1SMYA 3S1QK 2YU9A 4G7OA 1Y1VA 3HOUK 3MMLB 1TWGA 3TFHA 1EK8A 3S0XA 1HI9A 4YFXA 4KATA 1WOOA 4KDDA 2JA5A 3GTQK 4C3JK 1WOPA 5FLMC 3PO2K 5IP7C 1B4AA 4KAWX 4AH6A 3GTMC 1I50K 3CQZK 4A3EK 4X6AK 1I50A 2Y0SL 2JA8C 2XCQA 3T00A 3HOVK 1BJTA 1SFOA 4KN4A 2NVYC 1WQGA 2RH6A 4C2MK 3H0GC 3RZDK 2YU9C 5IYBK 2R7ZK 1XZPB 1WCMC 4XSXA 4JK1A 1WSVA 4O2DA 1YX2A 3PO3K 3GTKK 2VUMK 2ZUEA 4BXXC 1DCOA 4J3NA 3HOXC 1TWCA 1J6WA 2CW0A 3GTLC 5IOTA 3WODA 4MEXA 3S2HC 4OIOA 3N0CA 2NVXC 2GSOA 1R9TC 3LAJA 2PHCB 1G51A 4BBRC 5IOSA 1USMA 1J98A 2D6FC 1XXCA 5JVOA 3GTPC 1ISEA 2A6HA 3HOWC 5IP9K 4YFNA 3FOFA 1I6HK 2JA6K 1XXAA 2E2HC 4A3MK 3M3YK 4XSZA 4QJVB 3AQPA 5EGHA 4A3BK 1Y1VC 2KWAA 4A3DK 2NVQK 2R93K 3FKIA 3I4MK 4MQ9A 1TWFA 5FJ8K 3OEPA 3L4KA 4ZH4A 2E2IK 3RZOC 4Y7NK 3L4JA 1TWFC 4BLBA 1EFWA 2GSUA 5C4JC 1JQWA 4WJ4A 3HOYC 1C0AA 4A3KC 3S1NC 1VJEA 4RMFA 4BY1C 1Y1WK 3GTGA 1J6XA 2CFAB 1I3QC 4C3IK 4YFKA 3S1MK 3GTJA 3S1RC 1EQRA 4LJZA 3FOEA 2A6EA 1USOA 3K7AC 2V6TA 3S1MC 4QIWD
chains in the Genus database with same CATH topology
2B63K 4LK1A 4BBSK 1Y1WC 5IYCC 4A3IC 3HOVC 4GZYA 2JA5C 4YFXA 1R9TK 1TWHC 4A3JK 4KMUA 2R92K 2JA5K 2JA7C 2WB1L 3GTQK 4C3JK 3S17K 2O5JA 3GTLK 4NOIA 1K83C 5FLMC 3PO2K 5IP7C 4A3CK 4A3CC 3K7AK 3HOUC 4A93K 2PMZD 2VUMC 3S17C 3GTMC 3S15C 1I50K 3CQZK 4A3EK 2JA7K 4A3LK 4X6AK 3I4MC 2R92C 2NVQC 2Y0SL 4XLNA 2JA8C 3DXJA 3S1RK 4MEYA 4A3GK 2YU9K 3GTJC 2A69A 4A3IK 1TWGC 3HOVK 4KN4A 2NVYK 2NVYC 1TWGK 4G7ZA 5C44C 4A3KK 4C2MK 3H0GC 3GTJK 3RZDK 5IYBK 4QJVA 2E2JC 2YU9C 3GTGK 4A3GC 2R7ZK 4BY7K 2PA8D 4OIQA 2JA8K 1WCMC 4XSXA 3CQZC 4JK1A 3GTMK 3PO3K 3GTKK 2VUMK 4BXXC 3HOZK 5IYDK 1IW7A 5C3EK 4LK0A 2E2IC 3RZOK 5M5WK 3HOXC 5FLMK 2CW0A 3GTLC 1I3QK 1XPPA 3GTQC 3WODA 4MEXA 3S2HC 3S14K 4OIOA 4A3DC 3HOYK 5D4DA 3FKIK 2NVXC 1R9TC 2PMZL 3FKIC 2NVXK 5IYCK 1YNJA 1ZYRA 4BBSC 2O5IA 4BBRC 4A3MC 1TWFK 4Y7NC 3GTPC 4A3FC 3I4NK 2A6HA 5M3MK 1TWCC 4QIWL 1SFOK 3H3VL 3HOWC 5IP9K 3HOXK 4YFNA 3HKZD 5C3EC 4OIRA 3M4OC 3S1MC 3HOZC 5C4XK 5C4XC 3GTOC 1I6HK 1Y1VK 1BDFA 2PA8L 4XLPA 2JA6K 1TWCK 2WAQD 3S2DK 4A3FK 4AYBD 5IYBC 2E2JK 4Q4ZA 2E2HC 3GTGC 4BY1K 4BBRK 4A3MK 2E2HK 3M3YK 4XSZA 2NVTK 4C3HK 4QJVB 2WAQL 4LLGA 5C4JK 4AYBL 4A3BK 4Q5SA 1Y1VC 1YNNA 4OINA 3GTOK 1I6HC 4A3DK 3S1NK 2NVQK 2A68A 4Y52C 2Y0SD 2PPBA 3I4MK 3S14C 4MQ9A 4OIPA 2R93K 3S15K 5FJ8K 4A93C 4KN7A 1SFOC 3H3VD 4ZH4A 2E2IK 3HOWK 4Y7NK 3GTPK 3RZOC 1K83K 3PO2C 5IYDC 3I4NC 1TWFC 5TMFA 5M5XK 3GTKC 3PO3C 4BXXK 2WB1D 2R93C 4Y52K 1WCMK 5C4JC 4A3BC 2R7ZC 3HKZL 2NVTC 3HOYC 1TWHK 4A3JC 3M3YC 4A3KC 5C44K 3S1NC 3S2HK 4BY1C 3RZDC 1Y1WK 3EQLA 2B63C 3S2DC 1I3QC 4C3IK 4YFKA 2JA6C 1TWAC 3S1MK 5TMCA 5M3FK 3S1RC 1HQMA 4YG2A 5M5YK 4A3LC 3S16K 1SMYA 4G7HA 1I50C 4A3EC 3S1QC 3S1QK 3M4OK 4X6AC 3S16C 4LJZA 2A6EA 5IP9C 4G7OA 1I6VA 2BE5A 4BY7C 3K7AC 3HOUK 5IP7K 1TWAK 3H0GK 4QIWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 K;  4LK1 A;  4BBS K;  1Y1W C;  5IYC C;  4A3I C;  3HOV C;  4GZY A;  2JA5 C;  4YFX A;  1R9T K;  1TWH C;  4A3J K;  4KMU A;  2R92 K;  2JA5 K;  2JA7 C;  2WB1 L;  3GTQ K;  4C3J K;  3S17 K;  2O5J A;  3GTL K;  4NOI A;  1K83 C;  5FLM C;  3PO2 K;  5IP7 C;  4A3C K;  4A3C C;  3K7A K;  3HOU C;  4A93 K;  2PMZ D;  2VUM C;  3S17 C;  3GTM C;  3S15 C;  1I50 K;  3CQZ K;  4A3E K;  2JA7 K;  4A3L K;  4X6A K;  3I4M C;  2R92 C;  2NVQ C;  2Y0S L;  4XLN A;  2JA8 C;  3DXJ A;  3S1R K;  4MEY A;  4A3G K;  2YU9 K;  3GTJ C;  2A69 A;  4A3I K;  1TWG C;  3HOV K;  4KN4 A;  2NVY K;  2NVY C;  1TWG K;  4G7Z A;  5C44 C;  4A3K K;  4C2M K;  3H0G C;  3GTJ K;  3RZD K;  5IYB K;  4QJV A;  2E2J C;  2YU9 C;  3GTG K;  4A3G C;  2R7Z K;  4BY7 K;  2PA8 D;  4OIQ A;  2JA8 K;  1WCM C;  4XSX A;  3CQZ C;  4JK1 A;  3GTM K;  3PO3 K;  3GTK K;  2VUM K;  4BXX C;  3HOZ K;  5IYD K;  1IW7 A;  5C3E K;  4LK0 A;  2E2I C;  3RZO K;  5M5W K;  3HOX C;  5FLM K;  2CW0 A;  3GTL C;  1I3Q K;  1XPP A;  3GTQ C;  3WOD A;  4MEX A;  3S2H C;  3S14 K;  4OIO A;  4A3D C;  3HOY K;  5D4D A;  3FKI K;  2NVX C;  1R9T C;  2PMZ L;  3FKI C;  2NVX K;  5IYC K;  1YNJ A;  1ZYR A;  4BBS C;  2O5I A;  4BBR C;  4A3M C;  1TWF K;  4Y7N C;  3GTP C;  4A3F C;  3I4N K;  2A6H A;  5M3M K;  1TWC C;  4QIW L;  1SFO K;  3H3V L;  3HOW C;  5IP9 K;  3HOX K;  4YFN A;  3HKZ D;  5C3E C;  4OIR A;  3M4O C;  3S1M C;  3HOZ C;  5C4X K;  5C4X C;  3GTO C;  1I6H K;  1Y1V K;  1BDF A;  2PA8 L;  4XLP A;  2JA6 K;  1TWC K;  2WAQ D;  3S2D K;  4A3F K;  4AYB D;  5IYB C;  2E2J K;  4Q4Z A;  2E2H C;  3GTG C;  4BY1 K;  4BBR K;  4A3M K;  2E2H K;  3M3Y K;  4XSZ A;  2NVT K;  4C3H K;  4QJV B;  2WAQ L;  4LLG A;  5C4J K;  4AYB L;  4A3B K;  4Q5S A;  1Y1V C;  1YNN A;  4OIN A;  3GTO K;  1I6H C;  4A3D K;  3S1N K;  2NVQ K;  2A68 A;  4Y52 C;  2Y0S D;  2PPB A;  3I4M K;  3S14 C;  4MQ9 A;  4OIP A;  2R93 K;  3S15 K;  5FJ8 K;  4A93 C;  4KN7 A;  1SFO C;  3H3V D;  4ZH4 A;  2E2I K;  3HOW K;  4Y7N K;  3GTP K;  3RZO C;  1K83 K;  3PO2 C;  5IYD C;  3I4N C;  1TWF C;  5TMF A;  5M5X K;  3GTK C;  3PO3 C;  4BXX K;  2WB1 D;  2R93 C;  4Y52 K;  1WCM K;  5C4J C;  4A3B C;  2R7Z C;  3HKZ L;  2NVT C;  3HOY C;  1TWH K;  4A3J C;  3M3Y C;  4A3K C;  5C44 K;  3S1N C;  3S2H K;  4BY1 C;  3RZD C;  1Y1W K;  3EQL A;  2B63 C;  3S2D C;  1I3Q C;  4C3I K;  4YFK A;  2JA6 C;  1TWA C;  3S1M K;  5TMC A;  5M3F K;  3S1R C;  1HQM A;  4YG2 A;  5M5Y K;  4A3L C;  3S16 K;  1SMY A;  4G7H A;  1I50 C;  4A3E C;  3S1Q C;  3S1Q K;  3M4O K;  4X6A C;  3S16 C;  4LJZ A;  2A6E A;  5IP9 C;  4G7O A;  1I6V A;  2BE5 A;  4BY7 C;  3K7A C;  3HOU K;  5IP7 K;  1TWA K;  3H0G K;  4QIW D; 
#chains in the Genus database with same CATH topology
 1Y1W C;  4DDQ A;  4KAS A;  2JA5 C;  1DCP A;  3AD8 C;  1PJ6 A;  2R92 A;  1IQ0 A;  3CQZ A;  1F7U A;  1DCH A;  2JA7 C;  2WB1 L;  4GTA A;  1TWH A;  3BUE A;  3S17 K;  2O5J A;  3Q3Q A;  2B63 A;  2P8T A;  1WQH A;  3S17 C;  1ZBS A;  2JA7 K;  4A3L K;  3I4M C;  2NVQ C;  3DXJ A;  2FQO A;  4PAB A;  3GTL A;  1TWG K;  4G7Z A;  5C44 C;  3GTJ K;  4GFQ A;  3CAG A;  4A3G C;  1ZQ1 C;  2PA8 D;  1VRQ C;  4KMA A;  1WQF A;  1WSR A;  3GTO A;  1F93 A;  3GEH A;  4KC6 A;  4BLA A;  4G0W A;  1I3Q K;  2NVY A;  1BGW A;  5IOQ A;  4G0U A;  3HOY K;  5D4D A;  3G4A A;  4GTB A;  2PMZ L;  2NVX K;  1EI6 A;  1L0W A;  3T01 A;  5IYC K;  4BBS C;  1TWF K;  4Y7N C;  4A3F C;  4P5B A;  5M3M K;  1TWC C;  3SZZ A;  3HOX K;  3HKZ D;  3VA7 A;  3M4O C;  5C4X K;  5C4X C;  3OPF A;  1JOE A;  1Y1V K;  1TWC K;  2WAQ D;  4A3F K;  5IYB C;  4C2M C;  2E2H K;  2NVT K;  4Q5S A;  1GE9 A;  1O28 A;  4OIN A;  3TFI A;  1I6H C;  2A68 A;  4Y52 C;  3T02 A;  1O25 A;  1XZQ A;  1JVI A;  4KMH A;  2Y3P A;  3A8K A;  3GEE A;  3G4C A;  3H3V D;  3HOW K;  3AD9 C;  3GTP K;  3PO2 C;  1O2F B;  1VGX A;  4C3J C;  3TFJ A;  4Y52 K;  1IS1 A;  1IL2 A;  3HKZ L;  2NVT C;  4P5A A;  5C44 K;  3S2H K;  1YCL A;  2R7Z A;  1KQ4 A;  5TMC A;  5IOR A;  3QX3 A;  1R9T A;  4A3L C;  4G7H A;  3S1Q C;  3M4O K;  3S16 C;  3GIR A;  3JST A;  4LOW A;  1I6V A;  3H0G K;  3RZD C;  2B63 K;  4BBS K;  5IYC C;  1PJ5 A;  3HOV C;  4GZY A;  2E2I A;  1TWH C;  4A3J K;  3FHZ A;  4KMU A;  1IE0 A;  5L46 A;  2JA5 K;  2ZUF A;  1K83 C;  3K7A K;  3H0G A;  4A93 K;  3N3Y A;  1RU0 A;  3S15 C;  1DD5 A;  3A8I A;  3S1R K;  4FZB A;  1WIH A;  4A3G K;  4GTL A;  3GTJ C;  4C3I C;  2A69 A;  1TWG C;  4A3K K;  3S1N K;  1V5V A;  1O29 A;  4OIQ A;  1VLO A;  1X31 C;  1ZVU A;  1PJ7 A;  1IW7 A;  5C3E K;  2E2I C;  3RZO K;  1VH2 A;  2E2H A;  5E68 A;  3SZY A;  1ZXO A;  5TJ3 A;  4A3D C;  1WCM A;  3FKI C;  4GTC A;  1ZYR A;  4WJ3 M;  3AH5 A;  2VUM A;  4A3M C;  1BS2 A;  2W7V A;  5HL8 A;  3GDZ A;  4QIW L;  3V4G A;  3H3V L;  1XXB A;  4OIR A;  3HOZ C;  2NVX A;  4GTF A;  1UV7 A;  3GTO C;  2JA6 A;  1WOR A;  1BDF A;  4XLP A;  1TWA A;  4XCH A;  2E2J K;  4Q4Z A;  3GTG C;  4BY1 K;  2JH3 A;  4BBR K;  3TTG A;  3HXA A;  4C3H K;  2WAQ L;  5C4J K;  4AYB L;  1IBA A;  4OIP A;  3ERE D;  1SFO C;  3I4N C;  4BXX K;  5TMF A;  1O27 A;  3GTK C;  3NUH A;  3PO3 C;  2WB1 D;  2R93 C;  1WCM K;  4C45 A;  4A3B C;  3GSI A;  2GAG C;  2R7Z C;  4KM8 A;  3M3Y C;  4ILD A;  1O24 A;  1Y1W A;  2JA6 C;  1TWA C;  1HQM A;  5M5Y K;  1I50 C;  4A3E C;  4X6A C;  5IP9 C;  4BY7 C;  2BE5 A;  5IP7 K;  1TWA K;  4KB2 A;  4LK1 A;  4A3I C;  5EGE A;  4WIL A;  2XCR B;  1R9T K;  2CFA A;  2R92 K;  1WOS A;  1J6V A;  2R93 A;  3GTK A;  3GTL K;  4NOI A;  3GEI A;  4A3C K;  4A3C C;  3HOU C;  2PMZ D;  2VUM C;  1INN A;  4LR2 A;  4FM9 A;  2R92 C;  1F7V A;  4XLN A;  3BP8 C;  4MEY A;  2YU9 K;  4A3I K;  1AB4 A;  2NVY K;  3GTP A;  2V6S A;  3IPJ A;  5CHP A;  2GAH C;  3GTG K;  3A8J A;  4QJV A;  2E2J C;  4GTE A;  4BY7 K;  2JA8 K;  2FQT A;  3CQZ C;  3GTM K;  1F9N A;  5CJ9 A;  3GTQ A;  5IYD K;  3HOZ K;  4LK0 A;  5M5W K;  1I3Q A;  5FLM K;  2RGR A;  1XPP A;  4KM9 A;  3GTQ C;  3S14 K;  1O2B A;  4GTD A;  3FKI K;  1O2A A;  1YNJ A;  2GSN A;  3GTM A;  2O5I A;  4P9S A;  3BP3 A;  4PAA A;  3AQO A;  3I4N K;  1SFO K;  4G0V A;  5C3E C;  3ADA C;  2JA7 A;  2P5M A;  2V6U A;  4LQY A;  4M1X A;  2PA8 L;  5JFE A;  4C3H C;  3S2D K;  4AYB D;  1K83 A;  4GT9 A;  2EBB A;  1XZP A;  3ORE A;  4LLG A;  1EH1 A;  1YNN A;  4BKW A;  3GTO K;  2Y0S D;  2PPB A;  3S14 C;  3S15 K;  1O26 A;  1XZQ B;  4A93 C;  4KN7 A;  1K83 K;  5IYD C;  5M5X K;  2ZFZ A;  1B4B A;  2XCO A;  4KB4 A;  1TWH K;  3AD7 C;  4A3J C;  3LPX A;  3EQL A;  2B63 C;  4KAR A;  3LAP A;  3S2D C;  3N0B A;  5M3F K;  4KMD A;  4YG2 A;  3S16 K;  1SMY A;  3S1Q K;  2YU9 A;  4G7O A;  1Y1V A;  3HOU K;  3MML B;  1TWG A;  3TFH A;  1EK8 A;  3S0X A;  1HI9 A;  4YFX A;  4KAT A;  1WOO A;  4KDD A;  2JA5 A;  3GTQ K;  4C3J K;  1WOP A;  5FLM C;  3PO2 K;  5IP7 C;  1B4A A;  4KAW X;  4AH6 A;  3GTM C;  1I50 K;  3CQZ K;  4A3E K;  4X6A K;  1I50 A;  2Y0S L;  2JA8 C;  2XCQ A;  3T00 A;  3HOV K;  1BJT A;  1SFO A;  4KN4 A;  2NVY C;  1WQG A;  2RH6 A;  4C2M K;  3H0G C;  3RZD K;  2YU9 C;  5IYB K;  2R7Z K;  1XZP B;  1WCM C;  4XSX A;  4JK1 A;  1WSV A;  4O2D A;  1YX2 A;  3PO3 K;  3GTK K;  2VUM K;  2ZUE A;  4BXX C;  1DCO A;  4J3N A;  3HOX C;  1TWC A;  1J6W A;  2CW0 A;  3GTL C;  5IOT A;  3WOD A;  4MEX A;  3S2H C;  4OIO A;  3N0C A;  2NVX C;  2GSO A;  1R9T C;  3LAJ A;  2PHC B;  1G51 A;  4BBR C;  5IOS A;  1USM A;  1J98 A;  2D6F C;  1XXC A;  5JVO A;  3GTP C;  1ISE A;  2A6H A;  3HOW C;  5IP9 K;  4YFN A;  3FOF A;  1I6H K;  2JA6 K;  1XXA A;  2E2H C;  4A3M K;  3M3Y K;  4XSZ A;  4QJV B;  3AQP A;  5EGH A;  4A3B K;  1Y1V C;  2KWA A;  4A3D K;  2NVQ K;  2R93 K;  3FKI A;  3I4M K;  4MQ9 A;  1TWF A;  5FJ8 K;  3OEP A;  3L4K A;  4ZH4 A;  2E2I K;  3RZO C;  4Y7N K;  3L4J A;  1TWF C;  4BLB A;  1EFW A;  2GSU A;  5C4J C;  1JQW A;  4WJ4 A;  3HOY C;  1C0A A;  4A3K C;  3S1N C;  1VJE A;  4RMF A;  4BY1 C;  1Y1W K;  3GTG A;  1J6X A;  2CFA B;  1I3Q C;  4C3I K;  4YFK A;  3S1M K;  3GTJ A;  3S1R C;  1EQR A;  4LJZ A;  3FOE A;  2A6E A;  1USO A;  3K7A C;  2V6T A;  3S1M C;  4QIW D; 
#chains in the Genus database with same CATH homology
 2B63 K;  4LK1 A;  4BBS K;  1Y1W C;  5IYC C;  4A3I C;  3HOV C;  4GZY A;  2JA5 C;  4YFX A;  1R9T K;  1TWH C;  4A3J K;  4KMU A;  2R92 K;  2JA5 K;  2JA7 C;  2WB1 L;  3GTQ K;  4C3J K;  3S17 K;  2O5J A;  3GTL K;  4NOI A;  1K83 C;  5FLM C;  3PO2 K;  5IP7 C;  4A3C K;  4A3C C;  3K7A K;  3HOU C;  4A93 K;  2PMZ D;  2VUM C;  3S17 C;  3GTM C;  3S15 C;  1I50 K;  3CQZ K;  4A3E K;  2JA7 K;  4A3L K;  4X6A K;  3I4M C;  2R92 C;  2NVQ C;  2Y0S L;  4XLN A;  2JA8 C;  3DXJ A;  3S1R K;  4MEY A;  4A3G K;  2YU9 K;  3GTJ C;  2A69 A;  4A3I K;  1TWG C;  3HOV K;  4KN4 A;  2NVY K;  2NVY C;  1TWG K;  4G7Z A;  5C44 C;  4A3K K;  4C2M K;  3H0G C;  3GTJ K;  3RZD K;  5IYB K;  4QJV A;  2E2J C;  2YU9 C;  3GTG K;  4A3G C;  2R7Z K;  4BY7 K;  2PA8 D;  4OIQ A;  2JA8 K;  1WCM C;  4XSX A;  3CQZ C;  4JK1 A;  3GTM K;  3PO3 K;  3GTK K;  2VUM K;  4BXX C;  3HOZ K;  5IYD K;  1IW7 A;  5C3E K;  4LK0 A;  2E2I C;  3RZO K;  5M5W K;  3HOX C;  5FLM K;  2CW0 A;  3GTL C;  1I3Q K;  1XPP A;  3GTQ C;  3WOD A;  4MEX A;  3S2H C;  3S14 K;  4OIO A;  4A3D C;  3HOY K;  5D4D A;  3FKI K;  2NVX C;  1R9T C;  2PMZ L;  3FKI C;  2NVX K;  5IYC K;  1YNJ A;  1ZYR A;  4BBS C;  2O5I A;  4BBR C;  4A3M C;  1TWF K;  4Y7N C;  3GTP C;  4A3F C;  3I4N K;  2A6H A;  5M3M K;  1TWC C;  4QIW L;  1SFO K;  3H3V L;  3HOW C;  5IP9 K;  3HOX K;  4YFN A;  3HKZ D;  5C3E C;  4OIR A;  3M4O C;  3S1M C;  3HOZ C;  5C4X K;  5C4X C;  3GTO C;  1I6H K;  1Y1V K;  1BDF A;  2PA8 L;  4XLP A;  2JA6 K;  1TWC K;  2WAQ D;  3S2D K;  4A3F K;  4AYB D;  5IYB C;  2E2J K;  4Q4Z A;  2E2H C;  3GTG C;  4BY1 K;  4BBR K;  4A3M K;  2E2H K;  3M3Y K;  4XSZ A;  2NVT K;  4C3H K;  4QJV B;  2WAQ L;  4LLG A;  5C4J K;  4AYB L;  4A3B K;  4Q5S A;  1Y1V C;  1YNN A;  4OIN A;  3GTO K;  1I6H C;  4A3D K;  3S1N K;  2NVQ K;  2A68 A;  4Y52 C;  2Y0S D;  2PPB A;  3I4M K;  3S14 C;  4MQ9 A;  4OIP A;  2R93 K;  3S15 K;  5FJ8 K;  4A93 C;  4KN7 A;  1SFO C;  3H3V D;  4ZH4 A;  2E2I K;  3HOW K;  4Y7N K;  3GTP K;  3RZO C;  1K83 K;  3PO2 C;  5IYD C;  3I4N C;  1TWF C;  5TMF A;  5M5X K;  3GTK C;  3PO3 C;  4BXX K;  2WB1 D;  2R93 C;  4Y52 K;  1WCM K;  5C4J C;  4A3B C;  2R7Z C;  3HKZ L;  2NVT C;  3HOY C;  1TWH K;  4A3J C;  3M3Y C;  4A3K C;  5C44 K;  3S1N C;  3S2H K;  4BY1 C;  3RZD C;  1Y1W K;  3EQL A;  2B63 C;  3S2D C;  1I3Q C;  4C3I K;  4YFK A;  2JA6 C;  1TWA C;  3S1M K;  5TMC A;  5M3F K;  3S1R C;  1HQM A;  4YG2 A;  5M5Y K;  4A3L C;  3S16 K;  1SMY A;  4G7H A;  1I50 C;  4A3E C;  3S1Q C;  3S1Q K;  3M4O K;  4X6A C;  3S16 C;  4LJZ A;  2A6E A;  5IP9 C;  4G7O A;  1I6V A;  2BE5 A;  4BY7 C;  3K7A C;  3HOU K;  5IP7 K;  1TWA K;  3H0G K;  4QIW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...