2P5MA

C-terminal domain hexamer of ahrc bound with l-arginine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
QRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor L-arginine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 24
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2p5mA00
3V4GA 2P5MA 5CJ9A 3OPFA 3FOFA 1XXAA 1WQGA 3OREA 4DDQA 4KC6A 1BGWA 2Y3PA 3NUHA 4G0VA 1AB4A 3LPXA 2RGRA 3FOEA 2XCOA 3QX3A 2XCQA 1XXCA 4KB4A 4KAWX 4KB2A 3BUEA 4GFQA 1DD5A 5JVOA 2ZFZA 1BJTA 4J3NA 1F9NA 4FM9A 1GE9A 3FHZA 1IS1A 3LAPA 2XCRB 2PHCB 1WQFA 2KWAA 3ERED 1ZVUA 1WQHA 1ISEA 3CAGA 3L4JA 1XXBA 3MMLB 4KDDA 1B4AA 1B4BA 3VA7A 3LAJA 3OEPA 4G0WA 1WIHA 3L4KA 1EH1A 4G0UA 1EK8A
chains in the Genus database with same CATH superfamily
3V4GA 3H3VD 3HKZL 4A3LC 4MEXA 3FOFA 3M4OK 1TWHK 1I6HK 1AB4A 1VRQC 1X31C 4BBRK 4MQ9A 1HQMA 4KB2A 1J6VA 2E2IA 1I3QC 1RU0A 1YNNA 4QJVA 2O5IA 2B63C 2A6EA 3CQZC 2ZUFA 4A3CK 1I50K 2GAGC 1F7UA 3K7AK 1O24A 3FKIC 4GTDA 3IPJA 3OEPA 1F7VA 2WB1L 4KAWX 1SFOA 1INNA 4RMFA 4LK1A 1ZBSA 4LJZA 3TTGA 4KMDA 3NUHA 3GTOA 2JA8K 3S1RK 2JA6K 1O2BA 3AD7C 1WSVA 4A3MK 1XPPA 2ZFZA 5D4DA 1DCPA 4QIWL 3SZZA 4BXXC 4BBRC 1BS2A 1TWCC 3N0CA 3PO3C 4A3KK 2R92C 3S1QC 4OINA 1ZQ1C 3H3VL 5TMFA 4ILDA 5M5XK 4OIQA 2WB1D 4KMHA 4G7OA 1EQRA 5JFEA 3AD8C 4MEYA 4G7HA 2EBBA 4A3EC 5M3MK 1JOEA 1PJ7A 3K7AC 1WCMC 2XCRB 1WOOA 5IP9K 3S1NK 1WQHA 3GTLK 3GTGC 2W7VA 4BKWA 1O29A 3GEIA 4AH6A 1WOSA 1ZXOA 3S2HC 1WOPA 1EH1A 3S0XA 2V6TA 1YNJA 4WJ3M 1I6HC 1WCMK 1J6WA 4PAAA 3G4AA 4AYBL 5IYDC 1I6VA 3GTMC 4GFQA 4Y7NK 1IE0A 3H0GK 3N3YA 2R92A 4GTLA 1XZPB 4BLBA 3GTPK 4GTBA 2R7ZC 2Y0SL 1F93A 3L4JA 2YU9A 3AQPA 1TWAK 3HOWK 4BBSK 3LAJA 1TWGK 1Y1WK 3TFIA 2JA5A 3WODA 4A3JK 3I4MK 2JA5C 4A3FC 2JH3A 2P5MA 1TWFK 1WORA 4GT9A 4LOWA 2FQTA 4YFNA 4Q4ZA 1L0WA 3GTOC 1TWHA 3QX3A 1WSRA 2ZUEA 4KB4A 3GTKK 4C3JC 2RH6A 1YCLA 3HOVC 3S2DK 3T02A 4FM9A 4OIPA 1XZPA 3Q3QA 4YFKA 3FHZA 3G4CA 1IQ0A 5C3EC 1I50A 1Y1VK 1XXBA 2B63A 2A69A 2PA8L 1O28A 4Y52K 3BP8C 4KN4A 1WIHA 5IP7C 4G0UA 4C3JK 2A68A 3AQOA 2NVTK 4KASA 3HOVK 5CJ9A 4BY1C 1WCMA 5CHPA 5TMCA 5C4JK 5FJ8K 3S15K 5JVOA 1F9NA 5C44K 2VUMK 2E2HA 2NVYA 1WQFA 4GTFA 2Y0SD 4A3BK 5L46A 2A6HA 1TWAA 3L4KA 3N0BA 5M5YK 1DCHA 1TWCA 1UV7A 4A3DK 4A3BC 3M3YC 2XCQA 1USOA 5TJ3A 4A3GK 5C44C 2E2JC 3GTGK 3GTLC 5C4JC 3AH5A 1C0AA 1R9TC 1ISEA 1K83C 5IYCK 3S1NC 5E68A 4BY1K 2WAQL 5FLMK 1SFOK 4XSZA 4Y52C 3RZDC 4A3EK 2GSOA 4XCHA 3HOXC 5HL8A 4C2MK 3SZYA 4GTEA 3ADAC 3S2DC 4PABA 5C3EK 4BY7C 2E2IC 3GTKC 1O27A 4X6AC 4KMUA 2R92K 3S17C 4A93K 3GTPA 1ZVUA 4A3FK 2NVYC 4KMAA 1TWGC 1Y1WC 2NVXA 1TWGA 2CW0A 2JA5K 1Y1WA 1SMYA 1G51A 4WILA 4BBSC 3GTPC 4KM8A 3H0GC 5C4XK 4Y7NC 3GTKA 3HOXK 4ZH4A 4LK0A 4GTCA 2PA8D 3LAPA 2R93C 5FLMC 5EGEA 1HI9A 1K83K 5IYCC 4KM9A 1I50C 3S16K 2CFAB 4C3HC 1J98A 1R9TK 2NVQK 2B63K 4A3IK 3TFJA 4QJVB 3HOZK 1VLOA 3S2HK 1I3QK 4GTAA 5IOSA 3GDZA 5EGHA 1J6XA 5IOTA 2GSUA 1VGXA 5IP9C 4P5BA 2R93K 2O5JA 1DD5A 2D6FC 4WJ4A 2PHCB 1O2FB 3DXJA 2YU9C 2YU9K 3GIRA 4LQYA 2R7ZA 1JVIA 1B4AA 4BLAA 2V6UA 3VA7A 3HOUK 1TWFA 4C3IC 2VUMC 1JQWA 3GTMA 4AYBD 1V5VA 1WQGA 4KC6A 4BXXK 2Y3PA 3PO3K 3RZOK 1TWCK 3AD9C 3HOZC 4A93C 1O2AA 2CFAA 4A3IC 3GTQA 2NVTC 3S1RC 4C3HK 2E2IK 1GE9A 4A3MC 2JA8C 1IS1A 1Y1VA 2PMZL 3HOYK 2KWAA 3GTGA 4Q5SA 2JA7K 3GTQC 3S14K 3RZDK 3I4NC 3OPFA 3HOYC 3TFHA 2V6SA 3LPXA 4A3CC 1KQ4A 3FOEA 2FQOA 1XXCA 1O26A 3GTJA 2VUMA 3PO2K 1BJTA 2E2JK 2NVYK 1IL2A 1EI6A 4A3JC 1TWHC 3EQLA 3HOWC 4X6AK 3HKZD 4G7ZA 2NVXK 3S1QK 4GZYA 1EK8A 4BY7K 1EFWA 1XXAA 3HXAA 3GTMK 5IOQA 4G0VA 5IYDK 2BE5A 5IYBC 1VH2A 4KARA 1SFOC 2P8TA 1YX2A 3GTJC 4FZBA 4XLNA 3FKIA 4YG2A 4QIWD 4NOIA 3CQZA 1B4BA 4G0WA 3JSTA 1VJEA 3GEHA 1I3QA 2NVQC 3S16C 4A3DC 4DDQA 3GEEA 5IYBK 1O25A 2XCOA 1Y1VC 3BUEA 4JK1A 4M1XA 5C4XC 3S1MC 4LLGA 4C45A 1XZQA 4A3KC 2WAQD 3A8KA 1IW7A 3PO2C 3S15C 1TWFC 4XLPA 5M5WK 3OREA 3S17K 1BGWA 2RGRA 2JA6C 2PPBA 3GSIA 3S1MK 1ZYRA 4OIOA 5IP7K 1USMA 4KATA 3I4NK 4J3NA 3A8IA 1XZQB 3GTQK 3S14C 4C2MC 1K83A 3ERED 2JA7A 4YFXA 3FKIK 3CAGA 1R9TA 3MMLB 2JA7C 3CQZK 2PMZD 3GTLA 1DCOA 4O2DA 4KN7A 2GSNA 1PJ5A 3GTOK 3RZOC 2JA6A 3GTJK 2R93A 4P9SA 5M3FK 4A3GC 4C3IK 4OIRA 3I4MC 3M4OC 2GAHC 4XSXA 4LR2A 4A3LK 3M3YK 1TWAC 3H0GA 3BP3A 3T00A 2E2HK 3HOUC 2R7ZK 1BDFA 1PJ6A 4KDDA 3A8JA 5IORA 3T01A 2E2HC 1IBAA 2NVXC 4P5AA
chains in the Genus database with same CATH topology
1TWGA 3V4GA 1Y1WA 2JH3A 2P5MA 4GT9A 3FOFA 1XXAA 5IOQA 4G0VA 1AB4A 1TWHA 4KM8A 3QX3A 4KB4A 4C3JC 4KB2A 2RH6A 4KARA 3GTKA 2E2IA 4FM9A 4GTCA 3Q3QA 3FHZA 4FZBA 3G4CA 3LAPA 3FKIA 5EGEA 1I50A 3CQZA 1XXBA 4KM9A 2CFAB 1B4BA 4GTDA 1O24A 4C3HC 2B63A 1O28A 3OEPA 4G0WA 1WIHA 4P5AA 4KAWX 4G0UA 1I3QA 3AQOA 1SFOA 4KASA 4GTAA 5CJ9A 1ZBSA 4DDQA 5IOSA 4KMDA 5EGHA 3NUHA 3GTOA 5IOTA 2GSUA 1O25A 2XCOA 1O2BA 1WCMA 5CHPA 4P5BA 3BUEA 1DD5A 5JVOA 2ZFZA 4M1XA 1F9NA 2E2HA 2NVYA 2PHCB 1WQFA 4GTFA 4LQYA 2R7ZA 3N0CA 1B4AA 4BLAA 3VA7A 1TWAA 3L4KA 1TWFA 3N0BA 4C3IC 3GTMA 4ILDA 1WQGA 3OREA 1TWCA 4KC6A 1BGWA 2Y3PA 4KMHA 5JFEA 2RGRA 2XCQA 1O2AA 2CFAA 5TJ3A 4KATA 3GTQA 4J3NA 1GE9A 1IS1A 1Y1VA 4C2MC 2XCRB 1K83A 3AH5A 2KWAA 3ERED 3GTGA 2JA7A 1WQHA 1ISEA 3CAGA 1R9TA 3MMLB 4BKWA 1O29A 3GTLA 1ZXOA 2GSNA 1EH1A 3S0XA 2GSOA 3OPFA 2JA6A 3LPXA 1KQ4A 3G4AA 4GTEA 3FOEA 2R93A 1XXCA 1O26A 3GTJA 2VUMA 4GFQA 4LR2A 1BJTA 1O27A 3N3YA 2R92A 4GTLA 4BLBA 3H0GA 4GTBA 3GTPA 1ZVUA 3L4JA 4KDDA 2YU9A 3AQPA 5IORA 3LAJA 4KMAA 2JA5A 2NVXA 1EK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  2P5M A;  5CJ9 A;  3OPF A;  3FOF A;  1XXA A;  1WQG A;  3ORE A;  4DDQ A;  4KC6 A;  1BGW A;  2Y3P A;  3NUH A;  4G0V A;  1AB4 A;  3LPX A;  2RGR A;  3FOE A;  2XCO A;  3QX3 A;  2XCQ A;  1XXC A;  4KB4 A;  4KAW X;  4KB2 A;  3BUE A;  4GFQ A;  1DD5 A;  5JVO A;  2ZFZ A;  1BJT A;  4J3N A;  1F9N A;  4FM9 A;  1GE9 A;  3FHZ A;  1IS1 A;  3LAP A;  2XCR B;  2PHC B;  1WQF A;  2KWA A;  3ERE D;  1ZVU A;  1WQH A;  1ISE A;  3CAG A;  3L4J A;  1XXB A;  3MML B;  4KDD A;  1B4A A;  1B4B A;  3VA7 A;  3LAJ A;  3OEP A;  4G0W A;  1WIH A;  3L4K A;  1EH1 A;  4G0U A;  1EK8 A; 
#chains in the Genus database with same CATH topology
 3V4G A;  3H3V D;  3HKZ L;  4A3L C;  4MEX A;  3FOF A;  3M4O K;  1TWH K;  1I6H K;  1AB4 A;  1VRQ C;  1X31 C;  4BBR K;  4MQ9 A;  1HQM A;  4KB2 A;  1J6V A;  2E2I A;  1I3Q C;  1RU0 A;  1YNN A;  4QJV A;  2O5I A;  2B63 C;  2A6E A;  3CQZ C;  2ZUF A;  4A3C K;  1I50 K;  2GAG C;  1F7U A;  3K7A K;  1O24 A;  3FKI C;  4GTD A;  3IPJ A;  3OEP A;  1F7V A;  2WB1 L;  4KAW X;  1SFO A;  1INN A;  4RMF A;  4LK1 A;  1ZBS A;  4LJZ A;  3TTG A;  4KMD A;  3NUH A;  3GTO A;  2JA8 K;  3S1R K;  2JA6 K;  1O2B A;  3AD7 C;  1WSV A;  4A3M K;  1XPP A;  2ZFZ A;  5D4D A;  1DCP A;  4QIW L;  3SZZ A;  4BXX C;  4BBR C;  1BS2 A;  1TWC C;  3N0C A;  3PO3 C;  4A3K K;  2R92 C;  3S1Q C;  4OIN A;  1ZQ1 C;  3H3V L;  5TMF A;  4ILD A;  5M5X K;  4OIQ A;  2WB1 D;  4KMH A;  4G7O A;  1EQR A;  5JFE A;  3AD8 C;  4MEY A;  4G7H A;  2EBB A;  4A3E C;  5M3M K;  1JOE A;  1PJ7 A;  3K7A C;  1WCM C;  2XCR B;  1WOO A;  5IP9 K;  3S1N K;  1WQH A;  3GTL K;  3GTG C;  2W7V A;  4BKW A;  1O29 A;  3GEI A;  4AH6 A;  1WOS A;  1ZXO A;  3S2H C;  1WOP A;  1EH1 A;  3S0X A;  2V6T A;  1YNJ A;  4WJ3 M;  1I6H C;  1WCM K;  1J6W A;  4PAA A;  3G4A A;  4AYB L;  5IYD C;  1I6V A;  3GTM C;  4GFQ A;  4Y7N K;  1IE0 A;  3H0G K;  3N3Y A;  2R92 A;  4GTL A;  1XZP B;  4BLB A;  3GTP K;  4GTB A;  2R7Z C;  2Y0S L;  1F93 A;  3L4J A;  2YU9 A;  3AQP A;  1TWA K;  3HOW K;  4BBS K;  3LAJ A;  1TWG K;  1Y1W K;  3TFI A;  2JA5 A;  3WOD A;  4A3J K;  3I4M K;  2JA5 C;  4A3F C;  2JH3 A;  2P5M A;  1TWF K;  1WOR A;  4GT9 A;  4LOW A;  2FQT A;  4YFN A;  4Q4Z A;  1L0W A;  3GTO C;  1TWH A;  3QX3 A;  1WSR A;  2ZUE A;  4KB4 A;  3GTK K;  4C3J C;  2RH6 A;  1YCL A;  3HOV C;  3S2D K;  3T02 A;  4FM9 A;  4OIP A;  1XZP A;  3Q3Q A;  4YFK A;  3FHZ A;  3G4C A;  1IQ0 A;  5C3E C;  1I50 A;  1Y1V K;  1XXB A;  2B63 A;  2A69 A;  2PA8 L;  1O28 A;  4Y52 K;  3BP8 C;  4KN4 A;  1WIH A;  5IP7 C;  4G0U A;  4C3J K;  2A68 A;  3AQO A;  2NVT K;  4KAS A;  3HOV K;  5CJ9 A;  4BY1 C;  1WCM A;  5CHP A;  5TMC A;  5C4J K;  5FJ8 K;  3S15 K;  5JVO A;  1F9N A;  5C44 K;  2VUM K;  2E2H A;  2NVY A;  1WQF A;  4GTF A;  2Y0S D;  4A3B K;  5L46 A;  2A6H A;  1TWA A;  3L4K A;  3N0B A;  5M5Y K;  1DCH A;  1TWC A;  1UV7 A;  4A3D K;  4A3B C;  3M3Y C;  2XCQ A;  1USO A;  5TJ3 A;  4A3G K;  5C44 C;  2E2J C;  3GTG K;  3GTL C;  5C4J C;  3AH5 A;  1C0A A;  1R9T C;  1ISE A;  1K83 C;  5IYC K;  3S1N C;  5E68 A;  4BY1 K;  2WAQ L;  5FLM K;  1SFO K;  4XSZ A;  4Y52 C;  3RZD C;  4A3E K;  2GSO A;  4XCH A;  3HOX C;  5HL8 A;  4C2M K;  3SZY A;  4GTE A;  3ADA C;  3S2D C;  4PAB A;  5C3E K;  4BY7 C;  2E2I C;  3GTK C;  1O27 A;  4X6A C;  4KMU A;  2R92 K;  3S17 C;  4A93 K;  3GTP A;  1ZVU A;  4A3F K;  2NVY C;  4KMA A;  1TWG C;  1Y1W C;  2NVX A;  1TWG A;  2CW0 A;  2JA5 K;  1Y1W A;  1SMY A;  1G51 A;  4WIL A;  4BBS C;  3GTP C;  4KM8 A;  3H0G C;  5C4X K;  4Y7N C;  3GTK A;  3HOX K;  4ZH4 A;  4LK0 A;  4GTC A;  2PA8 D;  3LAP A;  2R93 C;  5FLM C;  5EGE A;  1HI9 A;  1K83 K;  5IYC C;  4KM9 A;  1I50 C;  3S16 K;  2CFA B;  4C3H C;  1J98 A;  1R9T K;  2NVQ K;  2B63 K;  4A3I K;  3TFJ A;  4QJV B;  3HOZ K;  1VLO A;  3S2H K;  1I3Q K;  4GTA A;  5IOS A;  3GDZ A;  5EGH A;  1J6X A;  5IOT A;  2GSU A;  1VGX A;  5IP9 C;  4P5B A;  2R93 K;  2O5J A;  1DD5 A;  2D6F C;  4WJ4 A;  2PHC B;  1O2F B;  3DXJ A;  2YU9 C;  2YU9 K;  3GIR A;  4LQY A;  2R7Z A;  1JVI A;  1B4A A;  4BLA A;  2V6U A;  3VA7 A;  3HOU K;  1TWF A;  4C3I C;  2VUM C;  1JQW A;  3GTM A;  4AYB D;  1V5V A;  1WQG A;  4KC6 A;  4BXX K;  2Y3P A;  3PO3 K;  3RZO K;  1TWC K;  3AD9 C;  3HOZ C;  4A93 C;  1O2A A;  2CFA A;  4A3I C;  3GTQ A;  2NVT C;  3S1R C;  4C3H K;  2E2I K;  1GE9 A;  4A3M C;  2JA8 C;  1IS1 A;  1Y1V A;  2PMZ L;  3HOY K;  2KWA A;  3GTG A;  4Q5S A;  2JA7 K;  3GTQ C;  3S14 K;  3RZD K;  3I4N C;  3OPF A;  3HOY C;  3TFH A;  2V6S A;  3LPX A;  4A3C C;  1KQ4 A;  3FOE A;  2FQO A;  1XXC A;  1O26 A;  3GTJ A;  2VUM A;  3PO2 K;  1BJT A;  2E2J K;  2NVY K;  1IL2 A;  1EI6 A;  4A3J C;  1TWH C;  3EQL A;  3HOW C;  4X6A K;  3HKZ D;  4G7Z A;  2NVX K;  3S1Q K;  4GZY A;  1EK8 A;  4BY7 K;  1EFW A;  1XXA A;  3HXA A;  3GTM K;  5IOQ A;  4G0V A;  5IYD K;  2BE5 A;  5IYB C;  1VH2 A;  4KAR A;  1SFO C;  2P8T A;  1YX2 A;  3GTJ C;  4FZB A;  4XLN A;  3FKI A;  4YG2 A;  4QIW D;  4NOI A;  3CQZ A;  1B4B A;  4G0W A;  3JST A;  1VJE A;  3GEH A;  1I3Q A;  2NVQ C;  3S16 C;  4A3D C;  4DDQ A;  3GEE A;  5IYB K;  1O25 A;  2XCO A;  1Y1V C;  3BUE A;  4JK1 A;  4M1X A;  5C4X C;  3S1M C;  4LLG A;  4C45 A;  1XZQ A;  4A3K C;  2WAQ D;  3A8K A;  1IW7 A;  3PO2 C;  3S15 C;  1TWF C;  4XLP A;  5M5W K;  3ORE A;  3S17 K;  1BGW A;  2RGR A;  2JA6 C;  2PPB A;  3GSI A;  3S1M K;  1ZYR A;  4OIO A;  5IP7 K;  1USM A;  4KAT A;  3I4N K;  4J3N A;  3A8I A;  1XZQ B;  3GTQ K;  3S14 C;  4C2M C;  1K83 A;  3ERE D;  2JA7 A;  4YFX A;  3FKI K;  3CAG A;  1R9T A;  3MML B;  2JA7 C;  3CQZ K;  2PMZ D;  3GTL A;  1DCO A;  4O2D A;  4KN7 A;  2GSN A;  1PJ5 A;  3GTO K;  3RZO C;  2JA6 A;  3GTJ K;  2R93 A;  4P9S A;  5M3F K;  4A3G C;  4C3I K;  4OIR A;  3I4M C;  3M4O C;  2GAH C;  4XSX A;  4LR2 A;  4A3L K;  3M3Y K;  1TWA C;  3H0G A;  3BP3 A;  3T00 A;  2E2H K;  3HOU C;  2R7Z K;  1BDF A;  1PJ6 A;  4KDD A;  3A8J A;  5IOR A;  3T01 A;  2E2H C;  1IBA A;  2NVX C;  4P5A A; 
#chains in the Genus database with same CATH homology
 1TWG A;  3V4G A;  1Y1W A;  2JH3 A;  2P5M A;  4GT9 A;  3FOF A;  1XXA A;  5IOQ A;  4G0V A;  1AB4 A;  1TWH A;  4KM8 A;  3QX3 A;  4KB4 A;  4C3J C;  4KB2 A;  2RH6 A;  4KAR A;  3GTK A;  2E2I A;  4FM9 A;  4GTC A;  3Q3Q A;  3FHZ A;  4FZB A;  3G4C A;  3LAP A;  3FKI A;  5EGE A;  1I50 A;  3CQZ A;  1XXB A;  4KM9 A;  2CFA B;  1B4B A;  4GTD A;  1O24 A;  4C3H C;  2B63 A;  1O28 A;  3OEP A;  4G0W A;  1WIH A;  4P5A A;  4KAW X;  4G0U A;  1I3Q A;  3AQO A;  1SFO A;  4KAS A;  4GTA A;  5CJ9 A;  1ZBS A;  4DDQ A;  5IOS A;  4KMD A;  5EGH A;  3NUH A;  3GTO A;  5IOT A;  2GSU A;  1O25 A;  2XCO A;  1O2B A;  1WCM A;  5CHP A;  4P5B A;  3BUE A;  1DD5 A;  5JVO A;  2ZFZ A;  4M1X A;  1F9N A;  2E2H A;  2NVY A;  2PHC B;  1WQF A;  4GTF A;  4LQY A;  2R7Z A;  3N0C A;  1B4A A;  4BLA A;  3VA7 A;  1TWA A;  3L4K A;  1TWF A;  3N0B A;  4C3I C;  3GTM A;  4ILD A;  1WQG A;  3ORE A;  1TWC A;  4KC6 A;  1BGW A;  2Y3P A;  4KMH A;  5JFE A;  2RGR A;  2XCQ A;  1O2A A;  2CFA A;  5TJ3 A;  4KAT A;  3GTQ A;  4J3N A;  1GE9 A;  1IS1 A;  1Y1V A;  4C2M C;  2XCR B;  1K83 A;  3AH5 A;  2KWA A;  3ERE D;  3GTG A;  2JA7 A;  1WQH A;  1ISE A;  3CAG A;  1R9T A;  3MML B;  4BKW A;  1O29 A;  3GTL A;  1ZXO A;  2GSN A;  1EH1 A;  3S0X A;  2GSO A;  3OPF A;  2JA6 A;  3LPX A;  1KQ4 A;  3G4A A;  4GTE A;  3FOE A;  2R93 A;  1XXC A;  1O26 A;  3GTJ A;  2VUM A;  4GFQ A;  4LR2 A;  1BJT A;  1O27 A;  3N3Y A;  2R92 A;  4GTL A;  4BLB A;  3H0G A;  4GTB A;  3GTP A;  1ZVU A;  3L4J A;  4KDD A;  2YU9 A;  3AQP A;  5IOR A;  3LAJ A;  4KMA A;  2JA5 A;  2NVX A;  1EK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...