2P5MA

C-terminal domain hexamer of ahrc bound with l-arginine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
QRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor L-arginine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 24
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2p5mA00
1F9NA 4DDQA 1IS1A 1EK8A 4GFQA 1WQFA 4KAWX 3LAJA 3BUEA 3V4GA 3LPXA 2ZFZA 3OREA 4KB4A 3FOFA 4FM9A 2KWAA 1WQGA 3L4KA 4G0WA 1WQHA 2PHCB 1ISEA 3MMLB 1XXAA 4KC6A 4G0UA 3ERED 1B4AA 2Y3PA 2P5MA 3OPFA 3FOEA 3QX3A 1DD5A 1WIHA 4KB2A 3VA7A 1B4BA 2XCQA 2XCOA 4G0VA 1BGWA 5JVOA 3FHZA 1EH1A 1ZVUA 4KDDA 5CJ9A 2XCRB 1XXBA 3NUHA 2RGRA 3L4JA 3CAGA 4J3NA 3LAPA 1BJTA 1GE9A 3OEPA 1AB4A 1XXCA
chains in the Genus database with same CATH superfamily
1IS1A 3GTMK 2NVYC 3HKZD 3EQLA 5C4JC 2JA6K 1R9TC 2KWAA 1WQGA 4G0WA 3GTMA 4A93K 3BP8C 5IP7C 2JA6A 4A3MC 3HXAA 4A3FK 2YU9C 1WIHA 5C4XC 3S2HK 3A8JA 2R93C 4P5AA 1ZVUA 2NVTK 3A8KA 2JH3A 1WOPA 5IORA 1X31C 3H3VD 2PA8D 5IOSA 1GE9A 4Y7NC 1F9NA 2NVYA 3S1QK 1YNNA 1R9TA 1V5VA 2R92K 2JA5C 1TWGC 3HOZK 1KQ4A 3MMLB 4BBRC 1J6WA 2YU9A 4C3HK 2R92A 3RZDC 1SFOK 1YCLA 3S2DK 4AH6A 1IL2A 1I6HK 5FJ8K 1JQWA 1Y1VK 2CFAA 3HOXK 2Y0SL 4JK1A 3FOFA 2JA5A 1TWGA 1UV7A 1Y1VA 1I3QC 1ZQ1C 2PMZL 3S14K 2WB1D 2A68A 1HI9A 4KB2A 1VGXA 3GTJC 3GTGK 3VA7A 4LLGA 2XCQA 3TFHA 3N0CA 1YX2A 4P5BA 4YG2A 1O2BA 1TWCC 3L4JA 2O5JA 1WOSA 1PJ5A 4C3JC 4A3BK 3HKZL 1VJEA 2E2JC 3V4GA 3LPXA 4A3JC 1EFWA 3GTKK 3K7AC 4YFXA 3GTPK 1I3QA 2VUMC 5C44C 4ILDA 1Y1WC 5IP9C 2R7ZK 4X6AC 2P5MA 5FLMC 3GTKA 1VLOA 2E2IK 1XZPA 1TWCA 1JOEA 3AD8C 1G51A 1TWHC 4A3JK 3H3VL 2PA8L 3JSTA 3HOYC 2ZUEA 2V6UA 4A3CK 3GSIA 3AD7C 1L0WA 5C44K 1EK8A 2JA7K 5FLMK 3OREA 5C3EK 2GAHC 3PO3C 3S15C 5M5WK 2VUMA 3I4MK 4C2MK 2E2HC 1Y1WA 3GTLK 3GTMC 3HOUK 3AH5A 4YFNA 3QX3A 2JA6C 2NVXK 4GTCA 3GTLA 5IOQA 3FHZA 1O2AA 3S1RK 4A93C 1WORA 2NVXA 4A3FC 1USMA 1BJTA 1PJ6A 1F7UA 4Y52K 3S1NK 5D4DA 4A3DK 5TMCA 1YNJA 3M4OC 4BBSK 2NVTC 2P8TA 4A3LK 2E2HA 3S16K 2PHCB 2A69A 1F7VA 4KM9A 1RU0A 3S1QC 3FOEA 4C45A 2O5IA 3BP3A 3AQOA 4GTEA 2R92C 1IE0A 3HOZC 1I50K 5CJ9A 3M4OK 3SZYA 4WILA 4C3HC 4MEYA 4OIOA 3GDZA 1K83K 1SMYA 3GIRA 1SFOC 4A3IK 3S2DC 3L4KA 2FQTA 1IQ0A 1I6HC 3GTOK 1XXAA 4QIWL 4BY7K 4A3GK 1Y1VC 3G4AA 3HOXC 1DD5A 2WAQD 4WJ4A 2NVQK 3AQPA 2CW0A 2XCOA 3GTOA 1BGWA 4XLNA 3S14C 4BY1K 1USOA 3GTGC 2EBBA 4M1XA 4PAAA 2ZUFA 1I6VA 1EI6A 4A3KK 1SFOA 4XSZA 1O25A 3ADAC 1J6XA 4A3BC 3N3YA 4BLBA 3M3YK 3GTKC 4XCHA 1DCPA 3GTPC 4XSXA 1IBAA 4GTLA 2RGRA 4BXXK 1TWAK 2R7ZC 4GTAA 3GTGA 2E2IC 4OIQA 1O29A 4GFQA 4QJVB 1EQRA 4OIRA 4A3CC 1TWFK 2RH6A 3HOWK 4Q5SA 5IYCK 2PPBA 3OPFA 4MQ9A 2JA7C 3SZZA 3CQZK 5IYBK 3S0XA 5C3EC 4QJVA 4KMDA 3GTPA 4LK0A 3S1MK 3I4MC 4C2MC 3WODA 4BLAA 2R7ZA 5IYDK 3GTLC 4AYBD 1J6VA 3IPJA 3HOUC 4J3NA 3LAPA 4C3IC 2E2IA 2NVXC 3GTQK 3BUEA 1O27A 3S1RC 5L46A 1F93A 4GTFA 4Y52C 3S1NC 2JA7A 4A3DC 4Q4ZA 2V6SA 4OIPA 1WCMK 4KATA 4C3IK 4BBSC 4LQYA 3RZOK 4A3LC 3I4NK 3S16C 1EH1A 2A6HA 3FKIK 1WOOA 3GEEA 1WCMA 2A6EA 1HQMA 2W7VA 4P9SA 2Y0SD 1I50C 4GTDA 3T00A 1BDFA 1WSRA 4KC6A 4G7HA 2GSUA 2WB1L 1K83C 4A3EK 4PABA 4A3IC 3GTOC 3GEIA 3PO2K 4BY7C 4A3GC 4LOWA 5M3MK 5M5YK 3AD9C 4FZBA 2NVQC 1XXCA 4ZH4A 1I50A 5TJ3A 4BY1C 5M5XK 1O24A 1K83A 3S17K 3ERED 4A3KC 4OINA 4KN4A 2GSOA 2B63K 2NVYK 3HOVC 5C4JK 4LR2A 5JVOA 4AYBL 1R9TK 3CAGA 2B63A 4MEXA 3Q3QA 2JA8C 3M3YC 2D6FC 1INNA 5IP7K 4DDQA 1BS2A 4A3MK 2YU9K 5HL8A 1J98A 1C0AA 3LAJA 4KARA 4LK1A 5C4XK 4BXXC 4KMHA 1TWAC 2R93K 3HOVK 5EGEA 4KASA 4G0UA 3H0GC 3T01A 1B4AA 1VH2A 4O2DA 4GTBA 4Y7NK 2JA8K 2CFAB 2R93A 1O26A 1IW7A 4KDDA 5TMFA 1TWFC 3HOWC 5IYCC 2JA5K 1DCHA 1TWGK 3CQZC 1AB4A 4BBRK 5IYBC 1ZBSA 3H0GK 1WQFA 3S1MC 3T02A 1TWAA 5E68A 5IYDC 4YFKA 4FM9A 4GZYA 1XPPA 3DXJA 4GT9A 3RZDK 1VRQC 1ISEA 4G7OA 3H0GA 5JFEA 2B63C 3GTQC 3N0BA 2BE5A 1O28A 1TWFA 4NOIA 1XXBA 3TTGA 3CQZA 5M3FK 1WCMC 3OEPA 3S2HC 1I3QK 1DCOA 4KM8A 3RZOC 1XZPB 3GTJK 3I4NC 4KAWX 3TFIA 3FKIC 3TFJA 4KB4A 1ZXOA 1PJ7A 1WQHA 5IOTA 4QIWD 1TWCK 3GTJA 3GTQA 2WAQL 4C3JK 3G4CA 1XZQB 2GSNA 4G0VA 2E2JK 2XCRB 3K7AK 3A8IA 4RMFA 1O2FB 4A3EC 2VUMK 2FQOA 1Y1WK 5IP9K 1XZQA 4X6AK 4WJ3M 1WSVA 4KMAA 4KN7A 4XLPA 3FKIA 1JVIA 2ZFZA 3PO2C 2GAGC 1ZYRA 4KMUA 5EGHA 1TWHK 3HOYK 2Y3PA 2PMZD 2V6TA 1B4BA 1TWHA 3NUHA 3PO3K 3GEHA 3S15K 3S17C 4LJZA 4BKWA 4G7ZA 2E2HK 5CHPA
chains in the Genus database with same CATH topology
4DDQA 1IS1A 1EK8A 1O29A 4GFQA 3LAJA 4KARA 3OREA 4KMHA 2KWAA 1WQGA 4G0WA 2VUMA 5EGEA 3GTMA 4KASA 2RH6A 1Y1WA 4G0UA 2JA6A 1B4AA 3AH5A 3OPFA 3QX3A 1WIHA 4GTBA 2CFAB 2R93A 3S0XA 1O26A 4KMDA 4GTCA 3GTPA 3GTLA 5IOQA 4KDDA 1ZVUA 4P5AA 4C2MC 1O2AA 2JH3A 3FHZA 4BLAA 2R7ZA 5IORA 2NVXA 4J3NA 3LAPA 4C3IC 1BJTA 5IOSA 2E2IA 1GE9A 1AB4A 1F9NA 1ZBSA 2NVYA 1WQFA 3BUEA 1R9TA 1O27A 1TWAA 4GTFA 4FM9A 4GT9A 2E2HA 2PHCB 1ISEA 1KQ4A 3MMLB 3H0GA 2YU9A 4KM9A 2JA7A 5JFEA 3FOEA 3N0BA 4KATA 2R92A 4LQYA 3AQOA 4GTEA 1O28A 1TWFA 1EH1A 5CJ9A 1XXBA 1WCMA 3CQZA 4C3HC 3OEPA 4KM8A 2CFAA 4KAWX 3FOFA 4KB4A 4GTDA 1ZXOA 2JA5A 3L4KA 1TWGA 1WQHA 5IOTA 1Y1VA 4KC6A 1XXAA 2GSUA 3GTJA 3GTQA 3G4AA 1DD5A 4KB2A 3G4CA 3AQPA 2GSNA 3VA7A 2XCQA 2XCOA 4G0VA 3GTOA 1BGWA 3N0CA 4P5BA 2XCRB 1O2BA 3L4JA 4FZBA 4C3JC 1XXCA 4M1XA 4KMAA 1SFOA 3FKIA 1I50A 3V4GA 3LPXA 2ZFZA 5TJ3A 1O25A 1I3QA 5EGHA 1O24A 1K83A 4ILDA 3ERED 2Y3PA 3N3YA 2P5MA 4BLBA 3GTKA 2GSOA 1B4BA 1TWHA 4LR2A 5JVOA 1TWCA 4GTLA 3NUHA 2RGRA 3CAGA 4GTAA 4BKWA 2B63A 3Q3QA 3GTGA 5CHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9N A;  4DDQ A;  1IS1 A;  1EK8 A;  4GFQ A;  1WQF A;  4KAW X;  3LAJ A;  3BUE A;  3V4G A;  3LPX A;  2ZFZ A;  3ORE A;  4KB4 A;  3FOF A;  4FM9 A;  2KWA A;  1WQG A;  3L4K A;  4G0W A;  1WQH A;  2PHC B;  1ISE A;  3MML B;  1XXA A;  4KC6 A;  4G0U A;  3ERE D;  1B4A A;  2Y3P A;  2P5M A;  3OPF A;  3FOE A;  3QX3 A;  1DD5 A;  1WIH A;  4KB2 A;  3VA7 A;  1B4B A;  2XCQ A;  2XCO A;  4G0V A;  1BGW A;  5JVO A;  3FHZ A;  1EH1 A;  1ZVU A;  4KDD A;  5CJ9 A;  2XCR B;  1XXB A;  3NUH A;  2RGR A;  3L4J A;  3CAG A;  4J3N A;  3LAP A;  1BJT A;  1GE9 A;  3OEP A;  1AB4 A;  1XXC A; 
#chains in the Genus database with same CATH topology
 1IS1 A;  3GTM K;  2NVY C;  3HKZ D;  3EQL A;  5C4J C;  2JA6 K;  1R9T C;  2KWA A;  1WQG A;  4G0W A;  3GTM A;  4A93 K;  3BP8 C;  5IP7 C;  2JA6 A;  4A3M C;  3HXA A;  4A3F K;  2YU9 C;  1WIH A;  5C4X C;  3S2H K;  3A8J A;  2R93 C;  4P5A A;  1ZVU A;  2NVT K;  3A8K A;  2JH3 A;  1WOP A;  5IOR A;  1X31 C;  3H3V D;  2PA8 D;  5IOS A;  1GE9 A;  4Y7N C;  1F9N A;  2NVY A;  3S1Q K;  1YNN A;  1R9T A;  1V5V A;  2R92 K;  2JA5 C;  1TWG C;  3HOZ K;  1KQ4 A;  3MML B;  4BBR C;  1J6W A;  2YU9 A;  4C3H K;  2R92 A;  3RZD C;  1SFO K;  1YCL A;  3S2D K;  4AH6 A;  1IL2 A;  1I6H K;  5FJ8 K;  1JQW A;  1Y1V K;  2CFA A;  3HOX K;  2Y0S L;  4JK1 A;  3FOF A;  2JA5 A;  1TWG A;  1UV7 A;  1Y1V A;  1I3Q C;  1ZQ1 C;  2PMZ L;  3S14 K;  2WB1 D;  2A68 A;  1HI9 A;  4KB2 A;  1VGX A;  3GTJ C;  3GTG K;  3VA7 A;  4LLG A;  2XCQ A;  3TFH A;  3N0C A;  1YX2 A;  4P5B A;  4YG2 A;  1O2B A;  1TWC C;  3L4J A;  2O5J A;  1WOS A;  1PJ5 A;  4C3J C;  4A3B K;  3HKZ L;  1VJE A;  2E2J C;  3V4G A;  3LPX A;  4A3J C;  1EFW A;  3GTK K;  3K7A C;  4YFX A;  3GTP K;  1I3Q A;  2VUM C;  5C44 C;  4ILD A;  1Y1W C;  5IP9 C;  2R7Z K;  4X6A C;  2P5M A;  5FLM C;  3GTK A;  1VLO A;  2E2I K;  1XZP A;  1TWC A;  1JOE A;  3AD8 C;  1G51 A;  1TWH C;  4A3J K;  3H3V L;  2PA8 L;  3JST A;  3HOY C;  2ZUE A;  2V6U A;  4A3C K;  3GSI A;  3AD7 C;  1L0W A;  5C44 K;  1EK8 A;  2JA7 K;  5FLM K;  3ORE A;  5C3E K;  2GAH C;  3PO3 C;  3S15 C;  5M5W K;  2VUM A;  3I4M K;  4C2M K;  2E2H C;  1Y1W A;  3GTL K;  3GTM C;  3HOU K;  3AH5 A;  4YFN A;  3QX3 A;  2JA6 C;  2NVX K;  4GTC A;  3GTL A;  5IOQ A;  3FHZ A;  1O2A A;  3S1R K;  4A93 C;  1WOR A;  2NVX A;  4A3F C;  1USM A;  1BJT A;  1PJ6 A;  1F7U A;  4Y52 K;  3S1N K;  5D4D A;  4A3D K;  5TMC A;  1YNJ A;  3M4O C;  4BBS K;  2NVT C;  2P8T A;  4A3L K;  2E2H A;  3S16 K;  2PHC B;  2A69 A;  1F7V A;  4KM9 A;  1RU0 A;  3S1Q C;  3FOE A;  4C45 A;  2O5I A;  3BP3 A;  3AQO A;  4GTE A;  2R92 C;  1IE0 A;  3HOZ C;  1I50 K;  5CJ9 A;  3M4O K;  3SZY A;  4WIL A;  4C3H C;  4MEY A;  4OIO A;  3GDZ A;  1K83 K;  1SMY A;  3GIR A;  1SFO C;  4A3I K;  3S2D C;  3L4K A;  2FQT A;  1IQ0 A;  1I6H C;  3GTO K;  1XXA A;  4QIW L;  4BY7 K;  4A3G K;  1Y1V C;  3G4A A;  3HOX C;  1DD5 A;  2WAQ D;  4WJ4 A;  2NVQ K;  3AQP A;  2CW0 A;  2XCO A;  3GTO A;  1BGW A;  4XLN A;  3S14 C;  4BY1 K;  1USO A;  3GTG C;  2EBB A;  4M1X A;  4PAA A;  2ZUF A;  1I6V A;  1EI6 A;  4A3K K;  1SFO A;  4XSZ A;  1O25 A;  3ADA C;  1J6X A;  4A3B C;  3N3Y A;  4BLB A;  3M3Y K;  3GTK C;  4XCH A;  1DCP A;  3GTP C;  4XSX A;  1IBA A;  4GTL A;  2RGR A;  4BXX K;  1TWA K;  2R7Z C;  4GTA A;  3GTG A;  2E2I C;  4OIQ A;  1O29 A;  4GFQ A;  4QJV B;  1EQR A;  4OIR A;  4A3C C;  1TWF K;  2RH6 A;  3HOW K;  4Q5S A;  5IYC K;  2PPB A;  3OPF A;  4MQ9 A;  2JA7 C;  3SZZ A;  3CQZ K;  5IYB K;  3S0X A;  5C3E C;  4QJV A;  4KMD A;  3GTP A;  4LK0 A;  3S1M K;  3I4M C;  4C2M C;  3WOD A;  4BLA A;  2R7Z A;  5IYD K;  3GTL C;  4AYB D;  1J6V A;  3IPJ A;  3HOU C;  4J3N A;  3LAP A;  4C3I C;  2E2I A;  2NVX C;  3GTQ K;  3BUE A;  1O27 A;  3S1R C;  5L46 A;  1F93 A;  4GTF A;  4Y52 C;  3S1N C;  2JA7 A;  4A3D C;  4Q4Z A;  2V6S A;  4OIP A;  1WCM K;  4KAT A;  4C3I K;  4BBS C;  4LQY A;  3RZO K;  4A3L C;  3I4N K;  3S16 C;  1EH1 A;  2A6H A;  3FKI K;  1WOO A;  3GEE A;  1WCM A;  2A6E A;  1HQM A;  2W7V A;  4P9S A;  2Y0S D;  1I50 C;  4GTD A;  3T00 A;  1BDF A;  1WSR A;  4KC6 A;  4G7H A;  2GSU A;  2WB1 L;  1K83 C;  4A3E K;  4PAB A;  4A3I C;  3GTO C;  3GEI A;  3PO2 K;  4BY7 C;  4A3G C;  4LOW A;  5M3M K;  5M5Y K;  3AD9 C;  4FZB A;  2NVQ C;  1XXC A;  4ZH4 A;  1I50 A;  5TJ3 A;  4BY1 C;  5M5X K;  1O24 A;  1K83 A;  3S17 K;  3ERE D;  4A3K C;  4OIN A;  4KN4 A;  2GSO A;  2B63 K;  2NVY K;  3HOV C;  5C4J K;  4LR2 A;  5JVO A;  4AYB L;  1R9T K;  3CAG A;  2B63 A;  4MEX A;  3Q3Q A;  2JA8 C;  3M3Y C;  2D6F C;  1INN A;  5IP7 K;  4DDQ A;  1BS2 A;  4A3M K;  2YU9 K;  5HL8 A;  1J98 A;  1C0A A;  3LAJ A;  4KAR A;  4LK1 A;  5C4X K;  4BXX C;  4KMH A;  1TWA C;  2R93 K;  3HOV K;  5EGE A;  4KAS A;  4G0U A;  3H0G C;  3T01 A;  1B4A A;  1VH2 A;  4O2D A;  4GTB A;  4Y7N K;  2JA8 K;  2CFA B;  2R93 A;  1O26 A;  1IW7 A;  4KDD A;  5TMF A;  1TWF C;  3HOW C;  5IYC C;  2JA5 K;  1DCH A;  1TWG K;  3CQZ C;  1AB4 A;  4BBR K;  5IYB C;  1ZBS A;  3H0G K;  1WQF A;  3S1M C;  3T02 A;  1TWA A;  5E68 A;  5IYD C;  4YFK A;  4FM9 A;  4GZY A;  1XPP A;  3DXJ A;  4GT9 A;  3RZD K;  1VRQ C;  1ISE A;  4G7O A;  3H0G A;  5JFE A;  2B63 C;  3GTQ C;  3N0B A;  2BE5 A;  1O28 A;  1TWF A;  4NOI A;  1XXB A;  3TTG A;  3CQZ A;  5M3F K;  1WCM C;  3OEP A;  3S2H C;  1I3Q K;  1DCO A;  4KM8 A;  3RZO C;  1XZP B;  3GTJ K;  3I4N C;  4KAW X;  3TFI A;  3FKI C;  3TFJ A;  4KB4 A;  1ZXO A;  1PJ7 A;  1WQH A;  5IOT A;  4QIW D;  1TWC K;  3GTJ A;  3GTQ A;  2WAQ L;  4C3J K;  3G4C A;  1XZQ B;  2GSN A;  4G0V A;  2E2J K;  2XCR B;  3K7A K;  3A8I A;  4RMF A;  1O2F B;  4A3E C;  2VUM K;  2FQO A;  1Y1W K;  5IP9 K;  1XZQ A;  4X6A K;  4WJ3 M;  1WSV A;  4KMA A;  4KN7 A;  4XLP A;  3FKI A;  1JVI A;  2ZFZ A;  3PO2 C;  2GAG C;  1ZYR A;  4KMU A;  5EGH A;  1TWH K;  3HOY K;  2Y3P A;  2PMZ D;  2V6T A;  1B4B A;  1TWH A;  3NUH A;  3PO3 K;  3GEH A;  3S15 K;  3S17 C;  4LJZ A;  4BKW A;  4G7Z A;  2E2H K;  5CHP A; 
#chains in the Genus database with same CATH homology
 4DDQ A;  1IS1 A;  1EK8 A;  1O29 A;  4GFQ A;  3LAJ A;  4KAR A;  3ORE A;  4KMH A;  2KWA A;  1WQG A;  4G0W A;  2VUM A;  5EGE A;  3GTM A;  4KAS A;  2RH6 A;  1Y1W A;  4G0U A;  2JA6 A;  1B4A A;  3AH5 A;  3OPF A;  3QX3 A;  1WIH A;  4GTB A;  2CFA B;  2R93 A;  3S0X A;  1O26 A;  4KMD A;  4GTC A;  3GTP A;  3GTL A;  5IOQ A;  4KDD A;  1ZVU A;  4P5A A;  4C2M C;  1O2A A;  2JH3 A;  3FHZ A;  4BLA A;  2R7Z A;  5IOR A;  2NVX A;  4J3N A;  3LAP A;  4C3I C;  1BJT A;  5IOS A;  2E2I A;  1GE9 A;  1AB4 A;  1F9N A;  1ZBS A;  2NVY A;  1WQF A;  3BUE A;  1R9T A;  1O27 A;  1TWA A;  4GTF A;  4FM9 A;  4GT9 A;  2E2H A;  2PHC B;  1ISE A;  1KQ4 A;  3MML B;  3H0G A;  2YU9 A;  4KM9 A;  2JA7 A;  5JFE A;  3FOE A;  3N0B A;  4KAT A;  2R92 A;  4LQY A;  3AQO A;  4GTE A;  1O28 A;  1TWF A;  1EH1 A;  5CJ9 A;  1XXB A;  1WCM A;  3CQZ A;  4C3H C;  3OEP A;  4KM8 A;  2CFA A;  4KAW X;  3FOF A;  4KB4 A;  4GTD A;  1ZXO A;  2JA5 A;  3L4K A;  1TWG A;  1WQH A;  5IOT A;  1Y1V A;  4KC6 A;  1XXA A;  2GSU A;  3GTJ A;  3GTQ A;  3G4A A;  1DD5 A;  4KB2 A;  3G4C A;  3AQP A;  2GSN A;  3VA7 A;  2XCQ A;  2XCO A;  4G0V A;  3GTO A;  1BGW A;  3N0C A;  4P5B A;  2XCR B;  1O2B A;  3L4J A;  4FZB A;  4C3J C;  1XXC A;  4M1X A;  4KMA A;  1SFO A;  3FKI A;  1I50 A;  3V4G A;  3LPX A;  2ZFZ A;  5TJ3 A;  1O25 A;  1I3Q A;  5EGH A;  1O24 A;  1K83 A;  4ILD A;  3ERE D;  2Y3P A;  3N3Y A;  2P5M A;  4BLB A;  3GTK A;  2GSO A;  1B4B A;  1TWH A;  4LR2 A;  5JVO A;  1TWC A;  4GTL A;  3NUH A;  2RGR A;  3CAG A;  4GTA A;  4BKW A;  2B63 A;  3Q3Q A;  3GTG A;  5CHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...