2P5MA

C-terminal domain hexamer of ahrc bound with l-arginine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
b'QRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor L-arginine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 24
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2p5mA00
4KC6A 4G0WA 5CJ9A 1AB4A 2Y3PA 3FOEA 3LPXA 1F9NA 1WQFA 3V4GA 2XCOA 1GE9A 1EK8A 1B4BA 1XXCA 3VA7A 3LAJA 4KB4A 4FM9A 1DD5A 2P5MA 4KB2A 4DDQA 5JVOA 1BGWA 3FHZA 4G0UA 2PHCB 4KDDA 1WIHA 1ZVUA 1ISEA 1BJTA 3LAPA 1EH1A 4J3NA 3MMLB 1XXAA 2KWAA 3L4JA 3OEPA 3BUEA 2XCRB 3ERED 2ZFZA 3FOFA 1WQHA 1B4AA 3L4KA 2RGRA 4KAWX 1XXBA 3OPFA 3NUHA 4GFQA 3OREA 1IS1A 2XCQA 3CAGA 3QX3A 4G0VA 1WQGA
chains in the Genus database with same CATH superfamily
1SMYA 1Y1VC 3GTLA 4Y52C 1USOA 4C3IC 3FHZA 1ISEA 4KMHA 3SZYA 3MMLB 3T02A 4LK1A 2R92C 3S17K 2O5JA 4A3EC 2E2HC 3K7AK 1XZPA 3GTOA 3HOXC 4C3HK 3FKIK 3OPFA 4YFNA 1F7VA 1JQWA 3S15C 4KC6A 2ZUFA 3WODA 3S2HK 4Y7NK 3LPXA 1I50C 1DD5A 4C3JC 1BDFA 4BY1K 4MEYA 4GTCA 2JA7A 1TWGC 1Y1WA 1Y1VK 3S1NC 2NVXA 3AQPA 3IPJA 3GTQA 1XZQB 1TWFC 2NVTC 3OEPA 1TWCK 4GT9A 1F93A 1K83K 1O26A 2V6TA 4A93C 3HOVC 1IS1A 3GTPA 1VLOA 1INNA 2JA5A 3V4GA 2E2HK 4FZBA 4ZH4A 3T01A 4A3FC 3HOXK 1XXCA 5M5XK 1WSVA 3AD8C 3S15K 2JA6A 1WIHA 1SFOC 4LJZA 2R7ZC 3GTJC 3LAPA 4YFKA 1I50K 2RH6A 4C3JK 1XXAA 3S1MK 2R93A 2GSUA 5IP9C 2V6UA 5M3FK 3M4OK 4YG2A 4WILA 3GEEA 4GTDA 4PABA 5C44C 3HOYK 4A3LK 3I4MC 1WOSA 4OIQA 4X6AC 2PPBA 4A93K 4YFXA 1VH2A 4BBSC 1BS2A 3S1RK 1IE0A 4PAAA 1EH1A 4G7ZA 2Y0SD 5EGHA 5IYCC 3RZOK 3PO3K 4BY7K 3GEHA 5M5YK 1I3QA 1I6HK 2R7ZK 1B4AA 3L4KA 1WOOA 3GTMC 3TFHA 3GTGK 5IP9K 3A8IA 2JH3A 4G7OA 1WCMC 3VA7A 4KB4A 2NVQK 3AQOA 1F7UA 3K7AC 5C44K 3I4MK 4X6AK 4J3NA 4C3HC 4WJ4A 5HL8A 2R92A 1O28A 1J6WA 2E2JK 3S2DK 4KN4A 4Y7NC 1O2AA 1DCHA 1J6VA 4C45A 1O2BA 4BY1C 3H0GK 5IYCK 4GTFA 3CQZC 3H3VL 2V6SA 4A3CC 3ADAC 4KB2A 5JVOA 2CFAB 3GTMK 1TWGA 3S1QK 3HOWK 2A6EA 1TWCC 1JVIA 1WCMK 1K83C 1TWFA 3GIRA 2VUMK 4A3GK 5C4XK 1XZQA 1I6VA 3GTKK 2A68A 4Q4ZA 3M3YC 1IBAA 3QX3A 2W7VA 4LLGA 4MQ9A 4G0WA 1V5VA 2BE5A 1EK8A 5FLMK 3T00A 1IQ0A 4DDQA 1WOPA 1VJEA 3JSTA 3S1MC 2EBBA 1SFOA 1G51A 3DXJA 4P5BA 4GTLA 1ZVUA 4O2DA 1BJTA 3GTJA 3HOUC 3CQZK 5IOQA 4KN7A 3M4OC 3N0BA 3G4CA 2E2IC 3L4JA 2D6FC 4A3CK 1TWHK 3HOYC 2YU9A 1WQHA 4A3LC 4KARA 4KM8A 4KAWX 3SZZA 1TWAK 3OREA 3S16C 3CAGA 2B63K 3GTLC 1GE9A 4LR2A 3S1RC 4A3DC 3S14K 3M3YK 3EQLA 3RZOC 3PO3C 1R9TA 4BY7C 4XCHA 1I6HC 4A3MC 4QJVB 3GEIA 2XCRB 3GTGC 4KMDA 2PA8L 2WB1L 4GTAA 1EQRA 3HOUK 2NVYK 3NUHA 4GFQA 3S0XA 2NVQC 3I4NK 2E2IK 3FOEA 1O29A 1IW7A 5C3EK 5JFEA 2JA8K 1PJ6A 1XPPA 3PO2K 3S16K 3S2DC 1Y1WC 2E2JC 4Q5SA 3GTLK 4GTBA 4G7HA 3AD9C 3FKIA 1L0WA 4A3DK 1USMA 4NOIA 3H0GC 3HKZD 3HKZL 4A3BC 1JOEA 1WSRA 5FJ8K 1O24A 1ZYRA 4A3MK 5IOSA 1O25A 3S1QC 4OIRA 3HOWC 1Y1VA 3BP8C 2CW0A 3GTOK 4JK1A 5IYDK 3TFJA 4P9SA 4XSZA 1EI6A 1TWCA 2VUMC 4A3GC 4KASA 4MEXA 2GAGC 5C4XC 2CFAA 1K83A 4C2MC 3GTKC 1C0AA 5M5WK 4KM9A 2FQOA 2R93C 3BUEA 2JA7K 1Y1WK 3N0CA 2E2HA 1VGXA 5TJ3A 1O2FB 4BBRK 2NVXK 1J6XA 5FLMC 1DCOA 1HQMA 3GTQK 5IORA 4AYBD 4AYBL 3Q3QA 2Y3PA 1B4BA 1ZBSA 4KMAA 1I50A 4A3BK 3H3VD 3GTPK 2FQTA 5E68A 5IOTA 4A3KC 1TWHC 3A8KA 2JA5K 2GSOA 1TWAC 2O5IA 4OIOA 4QIWL 4QIWD 2B63C 2JA6K 4WJ3M 1I3QC 3AH5A 4C2MK 3S14C 1WORA 4BXXK 5D4DA 4XLPA 2R93K 1AB4A 4BKWA 3G4AA 4LK0A 4A3IK 4G0UA 3RZDC 3TFIA 2WAQD 2WAQL 2R7ZA 3BP3A 2NVYC 3GTGA 3I4NC 5EGEA 4A3KK 2ZFZA 4QJVA 1RU0A 5L46A 4BLBA 5IYBK 5C3EC 2JA8C 2XCQA 2GSNA 1WQGA 1O27A 4OIPA 3PO2C 1DCPA 5CJ9A 1I3QK 3HOZK 2GAHC 4LOWA 2P8TA 1YCLA 3HXAA 4Y52K 5TMFA 4GTEA 1XZPB 2ZUEA 4C3IK 3H0GA 1KQ4A 1YX2A 1X31C 3RZDK 2PA8D 1IL2A 3GTOC 2WB1D 4GZYA 1XXBA 4ILDA 5IYDC 2R92K 3GTMA 4G0VA 4A3EK 1J98A 4M1XA 1WCMA 3LAJA 4FM9A 3AD7C 1UV7A 5C4JC 2JA7C 2VUMA 2PMZL 2PMZD 1ZQ1C 4BBRC 2NVXC 3GTKA 3GTQC 5IP7C 1TWGK 5TMCA 2YU9C 3GDZA 3S1NK 2RGRA 1TWFK 3GTPC 2NVTK 1ZXOA 1HI9A 1F9NA 2JA5C 2XCOA 3CQZA 5CHPA 3HOVK 2P5MA 1BGWA 1TWHA 2JA6C 1R9TC 4OINA 3GSIA 4A3FK 2A6HA 1YNJA 1TWAA 2Y0SL 4A3JC 4BXXC 2B63A 1SFOK 5C4JK 3FOFA 4KMUA 3GTJK 4LQYA 4A3IC 5IP7K 2A69A 1PJ5A 4XLNA 1WQFA 4RMFA 2YU9K 4KATA 4P5AA 1PJ7A 2PHCB 1VRQC 1YNNA 3N3YA 4KDDA 3S17C 3A8JA 3FKIC 2NVYA 4BLAA 4XSXA 5M3MK 5IYBC 4AH6A 2KWAA 2E2IA 3S2HC 3ERED 4BBSK 3TTGA 1R9TK 3HOZC 1EFWA 4A3JK
chains in the Genus database with same CATH topology
1O27A 3GTLA 5CJ9A 3FOEA 2JH3A 1O29A 3VA7A 4KB4A 5JFEA 4C3IC 3FHZA 3AQOA 4GTBA 1ISEA 4KMHA 3FKIA 4J3NA 4C3HC 3MMLB 4GTEA 3H0GA 2R92A 1O28A 1KQ4A 1O2AA 3GTOA 1XXBA 3OPFA 1O24A 4ILDA 1O2BA 5IOSA 1O25A 3GTMA 4G0VA 4KC6A 1Y1VA 3LPXA 4GTFA 4M1XA 1WCMA 3LAJA 4FM9A 1DD5A 4C3JC 4KB2A 5JVOA 2CFAB 4GTCA 1TWGA 2JA7A 1Y1WA 1TWCA 2VUMA 4KASA 2NVXA 2CFAA 1K83A 3GTKA 4C2MC 3AQPA 3GTQA 1TWFA 4KM9A 3OEPA 3BUEA 3N0CA 4GT9A 2E2HA 5TJ3A 2RGRA 1O26A 1IS1A 3GTPA 3QX3A 1ZXOA 5IORA 4G0WA 3Q3QA 2Y3PA 2JA5A 1F9NA 3V4GA 2XCOA 4FZBA 1EK8A 1B4BA 1ZBSA 3CQZA 1XXCA 4KMAA 1I50A 5CHPA 2P5MA 4DDQA 1BGWA 5IOTA 1TWHA 2JA6A 1SFOA 1WIHA 4P5BA 4GTLA 1ZVUA 1BJTA 3GTJA 3LAPA 5IOQA 1TWAA 2GSOA 2RH6A 3N0BA 1XXAA 3G4CA 3L4JA 2R93A 2B63A 2GSUA 3FOFA 2YU9A 1WQHA 3AH5A 4KARA 4KM8A 4KAWX 3OREA 4LQYA 3CAGA 1AB4A 4GTDA 1GE9A 4LR2A 1WQFA 4BKWA 3G4AA 4KATA 4P5AA 4G0UA 2PHCB 3N3YA 4KDDA 1R9TA 2R7ZA 1EH1A 2NVYA 4BLAA 5EGHA 2KWAA 3GTGA 2E2IA 2XCRB 3ERED 5EGEA 2ZFZA 4KMDA 1I3QA 4GTAA 1B4AA 3L4KA 4BLBA 3NUHA 4GFQA 3S0XA 2XCQA 2GSNA 1WQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KC6 A;  4G0W A;  5CJ9 A;  1AB4 A;  2Y3P A;  3FOE A;  3LPX A;  1F9N A;  1WQF A;  3V4G A;  2XCO A;  1GE9 A;  1EK8 A;  1B4B A;  1XXC A;  3VA7 A;  3LAJ A;  4KB4 A;  4FM9 A;  1DD5 A;  2P5M A;  4KB2 A;  4DDQ A;  5JVO A;  1BGW A;  3FHZ A;  4G0U A;  2PHC B;  4KDD A;  1WIH A;  1ZVU A;  1ISE A;  1BJT A;  3LAP A;  1EH1 A;  4J3N A;  3MML B;  1XXA A;  2KWA A;  3L4J A;  3OEP A;  3BUE A;  2XCR B;  3ERE D;  2ZFZ A;  3FOF A;  1WQH A;  1B4A A;  3L4K A;  2RGR A;  4KAW X;  1XXB A;  3OPF A;  3NUH A;  4GFQ A;  3ORE A;  1IS1 A;  2XCQ A;  3CAG A;  3QX3 A;  4G0V A;  1WQG A; 
#chains in the Genus database with same CATH topology
 1SMY A;  1Y1V C;  3GTL A;  4Y52 C;  1USO A;  4C3I C;  3FHZ A;  1ISE A;  4KMH A;  3SZY A;  3MML B;  3T02 A;  4LK1 A;  2R92 C;  3S17 K;  2O5J A;  4A3E C;  2E2H C;  3K7A K;  1XZP A;  3GTO A;  3HOX C;  4C3H K;  3FKI K;  3OPF A;  4YFN A;  1F7V A;  1JQW A;  3S15 C;  4KC6 A;  2ZUF A;  3WOD A;  3S2H K;  4Y7N K;  3LPX A;  1I50 C;  1DD5 A;  4C3J C;  1BDF A;  4BY1 K;  4MEY A;  4GTC A;  2JA7 A;  1TWG C;  1Y1W A;  1Y1V K;  3S1N C;  2NVX A;  3AQP A;  3IPJ A;  3GTQ A;  1XZQ B;  1TWF C;  2NVT C;  3OEP A;  1TWC K;  4GT9 A;  1F93 A;  1K83 K;  1O26 A;  2V6T A;  4A93 C;  3HOV C;  1IS1 A;  3GTP A;  1VLO A;  1INN A;  2JA5 A;  3V4G A;  2E2H K;  4FZB A;  4ZH4 A;  3T01 A;  4A3F C;  3HOX K;  1XXC A;  5M5X K;  1WSV A;  3AD8 C;  3S15 K;  2JA6 A;  1WIH A;  1SFO C;  4LJZ A;  2R7Z C;  3GTJ C;  3LAP A;  4YFK A;  1I50 K;  2RH6 A;  4C3J K;  1XXA A;  3S1M K;  2R93 A;  2GSU A;  5IP9 C;  2V6U A;  5M3F K;  3M4O K;  4YG2 A;  4WIL A;  3GEE A;  4GTD A;  4PAB A;  5C44 C;  3HOY K;  4A3L K;  3I4M C;  1WOS A;  4OIQ A;  4X6A C;  2PPB A;  4A93 K;  4YFX A;  1VH2 A;  4BBS C;  1BS2 A;  3S1R K;  1IE0 A;  4PAA A;  1EH1 A;  4G7Z A;  2Y0S D;  5EGH A;  5IYC C;  3RZO K;  3PO3 K;  4BY7 K;  3GEH A;  5M5Y K;  1I3Q A;  1I6H K;  2R7Z K;  1B4A A;  3L4K A;  1WOO A;  3GTM C;  3TFH A;  3GTG K;  5IP9 K;  3A8I A;  2JH3 A;  4G7O A;  1WCM C;  3VA7 A;  4KB4 A;  2NVQ K;  3AQO A;  1F7U A;  3K7A C;  5C44 K;  3I4M K;  4X6A K;  4J3N A;  4C3H C;  4WJ4 A;  5HL8 A;  2R92 A;  1O28 A;  1J6W A;  2E2J K;  3S2D K;  4KN4 A;  4Y7N C;  1O2A A;  1DCH A;  1J6V A;  4C45 A;  1O2B A;  4BY1 C;  3H0G K;  5IYC K;  4GTF A;  3CQZ C;  3H3V L;  2V6S A;  4A3C C;  3ADA C;  4KB2 A;  5JVO A;  2CFA B;  3GTM K;  1TWG A;  3S1Q K;  3HOW K;  2A6E A;  1TWC C;  1JVI A;  1WCM K;  1K83 C;  1TWF A;  3GIR A;  2VUM K;  4A3G K;  5C4X K;  1XZQ A;  1I6V A;  3GTK K;  2A68 A;  4Q4Z A;  3M3Y C;  1IBA A;  3QX3 A;  2W7V A;  4LLG A;  4MQ9 A;  4G0W A;  1V5V A;  2BE5 A;  1EK8 A;  5FLM K;  3T00 A;  1IQ0 A;  4DDQ A;  1WOP A;  1VJE A;  3JST A;  3S1M C;  2EBB A;  1SFO A;  1G51 A;  3DXJ A;  4P5B A;  4GTL A;  1ZVU A;  4O2D A;  1BJT A;  3GTJ A;  3HOU C;  3CQZ K;  5IOQ A;  4KN7 A;  3M4O C;  3N0B A;  3G4C A;  2E2I C;  3L4J A;  2D6F C;  4A3C K;  1TWH K;  3HOY C;  2YU9 A;  1WQH A;  4A3L C;  4KAR A;  4KM8 A;  4KAW X;  3SZZ A;  1TWA K;  3ORE A;  3S16 C;  3CAG A;  2B63 K;  3GTL C;  1GE9 A;  4LR2 A;  3S1R C;  4A3D C;  3S14 K;  3M3Y K;  3EQL A;  3RZO C;  3PO3 C;  1R9T A;  4BY7 C;  4XCH A;  1I6H C;  4A3M C;  4QJV B;  3GEI A;  2XCR B;  3GTG C;  4KMD A;  2PA8 L;  2WB1 L;  4GTA A;  1EQR A;  3HOU K;  2NVY K;  3NUH A;  4GFQ A;  3S0X A;  2NVQ C;  3I4N K;  2E2I K;  3FOE A;  1O29 A;  1IW7 A;  5C3E K;  5JFE A;  2JA8 K;  1PJ6 A;  1XPP A;  3PO2 K;  3S16 K;  3S2D C;  1Y1W C;  2E2J C;  4Q5S A;  3GTL K;  4GTB A;  4G7H A;  3AD9 C;  3FKI A;  1L0W A;  4A3D K;  1USM A;  4NOI A;  3H0G C;  3HKZ D;  3HKZ L;  4A3B C;  1JOE A;  1WSR A;  5FJ8 K;  1O24 A;  1ZYR A;  4A3M K;  5IOS A;  1O25 A;  3S1Q C;  4OIR A;  3HOW C;  1Y1V A;  3BP8 C;  2CW0 A;  3GTO K;  4JK1 A;  5IYD K;  3TFJ A;  4P9S A;  4XSZ A;  1EI6 A;  1TWC A;  2VUM C;  4A3G C;  4KAS A;  4MEX A;  2GAG C;  5C4X C;  2CFA A;  1K83 A;  4C2M C;  3GTK C;  1C0A A;  5M5W K;  4KM9 A;  2FQO A;  2R93 C;  3BUE A;  2JA7 K;  1Y1W K;  3N0C A;  2E2H A;  1VGX A;  5TJ3 A;  1O2F B;  4BBR K;  2NVX K;  1J6X A;  5FLM C;  1DCO A;  1HQM A;  3GTQ K;  5IOR A;  4AYB D;  4AYB L;  3Q3Q A;  2Y3P A;  1B4B A;  1ZBS A;  4KMA A;  1I50 A;  4A3B K;  3H3V D;  3GTP K;  2FQT A;  5E68 A;  5IOT A;  4A3K C;  1TWH C;  3A8K A;  2JA5 K;  2GSO A;  1TWA C;  2O5I A;  4OIO A;  4QIW L;  4QIW D;  2B63 C;  2JA6 K;  4WJ3 M;  1I3Q C;  3AH5 A;  4C2M K;  3S14 C;  1WOR A;  4BXX K;  5D4D A;  4XLP A;  2R93 K;  1AB4 A;  4BKW A;  3G4A A;  4LK0 A;  4A3I K;  4G0U A;  3RZD C;  3TFI A;  2WAQ D;  2WAQ L;  2R7Z A;  3BP3 A;  2NVY C;  3GTG A;  3I4N C;  5EGE A;  4A3K K;  2ZFZ A;  4QJV A;  1RU0 A;  5L46 A;  4BLB A;  5IYB K;  5C3E C;  2JA8 C;  2XCQ A;  2GSN A;  1WQG A;  1O27 A;  4OIP A;  3PO2 C;  1DCP A;  5CJ9 A;  1I3Q K;  3HOZ K;  2GAH C;  4LOW A;  2P8T A;  1YCL A;  3HXA A;  4Y52 K;  5TMF A;  4GTE A;  1XZP B;  2ZUE A;  4C3I K;  3H0G A;  1KQ4 A;  1YX2 A;  1X31 C;  3RZD K;  2PA8 D;  1IL2 A;  3GTO C;  2WB1 D;  4GZY A;  1XXB A;  4ILD A;  5IYD C;  2R92 K;  3GTM A;  4G0V A;  4A3E K;  1J98 A;  4M1X A;  1WCM A;  3LAJ A;  4FM9 A;  3AD7 C;  1UV7 A;  5C4J C;  2JA7 C;  2VUM A;  2PMZ L;  2PMZ D;  1ZQ1 C;  4BBR C;  2NVX C;  3GTK A;  3GTQ C;  5IP7 C;  1TWG K;  5TMC A;  2YU9 C;  3GDZ A;  3S1N K;  2RGR A;  1TWF K;  3GTP C;  2NVT K;  1ZXO A;  1HI9 A;  1F9N A;  2JA5 C;  2XCO A;  3CQZ A;  5CHP A;  3HOV K;  2P5M A;  1BGW A;  1TWH A;  2JA6 C;  1R9T C;  4OIN A;  3GSI A;  4A3F K;  2A6H A;  1YNJ A;  1TWA A;  2Y0S L;  4A3J C;  4BXX C;  2B63 A;  1SFO K;  5C4J K;  3FOF A;  4KMU A;  3GTJ K;  4LQY A;  4A3I C;  5IP7 K;  2A69 A;  1PJ5 A;  4XLN A;  1WQF A;  4RMF A;  2YU9 K;  4KAT A;  4P5A A;  1PJ7 A;  2PHC B;  1VRQ C;  1YNN A;  3N3Y A;  4KDD A;  3S17 C;  3A8J A;  3FKI C;  2NVY A;  4BLA A;  4XSX A;  5M3M K;  5IYB C;  4AH6 A;  2KWA A;  2E2I A;  3S2H C;  3ERE D;  4BBS K;  3TTG A;  1R9T K;  3HOZ C;  1EFW A;  4A3J K; 
#chains in the Genus database with same CATH homology
 1O27 A;  3GTL A;  5CJ9 A;  3FOE A;  2JH3 A;  1O29 A;  3VA7 A;  4KB4 A;  5JFE A;  4C3I C;  3FHZ A;  3AQO A;  4GTB A;  1ISE A;  4KMH A;  3FKI A;  4J3N A;  4C3H C;  3MML B;  4GTE A;  3H0G A;  2R92 A;  1O28 A;  1KQ4 A;  1O2A A;  3GTO A;  1XXB A;  3OPF A;  1O24 A;  4ILD A;  1O2B A;  5IOS A;  1O25 A;  3GTM A;  4G0V A;  4KC6 A;  1Y1V A;  3LPX A;  4GTF A;  4M1X A;  1WCM A;  3LAJ A;  4FM9 A;  1DD5 A;  4C3J C;  4KB2 A;  5JVO A;  2CFA B;  4GTC A;  1TWG A;  2JA7 A;  1Y1W A;  1TWC A;  2VUM A;  4KAS A;  2NVX A;  2CFA A;  1K83 A;  3GTK A;  4C2M C;  3AQP A;  3GTQ A;  1TWF A;  4KM9 A;  3OEP A;  3BUE A;  3N0C A;  4GT9 A;  2E2H A;  5TJ3 A;  2RGR A;  1O26 A;  1IS1 A;  3GTP A;  3QX3 A;  1ZXO A;  5IOR A;  4G0W A;  3Q3Q A;  2Y3P A;  2JA5 A;  1F9N A;  3V4G A;  2XCO A;  4FZB A;  1EK8 A;  1B4B A;  1ZBS A;  3CQZ A;  1XXC A;  4KMA A;  1I50 A;  5CHP A;  2P5M A;  4DDQ A;  1BGW A;  5IOT A;  1TWH A;  2JA6 A;  1SFO A;  1WIH A;  4P5B A;  4GTL A;  1ZVU A;  1BJT A;  3GTJ A;  3LAP A;  5IOQ A;  1TWA A;  2GSO A;  2RH6 A;  3N0B A;  1XXA A;  3G4C A;  3L4J A;  2R93 A;  2B63 A;  2GSU A;  3FOF A;  2YU9 A;  1WQH A;  3AH5 A;  4KAR A;  4KM8 A;  4KAW X;  3ORE A;  4LQY A;  3CAG A;  1AB4 A;  4GTD A;  1GE9 A;  4LR2 A;  1WQF A;  4BKW A;  3G4A A;  4KAT A;  4P5A A;  4G0U A;  2PHC B;  3N3Y A;  4KDD A;  1R9T A;  2R7Z A;  1EH1 A;  2NVY A;  4BLA A;  5EGH A;  2KWA A;  3GTG A;  2E2I A;  2XCR B;  3ERE D;  5EGE A;  2ZFZ A;  4KMD A;  1I3Q A;  4GTA A;  1B4A A;  3L4K A;  4BLB A;  3NUH A;  4GFQ A;  3S0X A;  2XCQ A;  2GSN A;  1WQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...