2P5MA

C-terminal domain hexamer of ahrc bound with l-arginine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
QRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Arginine repressor
publication title Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor L-arginine.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 24
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2p5mA00
2KWAA 1ISEA 3LAJA 1DD5A 3LAPA 1EK8A 3VA7A 2RGRA 3FOFA 4DDQA 1BJTA 1XXCA 1ZVUA 5JVOA 1XXBA 1GE9A 3LPXA 2ZFZA 3OREA 4G0VA 4J3NA 4KC6A 1AB4A 3V4GA 1WQFA 1XXAA 3FOEA 4KAWX 4G0WA 3CAGA 2XCRB 3NUHA 3MMLB 1F9NA 3OEPA 1WIHA 2Y3PA 2P5MA 2XCQA 4GFQA 3L4JA 1IS1A 4KDDA 1EH1A 3BUEA 1B4AA 3QX3A 3ERED 2PHCB 3FHZA 1WQHA 4KB4A 3L4KA 4FM9A 4G0UA 3OPFA 1BGWA 5CJ9A 2XCOA 1WQGA 1B4BA 4KB2A
chains in the Genus database with same CATH superfamily
5C4JK 3LAPA 5L46A 2E2HA 5IP9C 3S16C 1Y1VK 4ILDA 1YNJA 1I3QK 1I6HK 2NVYA 2E2HK 4LR2A 3FKIC 1TWHA 4LK1A 1JQWA 2NVYK 1XXAA 2V6UA 1F7VA 1TWHK 5TMCA 1YX2A 1L0WA 3GTGA 4C3IK 5FJ8K 3K7AC 1IW7A 5CJ9A 2XCOA 3GTGK 1O24A 2R93C 3S15K 5HL8A 3HOUC 4BLBA 3GTMA 4BXXC 5IYBK 2YU9A 4QJVB 3N3YA 1Y1WA 3HOVC 3A8KA 3GTQA 1XZPA 3GTMK 2YU9K 1Y1WK 1WCMA 3GTQK 4XLPA 5C3EK 4BY7K 4OIQA 1WQHA 3HOXC 2PMZL 3SZYA 1TWCC 3T02A 2VUMC 5TMFA 1USMA 3BP8C 3S2DC 3HOZK 4G0VA 3CQZC 1WCMC 1SMYA 3GTOK 3TTGA 4JK1A 3HXAA 5EGHA 3M3YC 4A3DK 2R92A 5EGEA 2JA5A 4XCHA 4GFQA 2FQTA 4ZH4A 3S1NK 4QIWD 2O5JA 5IOQA 4WJ4A 4A3LC 2R92K 3S2HC 1WSVA 2JA5K 5C4XK 1HI9A 2E2IK 4C2MC 4GTFA 1HQMA 3T00A 3FOFA 1RU0A 4BBRK 5IP7C 5D4DA 4Y7NK 3G4CA 1PJ7A 1J98A 5C4XC 1KQ4A 5M5XK 3GEHA 1F93A 4QJVA 3EQLA 5TJ3A 1BS2A 1WORA 2GAGC 3AQPA 2FQOA 4BBSK 3I4NK 4A3CC 3TFHA 3GTPK 3SZZA 5IORA 3H3VL 4YFKA 4OIRA 2RGRA 1I50A 2NVXK 4RMFA 3HOWC 1TWFA 4KN7A 1O2AA 1YCLA 4PAAA 3GTJC 3GTKA 4KMUA 3AH5A 3GIRA 1I50K 1YNNA 2JA7C 3BP3A 4KATA 3GTKK 3FOEA 3GEIA 4M1XA 5IYCC 2B63C 3GTLA 2XCRB 2JA6C 1USOA 5IYDC 4A93C 1TWFC 4A3MK 3GTLK 3RZOC 3S14K 4A3BC 3S1MC 3S17C 1Y1VA 4A3FK 1O26A 4A3JK 2E2JC 1IQ0A 2P8TA 3M4OC 4GTLA 5C4JC 4YFXA 1ZXOA 1XPPA 3S0XA 1R9TA 3CAGA 3JSTA 4AYBL 1Y1VC 1I6HC 1I3QC 3OEPA 1ZBSA 3T01A 5CHPA 2P5MA 2E2HC 1R9TK 1IL2A 2PHCB 4YFNA 2NVYC 4KARA 1TWHC 4LQYA 4C3IC 4OIPA 1PJ5A 2CFAB 2BE5A 1XXBA 2Y0SD 3GTGC 2NVTK 1VRQC 3RZDK 1G51A 4G0WA 3S15C 4Y52K 3S1QK 5M5WK 3PO2K 5IYBC 2EBBA 3FHZA 4A3IK 4A3KK 4G0UA 1BGWA 1TWAA 1B4BA 3GTMC 1ZYRA 4GTAA 1EK8A 3VA7A 2YU9C 1Y1WC 2ZUFA 3AD9C 1JVIA 1TWAK 3GTQC 3GTOA 5C3EC 4BY7C 1O28A 1UV7A 4KC6A 4BKWA 1AB4A 2PA8L 1WQFA 4A3EK 1K83A 3TFIA 3H0GA 3L4JA 3HOZC 1K83K 2E2IA 3GTOC 3H0GK 2KWAA 1BDFA 1DD5A 4A3DC 3Q3QA 1J6WA 3S1NC 1DCHA 1O2FB 2CFAA 1WSRA 4P5AA 1VLOA 2JA8K 2R92C 2JA5C 2ZFZA 2E2IC 3GEEA 1VH2A 1VGXA 3HOYK 3GTPA 4BBRC 4Y7NC 4A3GK 3BUEA 4MQ9A 4C3HK 3S1RK 1C0AA 3AD8C 4KB4A 2R7ZK 2NVXA 4MEYA 4BBSC 3I4NC 1F7UA 4XLNA 3GTPC 4GTCA 1XZQB 4LJZA 3PO3K 4G7ZA 4X6AK 2NVXC 4BY1K 1TWGA 2V6SA 2WB1D 1IS1A 1I50C 2O5IA 1TWGK 4C3JK 3GTKC 1PJ6A 4GTEA 5M3FK 1SFOA 4KMDA 3LAJA 3I4MK 2GSNA 4A3MC 1SFOK 3GTLC 1BJTA 4YG2A 3S14C 1GE9A 1DCPA 2NVQK 4QIWL 3V4GA 1O2BA 4A3FC 4A3JC 1JOEA 3I4MC 3AQOA 1F9NA 5IP9K 3S16K 1WOPA 3FKIA 4KDDA 3QX3A 5M3MK 1WOOA 4GTBA 2A68A 4P5BA 3FKIK 1WQGA 4G7HA 4PABA 1ISEA 3GDZA 3IPJA 1R9TC 1XZQA 4O2DA 3OREA 3K7AK 2R93A 1I6VA 3AD7C 1EQRA 4BLAA 1IBAA 2R93K 4MEXA 4KASA 3HOUK 1B4AA 3L4KA 2NVTC 4BXXK 3OPFA 3RZDC 4C45A 4NOIA 5FLMK 2V6TA 1J6VA 4Y52C 3HOVK 5E68A 3S1QC 2PPBA 2WB1L 5IOSA 1O29A 3PO2C 1XXCA 1TWCA 4A3IC 4A3KC 3H3VD 4J3NA 5FLMC 2A69A 3A8JA 2VUMA 3HOXK 4LLGA 1TWCK 3HKZD 1TWAC 1O25A 3NUHA 2VUMK 1WIHA 2WAQD 3CQZA 2ZUEA 5C44K 2CW0A 1WOSA 3ERED 4G7OA 3S2DK 3CQZK 1WCMK 1EFWA 4A3EC 5C44C 1IE0A 3GSIA 3M3YK 1K83C 5JVOA 3H0GC 4XSZA 4A3LK 3WODA 3S2HK 1O27A 4GZYA 2GSUA 4FZBA 4AH6A 3N0BA 4XSXA 2GAHC 4GTDA 4C2MK 3MMLB 4WJ3M 2R7ZA 2XCQA 4OIOA 2JA8C 5IP7K 4GT9A 2Y0SL 3HOYC 1INNA 4LK0A 4KB2A 4AYBD 3N0CA 2A6EA 3A8IA 4A3GC 1EI6A 4A3CK 4C3HC 4WILA 4KMHA 3S1RC 3LPXA 2R7ZC 2GSOA 3DXJA 2A6HA 3ADAC 1VJEA 4KAWX 3GTJA 3TFJA 3HOWK 2JA7A 3PO3C 4X6AC 4KM9A 3GTJK 2JH3A 5M5YK 2B63A 2JA6A 2JA7K 4FM9A 3HKZL 1V5VA 4BY1C 5JFEA 1ZQ1C 5IYCK 4KMAA 2B63K 4OINA 2WAQL 2JA6K 4DDQA 4LOWA 1J6XA 1ZVUA 4C3JC 1TWGC 4A93K 5IYDK 1TWFK 2RH6A 3RZOK 3S1MK 4A3BK 2PMZD 4KM8A 4Q5SA 3S17K 1XZPB 1SFOC 2Y3PA 5IOTA 2E2JK 2NVQC 1EH1A 1X31C 2W7VA 2PA8D 4Q4ZA 4P9SA 3G4AA 2D6FC 4KN4A 3M4OK 1I3QA 1DCOA
chains in the Genus database with same CATH topology
2KWAA 1DD5A 3LAPA 2RGRA 1I50A 2E2HA 3Q3QA 1TWFA 4ILDA 1O2AA 5IOSA 1O29A 2CFAA 3GTKA 1XXCA 2NVYA 1TWCA 3AH5A 4P5AA 2ZFZA 4LR2A 4J3NA 1TWHA 2VUMA 4KATA 1XXAA 3FOEA 4M1XA 3GTPA 3GTLA 2XCRB 1O25A 3NUHA 1WIHA 3CQZA 3GTGA 3BUEA 3ERED 4KB4A 5CJ9A 2XCOA 2NVXA 1Y1VA 1O26A 1O24A 4BLBA 4GTCA 5JVOA 3GTMA 2YU9A 3N3YA 1O27A 1Y1WA 4GTLA 2GSUA 4FZBA 3N0BA 3GTQA 1ZXOA 3S0XA 4GTDA 3CAGA 1R9TA 1TWGA 3MMLB 3OEPA 1ZBSA 5CHPA 2P5MA 2XCQA 2R7ZA 1WCMA 1IS1A 4GT9A 2PHCB 1WQHA 4KARA 4GTEA 4KB2A 1SFOA 3N0CA 4KMDA 3LAJA 4LQYA 4C3IC 2GSNA 1BJTA 2CFAB 4C3HC 4KMHA 1XXBA 1GE9A 3LPXA 4G0VA 2GSOA 3V4GA 1O2BA 4KAWX 5EGHA 4G0WA 3GTJA 3AQOA 2R92A 1F9NA 5EGEA 2JA5A 3FKIA 2JA7A 4GFQA 4KDDA 4KM9A 2JH3A 3QX3A 5IOQA 4GTBA 4P5BA 3FHZA 4G0UA 2B63A 1BGWA 1TWAA 2JA6A 1WQGA 1B4BA 4FM9A 4C2MC 1ISEA 4GTAA 4GTFA 5JFEA 1EK8A 3VA7A 3FOFA 4KMAA 4DDQA 1ZVUA 3GTOA 3G4CA 4C3JC 1O28A 3OREA 2RH6A 4KC6A 1KQ4A 1AB4A 4BKWA 1WQFA 4KM8A 5TJ3A 2R93A 3AQPA 1K83A 4BLAA 2Y3PA 5IOTA 3H0GA 4KASA 3L4JA 1EH1A 5IORA 1B4AA 2E2IA 3G4AA 3L4KA 3OPFA 1I3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWA A;  1ISE A;  3LAJ A;  1DD5 A;  3LAP A;  1EK8 A;  3VA7 A;  2RGR A;  3FOF A;  4DDQ A;  1BJT A;  1XXC A;  1ZVU A;  5JVO A;  1XXB A;  1GE9 A;  3LPX A;  2ZFZ A;  3ORE A;  4G0V A;  4J3N A;  4KC6 A;  1AB4 A;  3V4G A;  1WQF A;  1XXA A;  3FOE A;  4KAW X;  4G0W A;  3CAG A;  2XCR B;  3NUH A;  3MML B;  1F9N A;  3OEP A;  1WIH A;  2Y3P A;  2P5M A;  2XCQ A;  4GFQ A;  3L4J A;  1IS1 A;  4KDD A;  1EH1 A;  3BUE A;  1B4A A;  3QX3 A;  3ERE D;  2PHC B;  3FHZ A;  1WQH A;  4KB4 A;  3L4K A;  4FM9 A;  4G0U A;  3OPF A;  1BGW A;  5CJ9 A;  2XCO A;  1WQG A;  1B4B A;  4KB2 A; 
#chains in the Genus database with same CATH topology
 5C4J K;  3LAP A;  5L46 A;  2E2H A;  5IP9 C;  3S16 C;  1Y1V K;  4ILD A;  1YNJ A;  1I3Q K;  1I6H K;  2NVY A;  2E2H K;  4LR2 A;  3FKI C;  1TWH A;  4LK1 A;  1JQW A;  2NVY K;  1XXA A;  2V6U A;  1F7V A;  1TWH K;  5TMC A;  1YX2 A;  1L0W A;  3GTG A;  4C3I K;  5FJ8 K;  3K7A C;  1IW7 A;  5CJ9 A;  2XCO A;  3GTG K;  1O24 A;  2R93 C;  3S15 K;  5HL8 A;  3HOU C;  4BLB A;  3GTM A;  4BXX C;  5IYB K;  2YU9 A;  4QJV B;  3N3Y A;  1Y1W A;  3HOV C;  3A8K A;  3GTQ A;  1XZP A;  3GTM K;  2YU9 K;  1Y1W K;  1WCM A;  3GTQ K;  4XLP A;  5C3E K;  4BY7 K;  4OIQ A;  1WQH A;  3HOX C;  2PMZ L;  3SZY A;  1TWC C;  3T02 A;  2VUM C;  5TMF A;  1USM A;  3BP8 C;  3S2D C;  3HOZ K;  4G0V A;  3CQZ C;  1WCM C;  1SMY A;  3GTO K;  3TTG A;  4JK1 A;  3HXA A;  5EGH A;  3M3Y C;  4A3D K;  2R92 A;  5EGE A;  2JA5 A;  4XCH A;  4GFQ A;  2FQT A;  4ZH4 A;  3S1N K;  4QIW D;  2O5J A;  5IOQ A;  4WJ4 A;  4A3L C;  2R92 K;  3S2H C;  1WSV A;  2JA5 K;  5C4X K;  1HI9 A;  2E2I K;  4C2M C;  4GTF A;  1HQM A;  3T00 A;  3FOF A;  1RU0 A;  4BBR K;  5IP7 C;  5D4D A;  4Y7N K;  3G4C A;  1PJ7 A;  1J98 A;  5C4X C;  1KQ4 A;  5M5X K;  3GEH A;  1F93 A;  4QJV A;  3EQL A;  5TJ3 A;  1BS2 A;  1WOR A;  2GAG C;  3AQP A;  2FQO A;  4BBS K;  3I4N K;  4A3C C;  3TFH A;  3GTP K;  3SZZ A;  5IOR A;  3H3V L;  4YFK A;  4OIR A;  2RGR A;  1I50 A;  2NVX K;  4RMF A;  3HOW C;  1TWF A;  4KN7 A;  1O2A A;  1YCL A;  4PAA A;  3GTJ C;  3GTK A;  4KMU A;  3AH5 A;  3GIR A;  1I50 K;  1YNN A;  2JA7 C;  3BP3 A;  4KAT A;  3GTK K;  3FOE A;  3GEI A;  4M1X A;  5IYC C;  2B63 C;  3GTL A;  2XCR B;  2JA6 C;  1USO A;  5IYD C;  4A93 C;  1TWF C;  4A3M K;  3GTL K;  3RZO C;  3S14 K;  4A3B C;  3S1M C;  3S17 C;  1Y1V A;  4A3F K;  1O26 A;  4A3J K;  2E2J C;  1IQ0 A;  2P8T A;  3M4O C;  4GTL A;  5C4J C;  4YFX A;  1ZXO A;  1XPP A;  3S0X A;  1R9T A;  3CAG A;  3JST A;  4AYB L;  1Y1V C;  1I6H C;  1I3Q C;  3OEP A;  1ZBS A;  3T01 A;  5CHP A;  2P5M A;  2E2H C;  1R9T K;  1IL2 A;  2PHC B;  4YFN A;  2NVY C;  4KAR A;  1TWH C;  4LQY A;  4C3I C;  4OIP A;  1PJ5 A;  2CFA B;  2BE5 A;  1XXB A;  2Y0S D;  3GTG C;  2NVT K;  1VRQ C;  3RZD K;  1G51 A;  4G0W A;  3S15 C;  4Y52 K;  3S1Q K;  5M5W K;  3PO2 K;  5IYB C;  2EBB A;  3FHZ A;  4A3I K;  4A3K K;  4G0U A;  1BGW A;  1TWA A;  1B4B A;  3GTM C;  1ZYR A;  4GTA A;  1EK8 A;  3VA7 A;  2YU9 C;  1Y1W C;  2ZUF A;  3AD9 C;  1JVI A;  1TWA K;  3GTQ C;  3GTO A;  5C3E C;  4BY7 C;  1O28 A;  1UV7 A;  4KC6 A;  4BKW A;  1AB4 A;  2PA8 L;  1WQF A;  4A3E K;  1K83 A;  3TFI A;  3H0G A;  3L4J A;  3HOZ C;  1K83 K;  2E2I A;  3GTO C;  3H0G K;  2KWA A;  1BDF A;  1DD5 A;  4A3D C;  3Q3Q A;  1J6W A;  3S1N C;  1DCH A;  1O2F B;  2CFA A;  1WSR A;  4P5A A;  1VLO A;  2JA8 K;  2R92 C;  2JA5 C;  2ZFZ A;  2E2I C;  3GEE A;  1VH2 A;  1VGX A;  3HOY K;  3GTP A;  4BBR C;  4Y7N C;  4A3G K;  3BUE A;  4MQ9 A;  4C3H K;  3S1R K;  1C0A A;  3AD8 C;  4KB4 A;  2R7Z K;  2NVX A;  4MEY A;  4BBS C;  3I4N C;  1F7U A;  4XLN A;  3GTP C;  4GTC A;  1XZQ B;  4LJZ A;  3PO3 K;  4G7Z A;  4X6A K;  2NVX C;  4BY1 K;  1TWG A;  2V6S A;  2WB1 D;  1IS1 A;  1I50 C;  2O5I A;  1TWG K;  4C3J K;  3GTK C;  1PJ6 A;  4GTE A;  5M3F K;  1SFO A;  4KMD A;  3LAJ A;  3I4M K;  2GSN A;  4A3M C;  1SFO K;  3GTL C;  1BJT A;  4YG2 A;  3S14 C;  1GE9 A;  1DCP A;  2NVQ K;  4QIW L;  3V4G A;  1O2B A;  4A3F C;  4A3J C;  1JOE A;  3I4M C;  3AQO A;  1F9N A;  5IP9 K;  3S16 K;  1WOP A;  3FKI A;  4KDD A;  3QX3 A;  5M3M K;  1WOO A;  4GTB A;  2A68 A;  4P5B A;  3FKI K;  1WQG A;  4G7H A;  4PAB A;  1ISE A;  3GDZ A;  3IPJ A;  1R9T C;  1XZQ A;  4O2D A;  3ORE A;  3K7A K;  2R93 A;  1I6V A;  3AD7 C;  1EQR A;  4BLA A;  1IBA A;  2R93 K;  4MEX A;  4KAS A;  3HOU K;  1B4A A;  3L4K A;  2NVT C;  4BXX K;  3OPF A;  3RZD C;  4C45 A;  4NOI A;  5FLM K;  2V6T A;  1J6V A;  4Y52 C;  3HOV K;  5E68 A;  3S1Q C;  2PPB A;  2WB1 L;  5IOS A;  1O29 A;  3PO2 C;  1XXC A;  1TWC A;  4A3I C;  4A3K C;  3H3V D;  4J3N A;  5FLM C;  2A69 A;  3A8J A;  2VUM A;  3HOX K;  4LLG A;  1TWC K;  3HKZ D;  1TWA C;  1O25 A;  3NUH A;  2VUM K;  1WIH A;  2WAQ D;  3CQZ A;  2ZUE A;  5C44 K;  2CW0 A;  1WOS A;  3ERE D;  4G7O A;  3S2D K;  3CQZ K;  1WCM K;  1EFW A;  4A3E C;  5C44 C;  1IE0 A;  3GSI A;  3M3Y K;  1K83 C;  5JVO A;  3H0G C;  4XSZ A;  4A3L K;  3WOD A;  3S2H K;  1O27 A;  4GZY A;  2GSU A;  4FZB A;  4AH6 A;  3N0B A;  4XSX A;  2GAH C;  4GTD A;  4C2M K;  3MML B;  4WJ3 M;  2R7Z A;  2XCQ A;  4OIO A;  2JA8 C;  5IP7 K;  4GT9 A;  2Y0S L;  3HOY C;  1INN A;  4LK0 A;  4KB2 A;  4AYB D;  3N0C A;  2A6E A;  3A8I A;  4A3G C;  1EI6 A;  4A3C K;  4C3H C;  4WIL A;  4KMH A;  3S1R C;  3LPX A;  2R7Z C;  2GSO A;  3DXJ A;  2A6H A;  3ADA C;  1VJE A;  4KAW X;  3GTJ A;  3TFJ A;  3HOW K;  2JA7 A;  3PO3 C;  4X6A C;  4KM9 A;  3GTJ K;  2JH3 A;  5M5Y K;  2B63 A;  2JA6 A;  2JA7 K;  4FM9 A;  3HKZ L;  1V5V A;  4BY1 C;  5JFE A;  1ZQ1 C;  5IYC K;  4KMA A;  2B63 K;  4OIN A;  2WAQ L;  2JA6 K;  4DDQ A;  4LOW A;  1J6X A;  1ZVU A;  4C3J C;  1TWG C;  4A93 K;  5IYD K;  1TWF K;  2RH6 A;  3RZO K;  3S1M K;  4A3B K;  2PMZ D;  4KM8 A;  4Q5S A;  3S17 K;  1XZP B;  1SFO C;  2Y3P A;  5IOT A;  2E2J K;  2NVQ C;  1EH1 A;  1X31 C;  2W7V A;  2PA8 D;  4Q4Z A;  4P9S A;  3G4A A;  2D6F C;  4KN4 A;  3M4O K;  1I3Q A;  1DCO A; 
#chains in the Genus database with same CATH homology
 2KWA A;  1DD5 A;  3LAP A;  2RGR A;  1I50 A;  2E2H A;  3Q3Q A;  1TWF A;  4ILD A;  1O2A A;  5IOS A;  1O29 A;  2CFA A;  3GTK A;  1XXC A;  2NVY A;  1TWC A;  3AH5 A;  4P5A A;  2ZFZ A;  4LR2 A;  4J3N A;  1TWH A;  2VUM A;  4KAT A;  1XXA A;  3FOE A;  4M1X A;  3GTP A;  3GTL A;  2XCR B;  1O25 A;  3NUH A;  1WIH A;  3CQZ A;  3GTG A;  3BUE A;  3ERE D;  4KB4 A;  5CJ9 A;  2XCO A;  2NVX A;  1Y1V A;  1O26 A;  1O24 A;  4BLB A;  4GTC A;  5JVO A;  3GTM A;  2YU9 A;  3N3Y A;  1O27 A;  1Y1W A;  4GTL A;  2GSU A;  4FZB A;  3N0B A;  3GTQ A;  1ZXO A;  3S0X A;  4GTD A;  3CAG A;  1R9T A;  1TWG A;  3MML B;  3OEP A;  1ZBS A;  5CHP A;  2P5M A;  2XCQ A;  2R7Z A;  1WCM A;  1IS1 A;  4GT9 A;  2PHC B;  1WQH A;  4KAR A;  4GTE A;  4KB2 A;  1SFO A;  3N0C A;  4KMD A;  3LAJ A;  4LQY A;  4C3I C;  2GSN A;  1BJT A;  2CFA B;  4C3H C;  4KMH A;  1XXB A;  1GE9 A;  3LPX A;  4G0V A;  2GSO A;  3V4G A;  1O2B A;  4KAW X;  5EGH A;  4G0W A;  3GTJ A;  3AQO A;  2R92 A;  1F9N A;  5EGE A;  2JA5 A;  3FKI A;  2JA7 A;  4GFQ A;  4KDD A;  4KM9 A;  2JH3 A;  3QX3 A;  5IOQ A;  4GTB A;  4P5B A;  3FHZ A;  4G0U A;  2B63 A;  1BGW A;  1TWA A;  2JA6 A;  1WQG A;  1B4B A;  4FM9 A;  4C2M C;  1ISE A;  4GTA A;  4GTF A;  5JFE A;  1EK8 A;  3VA7 A;  3FOF A;  4KMA A;  4DDQ A;  1ZVU A;  3GTO A;  3G4C A;  4C3J C;  1O28 A;  3ORE A;  2RH6 A;  4KC6 A;  1KQ4 A;  1AB4 A;  4BKW A;  1WQF A;  4KM8 A;  5TJ3 A;  2R93 A;  3AQP A;  1K83 A;  4BLA A;  2Y3P A;  5IOT A;  3H0G A;  4KAS A;  3L4J A;  1EH1 A;  5IOR A;  1B4A A;  2E2I A;  3G4A A;  3L4K A;  3OPF A;  1I3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...