2P5MA

C-terminal domain hexamer of ahrc bound with l-arginine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
QRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor L-arginine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 24
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2p5mA00
5CJ9A 3NUHA 1BGWA 1ZVUA 4GFQA 3LPXA 1XXCA 3OEPA 1EH1A 1BJTA 4G0UA 4KB4A 1GE9A 1F9NA 2XCOA 1EK8A 4KB2A 1XXBA 3FOEA 1IS1A 1B4BA 5JVOA 1WQGA 3OREA 1AB4A 2XCRB 3LAPA 3FOFA 3FHZA 4DDQA 4KAWX 2Y3PA 3CAGA 3VA7A 3L4KA 3V4GA 1XXAA 3MMLB 4KC6A 2PHCB 4J3NA 4KDDA 3L4JA 3LAJA 2XCQA 3OPFA 1WIHA 4G0WA 1DD5A 4FM9A 4G0VA 1B4AA 1WQHA 2RGRA 3QX3A 2ZFZA 1WQFA 2KWAA 1ISEA 3BUEA 3ERED 2P5MA
chains in the Genus database with same CATH superfamily
3HKZL 4OIQA 1BGWA 3AQPA 5HL8A 3K7AK 3H0GK 4Y7NK 1O2BA 5IP9K 3S1RC 4BBSK 3GTGK 3FOEA 4KMAA 1B4BA 5IYDC 1L0WA 3GTLC 3S1MC 4XSZA 2PPBA 1TWFA 3GTGC 3BP8C 5M5WK 1IBAA 2CFAA 3GSIA 2R93A 3MMLB 5IYBK 1IQ0A 1VH2A 4RMFA 4QIWL 5FLMK 5CHPA 1RU0A 2NVXA 2JA7A 1EI6A 3I4MK 4FZBA 1WOPA 1HQMA 3GTJC 1DCOA 4WJ4A 3PO3K 3OEPA 4GTCA 2XCOA 3CQZA 2Y0SD 4LJZA 1I6VA 1WQGA 4LK0A 4KATA 4OIPA 5FJ8K 4KASA 3S16K 3H0GA 4BLAA 4JK1A 5IYCK 5JFEA 4YG2A 1INNA 3GTMC 2XCQA 5C44C 2GSOA 4G0WA 2PA8D 2JA5A 3S0XA 5M5YK 4A3EC 1WCMC 2A69A 1SFOA 1SFOK 1O29A 3GDZA 5C4XC 1BDFA 4G7ZA 2E2HC 1WCMK 4LOWA 4A3FC 4YFKA 2GSNA 1R9TC 3GTQK 1EK8A 1I3QA 2NVYC 2NVYK 1XZQA 5JVOA 3HOWK 1O26A 1VLOA 1YX2A 3A8KA 4LLGA 1TWHK 1K83K 4J3NA 5M5XK 2W7VA 1IW7A 3S2DK 1B4AA 3H3VD 1Y1VA 5IOTA 2E2JC 1WORA 5IOSA 4AYBD 2VUMA 4OINA 2VUMK 4A3CK 1TWAK 4GZYA 1TWAA 5D4DA 1EH1A 3Q3QA 2RH6A 3S2HK 1IS1A 3T01A 3HKZD 1I50K 3EQLA 3S1QK 4A3IK 1Y1WA 2WB1D 3GTOA 2B63K 2R7ZK 2R7ZA 3GTKC 4G7OA 1K83C 3LAJA 3OPFA 3WODA 4LQYA 1WQHA 3QX3A 4Y52K 3T00A 2Y0SL 2PMZL 1EFWA 1F7VA 1ZVUA 5TMCA 1DCHA 3HOZC 2A6HA 3TFJA 3S1NK 2GSUA 4A3MK 1AB4A 3I4NK 4A3EK 2PA8L 3FHZA 2CFAB 3RZDC 1KQ4A 1WSVA 3AD7C 2PHCB 3N0BA 3M4OC 3M4OK 4BBRK 3TTGA 2FQOA 3S15K 3GEHA 4FM9A 1R9TK 3GTQC 4G0VA 2JA6K 4A3LK 4BBRC 1Y1WK 3HOUC 2O5JA 4BLBA 4A93C 2B63C 4BY1K 3LPXA 1TWHC 1BJTA 1O2AA 3GTLA 3GTMK 5M3FK 4C2MK 2JH3A 4KM9A 3GTGA 2JA5K 2R93C 4KN4A 3CAGA 3L4KA 1I6HC 4C45A 4ILDA 4GTBA 3ADAC 4KM8A 1EQRA 2A6EA 4Q4ZA 2NVXC 5C4JC 1DD5A 2JA7C 3RZDK 1ZYRA 3FKIA 3PO3C 4BY7C 3GTJA 4C3JK 5C4JK 2JA7K 3AH5A 4BY7K 4X6AC 3CQZC 5IP9C 1GE9A 1HI9A 1F9NA 3S16C 3AD8C 2JA6A 4P5BA 5IYCC 3OREA 1ZXOA 5M3MK 1XZPB 4QIWD 3N0CA 4QJVB 4ZH4A 3VA7A 2R93K 1XXAA 1O28A 4KMHA 3L4JA 2ZFZA 4PAAA 4C3HK 3HOYK 1I50C 1TWCA 5FLMC 4KARA 4GTFA 1J98A 1PJ7A 2O5IA 1XPPA 1XXCA 5C3EK 3GTPK 2NVYA 5EGHA 2E2HK 1JOEA 4MEYA 1J6XA 5IOQA 2XCRB 2E2IK 4A3KC 2E2IA 3S17K 1WOOA 2R92C 2R92K 3T02A 4A3DC 4A3DK 1SMYA 3GEIA 4BBSC 3BP3A 3HOZK 2V6SA 1VRQC 4XCHA 1Y1VC 2KWAA 1ISEA 2P5MA 2VUMC 5CJ9A 2NVQC 1VGXA 3TFHA 3DXJA 4G0UA 4XLNA 4KB2A 4GTEA 4A3JC 1PJ5A 1Y1WC 3I4MC 1ZQ1C 4A3JK 2A68A 3GTKA 4A3IC 3HOUK 3RZOC 1K83A 5C3EC 3GTPC 3G4AA 1JVIA 2D6FC 2ZUFA 1WOSA 3SZYA 3ERED 3JSTA 4C2MC 1TWFK 3NUHA 1TWGK 4GFQA 3HOXC 3S2DC 1G51A 3S14K 5C44K 4GTLA 3S2HC 2FQTA 4BKWA 4PABA 3GTQA 4MEXA 2GAHC 2P8TA 3TFIA 1ZBSA 2B63A 4XLPA 4M1XA 3S17C 1TWHA 1WSRA 3LAPA 1Y1VK 3FOFA 4WILA 1I6HK 4P9SA 3S14C 1TWGA 3PO2C 3I4NC 4P5AA 4KDDA 4LR2A 4O2DA 3FKIC 1PJ6A 2WAQD 4C3JC 2YU9A 3GTOK 4A93K 5L46A 4Q5SA 1YNNA 4YFNA 3M3YC 3RZOK 4KB4A 2JA6C 2CW0A 1F7UA 5TMFA 4NOIA 3HXAA 5IP7K 1O24A 4C3IK 5IYDK 1IL2A 4DDQA 1C0AA 1TWFC 4KC6A 4C3IC 3GTLK 3S1MK 3HOXK 1WIHA 3A8IA 2ZUEA 2RGRA 1I50A 1TWCK 1TWCC 4GT9A 1USMA 3IPJA 5TJ3A 2NVTK 1USOA 1O2FB 4A3FK 3GTKK 2PMZD 3FKIK 4WJ3M 3GTJK 4A3KK 2E2IC 3N3YA 4OIRA 2R92A 2BE5A 3K7AC 1J6VA 5E68A 3M3YK 4XSXA 5IP7C 3H0GC 4A3CC 1V5VA 1O25A 2NVQK 1VJEA 3GTMA 3BUEA 2GAGC 2JA5C 1WCMA 3A8JA 2WAQL 1SFOC 4BXXK 4BXXC 2E2HA 4KN7A 2NVXK 1R9TA 5IORA 1BS2A 1X31C 1I3QC 2V6TA 2JA8K 3S1QC 2NVTC 4GTDA 4Y7NC 4KAWX 3GTPA 3H3VL 3CQZK 4LK1A 3HOWC 4QJVA 2WB1L 4AYBL 4YFXA 3HOVK 4A3GK 1WQFA 1O27A 3G4CA 4KMUA 4G7HA 1J6WA 3PO2K 1YCLA 1TWAC 1XXBA 2E2JK 1XZPA 4C3HC 3HOYC 4A3BC 1F93A 2YU9K 2Y3PA 3GTOC 4MQ9A 1IE0A 3SZZA 4X6AK 1I3QK 1DCPA 4GTAA 4BY1C 2R7ZC 3S1RK 1JQWA 2EBBA 2V6UA 3HOVC 4A3GC 3AD9C 1XZQB 4Y52C 4AH6A 5IYBC 4OIOA 3AQOA 4KMDA 3GIRA 4A3MC 1TWGC 5C4XK 3GEEA 3S1NC 3V4GA 1YNJA 5EGEA 1UV7A 2YU9C 3S15C 4A3BK 4A3LC 2JA8C
chains in the Genus database with same CATH topology
5CJ9A 1BGWA 1ZVUA 3AQPA 1O2BA 5TJ3A 4G0UA 4KB2A 4GTEA 3FOEA 4KMAA 1B4BA 2GSUA 3N3YA 1AB4A 2R92A 1TWFA 3FHZA 2CFAB 3GTKA 1KQ4A 2CFAA 2R93A 3MMLB 1K83A 2PHCB 3G4AA 3N0BA 1O25A 5CHPA 4FM9A 3GTMA 4G0VA 2NVXA 2JA7A 3BUEA 3ERED 4FZBA 4C2MC 1WCMA 4BLBA 3NUHA 4GFQA 3LPXA 3OEPA 1O2AA 1BJTA 2E2HA 4GTCA 2XCOA 3CQZA 3GTLA 1R9TA 5IORA 1WQGA 2JH3A 4KM9A 3GTGA 4KATA 4GTDA 4GTLA 4KAWX 4KASA 3GTPA 3CAGA 3L4KA 4BKWA 3H0GA 4BLAA 4ILDA 4GTBA 5JFEA 4KM8A 3GTQA 2XCQA 2GSOA 4G0WA 1DD5A 2JA5A 3S0XA 3FKIA 1WQFA 1ZBSA 3GTJA 2B63A 1O27A 1SFOA 3G4CA 1O29A 3AH5A 4M1XA 1TWHA 1GE9A 2GSNA 1F9NA 1EK8A 1XXBA 1I3QA 2JA6A 4P5BA 5JVOA 3OREA 1O26A 4C3HC 1ZXOA 3LAPA 3FOFA 2Y3PA 3VA7A 3N0CA 1TWGA 1XXAA 4J3NA 4P5AA 1O28A 4KMHA 4GTAA 4KDDA 4LR2A 3L4JA 1B4AA 4C3JC 2ZFZA 2YU9A 1Y1VA 1TWCA 5IOTA 4KARA 4GTFA 5IOSA 2VUMA 1TWAA 1XXCA 1EH1A 2NVYA 3Q3QA 5EGHA 4KB4A 2RH6A 1IS1A 1O24A 3AQOA 4KMDA 5IOQA 2XCRB 2E2IA 1Y1WA 3GTOA 4DDQA 3V4GA 4KC6A 4C3IC 2R7ZA 3LAJA 3OPFA 1WIHA 5EGEA 4LQYA 1WQHA 2RGRA 3QX3A 1I50A 2KWAA 1ISEA 4GT9A 2P5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CJ9 A;  3NUH A;  1BGW A;  1ZVU A;  4GFQ A;  3LPX A;  1XXC A;  3OEP A;  1EH1 A;  1BJT A;  4G0U A;  4KB4 A;  1GE9 A;  1F9N A;  2XCO A;  1EK8 A;  4KB2 A;  1XXB A;  3FOE A;  1IS1 A;  1B4B A;  5JVO A;  1WQG A;  3ORE A;  1AB4 A;  2XCR B;  3LAP A;  3FOF A;  3FHZ A;  4DDQ A;  4KAW X;  2Y3P A;  3CAG A;  3VA7 A;  3L4K A;  3V4G A;  1XXA A;  3MML B;  4KC6 A;  2PHC B;  4J3N A;  4KDD A;  3L4J A;  3LAJ A;  2XCQ A;  3OPF A;  1WIH A;  4G0W A;  1DD5 A;  4FM9 A;  4G0V A;  1B4A A;  1WQH A;  2RGR A;  3QX3 A;  2ZFZ A;  1WQF A;  2KWA A;  1ISE A;  3BUE A;  3ERE D;  2P5M A; 
#chains in the Genus database with same CATH topology
 3HKZ L;  4OIQ A;  1BGW A;  3AQP A;  5HL8 A;  3K7A K;  3H0G K;  4Y7N K;  1O2B A;  5IP9 K;  3S1R C;  4BBS K;  3GTG K;  3FOE A;  4KMA A;  1B4B A;  5IYD C;  1L0W A;  3GTL C;  3S1M C;  4XSZ A;  2PPB A;  1TWF A;  3GTG C;  3BP8 C;  5M5W K;  1IBA A;  2CFA A;  3GSI A;  2R93 A;  3MML B;  5IYB K;  1IQ0 A;  1VH2 A;  4RMF A;  4QIW L;  5FLM K;  5CHP A;  1RU0 A;  2NVX A;  2JA7 A;  1EI6 A;  3I4M K;  4FZB A;  1WOP A;  1HQM A;  3GTJ C;  1DCO A;  4WJ4 A;  3PO3 K;  3OEP A;  4GTC A;  2XCO A;  3CQZ A;  2Y0S D;  4LJZ A;  1I6V A;  1WQG A;  4LK0 A;  4KAT A;  4OIP A;  5FJ8 K;  4KAS A;  3S16 K;  3H0G A;  4BLA A;  4JK1 A;  5IYC K;  5JFE A;  4YG2 A;  1INN A;  3GTM C;  2XCQ A;  5C44 C;  2GSO A;  4G0W A;  2PA8 D;  2JA5 A;  3S0X A;  5M5Y K;  4A3E C;  1WCM C;  2A69 A;  1SFO A;  1SFO K;  1O29 A;  3GDZ A;  5C4X C;  1BDF A;  4G7Z A;  2E2H C;  1WCM K;  4LOW A;  4A3F C;  4YFK A;  2GSN A;  1R9T C;  3GTQ K;  1EK8 A;  1I3Q A;  2NVY C;  2NVY K;  1XZQ A;  5JVO A;  3HOW K;  1O26 A;  1VLO A;  1YX2 A;  3A8K A;  4LLG A;  1TWH K;  1K83 K;  4J3N A;  5M5X K;  2W7V A;  1IW7 A;  3S2D K;  1B4A A;  3H3V D;  1Y1V A;  5IOT A;  2E2J C;  1WOR A;  5IOS A;  4AYB D;  2VUM A;  4OIN A;  2VUM K;  4A3C K;  1TWA K;  4GZY A;  1TWA A;  5D4D A;  1EH1 A;  3Q3Q A;  2RH6 A;  3S2H K;  1IS1 A;  3T01 A;  3HKZ D;  1I50 K;  3EQL A;  3S1Q K;  4A3I K;  1Y1W A;  2WB1 D;  3GTO A;  2B63 K;  2R7Z K;  2R7Z A;  3GTK C;  4G7O A;  1K83 C;  3LAJ A;  3OPF A;  3WOD A;  4LQY A;  1WQH A;  3QX3 A;  4Y52 K;  3T00 A;  2Y0S L;  2PMZ L;  1EFW A;  1F7V A;  1ZVU A;  5TMC A;  1DCH A;  3HOZ C;  2A6H A;  3TFJ A;  3S1N K;  2GSU A;  4A3M K;  1AB4 A;  3I4N K;  4A3E K;  2PA8 L;  3FHZ A;  2CFA B;  3RZD C;  1KQ4 A;  1WSV A;  3AD7 C;  2PHC B;  3N0B A;  3M4O C;  3M4O K;  4BBR K;  3TTG A;  2FQO A;  3S15 K;  3GEH A;  4FM9 A;  1R9T K;  3GTQ C;  4G0V A;  2JA6 K;  4A3L K;  4BBR C;  1Y1W K;  3HOU C;  2O5J A;  4BLB A;  4A93 C;  2B63 C;  4BY1 K;  3LPX A;  1TWH C;  1BJT A;  1O2A A;  3GTL A;  3GTM K;  5M3F K;  4C2M K;  2JH3 A;  4KM9 A;  3GTG A;  2JA5 K;  2R93 C;  4KN4 A;  3CAG A;  3L4K A;  1I6H C;  4C45 A;  4ILD A;  4GTB A;  3ADA C;  4KM8 A;  1EQR A;  2A6E A;  4Q4Z A;  2NVX C;  5C4J C;  1DD5 A;  2JA7 C;  3RZD K;  1ZYR A;  3FKI A;  3PO3 C;  4BY7 C;  3GTJ A;  4C3J K;  5C4J K;  2JA7 K;  3AH5 A;  4BY7 K;  4X6A C;  3CQZ C;  5IP9 C;  1GE9 A;  1HI9 A;  1F9N A;  3S16 C;  3AD8 C;  2JA6 A;  4P5B A;  5IYC C;  3ORE A;  1ZXO A;  5M3M K;  1XZP B;  4QIW D;  3N0C A;  4QJV B;  4ZH4 A;  3VA7 A;  2R93 K;  1XXA A;  1O28 A;  4KMH A;  3L4J A;  2ZFZ A;  4PAA A;  4C3H K;  3HOY K;  1I50 C;  1TWC A;  5FLM C;  4KAR A;  4GTF A;  1J98 A;  1PJ7 A;  2O5I A;  1XPP A;  1XXC A;  5C3E K;  3GTP K;  2NVY A;  5EGH A;  2E2H K;  1JOE A;  4MEY A;  1J6X A;  5IOQ A;  2XCR B;  2E2I K;  4A3K C;  2E2I A;  3S17 K;  1WOO A;  2R92 C;  2R92 K;  3T02 A;  4A3D C;  4A3D K;  1SMY A;  3GEI A;  4BBS C;  3BP3 A;  3HOZ K;  2V6S A;  1VRQ C;  4XCH A;  1Y1V C;  2KWA A;  1ISE A;  2P5M A;  2VUM C;  5CJ9 A;  2NVQ C;  1VGX A;  3TFH A;  3DXJ A;  4G0U A;  4XLN A;  4KB2 A;  4GTE A;  4A3J C;  1PJ5 A;  1Y1W C;  3I4M C;  1ZQ1 C;  4A3J K;  2A68 A;  3GTK A;  4A3I C;  3HOU K;  3RZO C;  1K83 A;  5C3E C;  3GTP C;  3G4A A;  1JVI A;  2D6F C;  2ZUF A;  1WOS A;  3SZY A;  3ERE D;  3JST A;  4C2M C;  1TWF K;  3NUH A;  1TWG K;  4GFQ A;  3HOX C;  3S2D C;  1G51 A;  3S14 K;  5C44 K;  4GTL A;  3S2H C;  2FQT A;  4BKW A;  4PAB A;  3GTQ A;  4MEX A;  2GAH C;  2P8T A;  3TFI A;  1ZBS A;  2B63 A;  4XLP A;  4M1X A;  3S17 C;  1TWH A;  1WSR A;  3LAP A;  1Y1V K;  3FOF A;  4WIL A;  1I6H K;  4P9S A;  3S14 C;  1TWG A;  3PO2 C;  3I4N C;  4P5A A;  4KDD A;  4LR2 A;  4O2D A;  3FKI C;  1PJ6 A;  2WAQ D;  4C3J C;  2YU9 A;  3GTO K;  4A93 K;  5L46 A;  4Q5S A;  1YNN A;  4YFN A;  3M3Y C;  3RZO K;  4KB4 A;  2JA6 C;  2CW0 A;  1F7U A;  5TMF A;  4NOI A;  3HXA A;  5IP7 K;  1O24 A;  4C3I K;  5IYD K;  1IL2 A;  4DDQ A;  1C0A A;  1TWF C;  4KC6 A;  4C3I C;  3GTL K;  3S1M K;  3HOX K;  1WIH A;  3A8I A;  2ZUE A;  2RGR A;  1I50 A;  1TWC K;  1TWC C;  4GT9 A;  1USM A;  3IPJ A;  5TJ3 A;  2NVT K;  1USO A;  1O2F B;  4A3F K;  3GTK K;  2PMZ D;  3FKI K;  4WJ3 M;  3GTJ K;  4A3K K;  2E2I C;  3N3Y A;  4OIR A;  2R92 A;  2BE5 A;  3K7A C;  1J6V A;  5E68 A;  3M3Y K;  4XSX A;  5IP7 C;  3H0G C;  4A3C C;  1V5V A;  1O25 A;  2NVQ K;  1VJE A;  3GTM A;  3BUE A;  2GAG C;  2JA5 C;  1WCM A;  3A8J A;  2WAQ L;  1SFO C;  4BXX K;  4BXX C;  2E2H A;  4KN7 A;  2NVX K;  1R9T A;  5IOR A;  1BS2 A;  1X31 C;  1I3Q C;  2V6T A;  2JA8 K;  3S1Q C;  2NVT C;  4GTD A;  4Y7N C;  4KAW X;  3GTP A;  3H3V L;  3CQZ K;  4LK1 A;  3HOW C;  4QJV A;  2WB1 L;  4AYB L;  4YFX A;  3HOV K;  4A3G K;  1WQF A;  1O27 A;  3G4C A;  4KMU A;  4G7H A;  1J6W A;  3PO2 K;  1YCL A;  1TWA C;  1XXB A;  2E2J K;  1XZP A;  4C3H C;  3HOY C;  4A3B C;  1F93 A;  2YU9 K;  2Y3P A;  3GTO C;  4MQ9 A;  1IE0 A;  3SZZ A;  4X6A K;  1I3Q K;  1DCP A;  4GTA A;  4BY1 C;  2R7Z C;  3S1R K;  1JQW A;  2EBB A;  2V6U A;  3HOV C;  4A3G C;  3AD9 C;  1XZQ B;  4Y52 C;  4AH6 A;  5IYB C;  4OIO A;  3AQO A;  4KMD A;  3GIR A;  4A3M C;  1TWG C;  5C4X K;  3GEE A;  3S1N C;  3V4G A;  1YNJ A;  5EGE A;  1UV7 A;  2YU9 C;  3S15 C;  4A3B K;  4A3L C;  2JA8 C; 
#chains in the Genus database with same CATH homology
 5CJ9 A;  1BGW A;  1ZVU A;  3AQP A;  1O2B A;  5TJ3 A;  4G0U A;  4KB2 A;  4GTE A;  3FOE A;  4KMA A;  1B4B A;  2GSU A;  3N3Y A;  1AB4 A;  2R92 A;  1TWF A;  3FHZ A;  2CFA B;  3GTK A;  1KQ4 A;  2CFA A;  2R93 A;  3MML B;  1K83 A;  2PHC B;  3G4A A;  3N0B A;  1O25 A;  5CHP A;  4FM9 A;  3GTM A;  4G0V A;  2NVX A;  2JA7 A;  3BUE A;  3ERE D;  4FZB A;  4C2M C;  1WCM A;  4BLB A;  3NUH A;  4GFQ A;  3LPX A;  3OEP A;  1O2A A;  1BJT A;  2E2H A;  4GTC A;  2XCO A;  3CQZ A;  3GTL A;  1R9T A;  5IOR A;  1WQG A;  2JH3 A;  4KM9 A;  3GTG A;  4KAT A;  4GTD A;  4GTL A;  4KAW X;  4KAS A;  3GTP A;  3CAG A;  3L4K A;  4BKW A;  3H0G A;  4BLA A;  4ILD A;  4GTB A;  5JFE A;  4KM8 A;  3GTQ A;  2XCQ A;  2GSO A;  4G0W A;  1DD5 A;  2JA5 A;  3S0X A;  3FKI A;  1WQF A;  1ZBS A;  3GTJ A;  2B63 A;  1O27 A;  1SFO A;  3G4C A;  1O29 A;  3AH5 A;  4M1X A;  1TWH A;  1GE9 A;  2GSN A;  1F9N A;  1EK8 A;  1XXB A;  1I3Q A;  2JA6 A;  4P5B A;  5JVO A;  3ORE A;  1O26 A;  4C3H C;  1ZXO A;  3LAP A;  3FOF A;  2Y3P A;  3VA7 A;  3N0C A;  1TWG A;  1XXA A;  4J3N A;  4P5A A;  1O28 A;  4KMH A;  4GTA A;  4KDD A;  4LR2 A;  3L4J A;  1B4A A;  4C3J C;  2ZFZ A;  2YU9 A;  1Y1V A;  1TWC A;  5IOT A;  4KAR A;  4GTF A;  5IOS A;  2VUM A;  1TWA A;  1XXC A;  1EH1 A;  2NVY A;  3Q3Q A;  5EGH A;  4KB4 A;  2RH6 A;  1IS1 A;  1O24 A;  3AQO A;  4KMD A;  5IOQ A;  2XCR B;  2E2I A;  1Y1W A;  3GTO A;  4DDQ A;  3V4G A;  4KC6 A;  4C3I C;  2R7Z A;  3LAJ A;  3OPF A;  1WIH A;  5EGE A;  4LQY A;  1WQH A;  2RGR A;  3QX3 A;  1I50 A;  2KWA A;  1ISE A;  4GT9 A;  2P5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...