2P5MA

C-terminal domain hexamer of ahrc bound with l-arginine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
QRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor L-arginine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 24
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2p5mA00
3MMLB 1DD5A 1WQHA 1BGWA 5JVOA 2XCRB 3QX3A 3NUHA 3L4KA 2Y3PA 3OEPA 3FOFA 4G0UA 3OPFA 4KC6A 2P5MA 4KB2A 5CJ9A 2RGRA 1IS1A 3OREA 1B4BA 4GFQA 2ZFZA 2PHCB 4KDDA 1XXCA 3LAPA 1EH1A 1AB4A 2KWAA 3L4JA 4FM9A 3V4GA 1XXAA 4G0WA 1EK8A 3LAJA 1F9NA 3FHZA 1B4AA 3CAGA 3LPXA 1WIHA 2XCQA 3ERED 1XXBA 4DDQA 4KAWX 4J3NA 4KB4A 3FOEA 4G0VA 1WQFA 2XCOA 1ISEA 1WQGA 1BJTA 1GE9A 3VA7A 3BUEA 1ZVUA
chains in the Genus database with same CATH superfamily
3GTPA 2JH3A 2Y3PA 1TWHA 3FOFA 2R93A 3GTMC 3RZOC 3A8KA 3HOYK 2JA5C 1DCPA 4C45A 2ZFZA 5IP7C 1YNJA 3GTJK 4LJZA 3DXJA 3L4JA 1XXAA 1Y1VA 3S2DC 2WB1D 2FQTA 1O28A 3GDZA 4A3KK 1WQFA 2B63C 4BY1C 5L46A 1WQHA 1VRQC 4P5BA 3GTJA 5M5WK 3GTMK 1JOEA 4A3GK 1IQ0A 1JVIA 4M1XA 1IL2A 2JA6C 3S2HC 5C4JC 4A3IK 1WCMC 4Y7NK 3GTLC 3SZZA 2R7ZC 1L0WA 4A3CC 4C2MC 2NVTK 3FKIC 3A8JA 2W7VA 1ZQ1C 2O5JA 3VA7A 4A3EC 4LOWA 3GTKC 3QX3A 1TWGC 2GSNA 1YX2A 1XPPA 2JA6K 5CHPA 3SZYA 4G0UA 1WOPA 5C4JK 2P5MA 1F7VA 1WCMK 2JA7K 3GTLK 4A93K 1R9TC 4C2MK 3PO3C 2CFAA 3HKZL 3GTOC 1HI9A 5IYCK 2CFAB 3S1MK 3T00A 2PA8L 2JA7A 5JFEA 3GTKK 2PPBA 1WSVA 1O24A 3S1NK 4KC6A 1R9TK 3TTGA 3A8IA 1I50K 2VUMK 1K83A 1EK8A 3GTGC 3GTOK 2R92C 1XXBA 4C3IC 3K7AK 2D6FC 4Q5SA 2GSOA 1INNA 3BUEA 5C3EK 4QJVA 1TWAC 1I50A 2VUMA 4OIPA 4KN4A 3BP8C 2RH6A 4WJ4A 2Y0SL 1Y1WK 4QJVB 2RGRA 5TJ3A 4XCHA 2KWAA 1I6VA 2NVXC 1XZPA 4G0WA 1J98A 1WIHA 4C3IK 1ZBSA 4BBSC 4QIWD 2NVQC 1VGXA 5M5YK 1Y1WA 1XZPB 3T02A 4Q4ZA 1TWAK 2E2IK 2WAQL 1O2AA 1GE9A 1DCOA 3M4OC 4C3HC 1BDFA 4A3JC 1TWFC 4XLNA 4LK0A 4KM9A 4A3DC 2JA8K 1USOA 2NVYK 5CJ9A 4KB2A 1I3QA 1SFOC 3H0GK 4OIOA 3M3YK 2E2IA 4A3FK 1G51A 3FHZA 4BBSK 1X31C 2NVQK 1TWCC 5IYBC 2NVYA 3M4OK 4BXXK 4A3JK 5C4XC 1TWFK 3CQZC 3H0GA 2Y0SD 1J6WA 1XZQA 2CW0A 4A3DK 1SMYA 2E2HC 4BLAA 2V6UA 1WORA 3RZOK 2JA5K 1XZQB 1O25A 2PMZL 4YFKA 5IP7K 2PHCB 1EQRA 4AYBD 3S2DK 5IYBK 1RU0A 4MEYA 3GTMA 3Q3QA 2JA5A 1KQ4A 3CQZK 2B63K 4BY1K 3AQPA 1WQGA 1O26A 3HOXC 3GTQC 4A3LC 3N0CA 1PJ5A 4BY7C 4XLPA 3S2HK 3OPFA 4GTAA 1YCLA 5E68A 1I6HC 4A3MC 3S15C 4KDDA 3TFJA 2R7ZK 4ILDA 3S0XA 5FJ8K 4A3CK 1PJ6A 2GAHC 4P5AA 5IYDC 3LPXA 3FKIK 2E2JC 3G4CA 3N0BA 2JA6A 1V5VA 4G0VA 3GTQK 4YFNA 4PABA 4A3EK 2BE5A 2PMZD 1WCMA 3GTLA 3AH5A 1K83C 1TWGK 1BGWA 2R7ZA 3NUHA 4C3JC 3HOUC 5IP9C 3S15K 3BP3A 3FKIA 4G7HA 3HOWC 3S14C 4WJ3M 4GFQA 4GTCA 3RZDC 3PO3K 1XXCA 4FM9A 2E2JK 3GTKA 4P9SA 3S1RC 4DDQA 4OIRA 2P8TA 3G4AA 2YU9C 3H3VL 3S17C 5C44C 1R9TA 3S1QC 1ZVUA 3MMLB 1DD5A 5IP9K 3S14K 4A3BC 4X6AC 3T01A 4KMHA 4OIQA 3GTOA 5EGHA 3RZDK 1J6XA 3HKZD 4LQYA 3GTGK 3GTPC 4KMAA 1F9NA 2R92K 2A68A 2PA8D 2YU9K 3HOZC 1TWHC 4GT9A 4O2DA 2R93C 4LR2A 4BBRC 4KATA 1BS2A 3GEHA 2WB1L 2ZUFA 4KARA 3I4NC 1Y1VC 3GEIA 4YG2A 3GTGA 4X6AK 1HQMA 4GTDA 3TFIA 4OINA 3HOYC 4WILA 2NVXK 1O2FB 3LAPA 1TWAA 3V4GA 3GTJC 2R93K 4KAWX 4KB4A 3ADAC 4A3KC 3I4NK 1ISEA 4KMDA 4C3HK 1Y1VK 5FLMC 1DCHA 4ZH4A 2NVXA 3PO2C 3I4MC 2FQOA 4KM8A 4A3GC 3S16C 1SFOK 4A3IC 4Y7NC 1TWFA 1VH2A 4BKWA 2V6SA 1TWCK 2XCQA 1O2BA 1O29A 2WAQD 3N3YA 1USMA 2NVTC 2O5IA 1F93A 5FLMK 1VJEA 1VLOA 5C4XK 3FOEA 1SFOA 4MEXA 3GEEA 1BJTA 4KMUA 3PO2K 2E2HK 1WSRA 3GSIA 3I4MK 2XCRB 3S16K 1TWCA 1EFWA 1JQWA 3AQOA 4Y52C 1EI6A 5TMCA 5D4DA 1B4BA 2JA7C 3CQZA 4A93C 1C0AA 2B63A 3HOVC 1PJ7A 2A6HA 2A69A 2E2HA 1ZXOA 4GTEA 2GAGC 4PAAA 5IYCC 3JSTA 4GTBA 5IOSA 3S1MC 4G7OA 3HOXK 4AH6A 4A3LK 1IW7A 1WOSA 5JVOA 2EBBA 5IOTA 5HL8A 3L4KA 2ZUEA 4BY7K 4Y52K 3OEPA 4MQ9A 5M3FK 4XSZA 1I6HK 4KASA 4A3MK 1IE0A 1F7UA 3S1NC 3HOVK 2GSUA 2V6TA 4GTLA 3GTQA 1J6VA 1I50C 5IYDK 2VUMC 3LAJA 1TWGA 3TFHA 3WODA 3IPJA 3GIRA 4JK1A 3K7AC 1ZYRA 3HXAA 1K83K 4G7ZA 4KN7A 4QIWL 5C3EC 4C3JK 3HOUK 3HOWK 3AD9C 1IBAA 1Y1WC 4YFXA 3OREA 3AD8C 1YNNA 1EH1A 4FZBA 1WOOA 1B4AA 3S1RK 4LK1A 3ERED 1O27A 4GZYA 5M5XK 4J3NA 3S17K 5C44K 5TMFA 1I3QC 3S1QK 2E2IC 4LLGA 4A3BK 4XSXA 4RMFA 2A6EA 2R92A 5IORA 2JA8C 2YU9A 5M3MK 2NVYC 1IS1A 4NOIA 3H0GC 5EGEA 3EQLA 1UV7A 3GTPK 3M3YC 1AB4A 3H3VD 4A3FC 4BLBA 3CAGA 3AD7C 1TWHK 3HOZK 1I3QK 4AYBL 4BBRK 4GTFA 2XCOA 4BXXC 5IOQA
chains in the Genus database with same CATH topology
3AH5A 3GTPA 1BGWA 1I50A 2R7ZA 2VUMA 2XCRB 2JH3A 3NUHA 2Y3PA 4C3JC 2RH6A 1TWHA 1TWCA 3FOFA 3FKIA 2R93A 3AQOA 2RGRA 5TJ3A 1B4BA 4GFQA 4GTCA 2ZFZA 3CQZA 2B63A 1XXCA 2KWAA 4FM9A 3L4JA 3GTKA 1XXAA 1ZXOA 1Y1VA 4G0WA 2E2HA 1WIHA 4GTEA 4DDQA 1ZBSA 1O28A 3G4AA 1Y1WA 1WQFA 4GTBA 5IOSA 1R9TA 1O2AA 1GE9A 1ZVUA 4C3HC 3MMLB 1DD5A 1WQHA 5JVOA 4P5BA 3GTJA 5IOTA 3L4KA 4KM9A 3OEPA 4KASA 4KMHA 4M1XA 3GTOA 5EGHA 5CJ9A 4KB2A 1I3QA 2GSUA 4GTLA 2E2IA 4LQYA 3GTQA 3LAJA 4KMAA 1F9NA 4C2MC 3FHZA 1TWGA 4GT9A 4LR2A 2NVYA 4KATA 3H0GA 3VA7A 4KARA 4BLAA 3GTGA 3QX3A 2GSNA 4GTDA 5CHPA 1O25A 4G0UA 2P5MA 3OREA 2PHCB 3LAPA 1EH1A 1TWAA 2CFAA 4FZBA 3V4GA 1B4AA 3ERED 1O27A 3GTMA 3Q3QA 4KAWX 2JA5A 4J3NA 1KQ4A 4KB4A 2CFAB 1ISEA 3AQPA 1WQGA 5JFEA 4KMDA 2JA7A 1O26A 2NVXA 3N0CA 1O24A 2R92A 4KM8A 3OPFA 4GTAA 5IORA 4KC6A 2YU9A 1IS1A 4KDDA 5EGEA 4ILDA 1AB4A 3S0XA 1TWFA 4BKWA 1K83A 1EK8A 4P5AA 4BLBA 3CAGA 3LPXA 2XCQA 1O2BA 1O29A 3N3YA 1XXBA 3G4CA 3N0BA 4C3IC 4GTFA 2JA6A 3FOEA 4G0VA 1SFOA 2XCOA 1BJTA 2GSOA 1WCMA 3GTLA 3BUEA 5IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MML B;  1DD5 A;  1WQH A;  1BGW A;  5JVO A;  2XCR B;  3QX3 A;  3NUH A;  3L4K A;  2Y3P A;  3OEP A;  3FOF A;  4G0U A;  3OPF A;  4KC6 A;  2P5M A;  4KB2 A;  5CJ9 A;  2RGR A;  1IS1 A;  3ORE A;  1B4B A;  4GFQ A;  2ZFZ A;  2PHC B;  4KDD A;  1XXC A;  3LAP A;  1EH1 A;  1AB4 A;  2KWA A;  3L4J A;  4FM9 A;  3V4G A;  1XXA A;  4G0W A;  1EK8 A;  3LAJ A;  1F9N A;  3FHZ A;  1B4A A;  3CAG A;  3LPX A;  1WIH A;  2XCQ A;  3ERE D;  1XXB A;  4DDQ A;  4KAW X;  4J3N A;  4KB4 A;  3FOE A;  4G0V A;  1WQF A;  2XCO A;  1ISE A;  1WQG A;  1BJT A;  1GE9 A;  3VA7 A;  3BUE A;  1ZVU A; 
#chains in the Genus database with same CATH topology
 3GTP A;  2JH3 A;  2Y3P A;  1TWH A;  3FOF A;  2R93 A;  3GTM C;  3RZO C;  3A8K A;  3HOY K;  2JA5 C;  1DCP A;  4C45 A;  2ZFZ A;  5IP7 C;  1YNJ A;  3GTJ K;  4LJZ A;  3DXJ A;  3L4J A;  1XXA A;  1Y1V A;  3S2D C;  2WB1 D;  2FQT A;  1O28 A;  3GDZ A;  4A3K K;  1WQF A;  2B63 C;  4BY1 C;  5L46 A;  1WQH A;  1VRQ C;  4P5B A;  3GTJ A;  5M5W K;  3GTM K;  1JOE A;  4A3G K;  1IQ0 A;  1JVI A;  4M1X A;  1IL2 A;  2JA6 C;  3S2H C;  5C4J C;  4A3I K;  1WCM C;  4Y7N K;  3GTL C;  3SZZ A;  2R7Z C;  1L0W A;  4A3C C;  4C2M C;  2NVT K;  3FKI C;  3A8J A;  2W7V A;  1ZQ1 C;  2O5J A;  3VA7 A;  4A3E C;  4LOW A;  3GTK C;  3QX3 A;  1TWG C;  2GSN A;  1YX2 A;  1XPP A;  2JA6 K;  5CHP A;  3SZY A;  4G0U A;  1WOP A;  5C4J K;  2P5M A;  1F7V A;  1WCM K;  2JA7 K;  3GTL K;  4A93 K;  1R9T C;  4C2M K;  3PO3 C;  2CFA A;  3HKZ L;  3GTO C;  1HI9 A;  5IYC K;  2CFA B;  3S1M K;  3T00 A;  2PA8 L;  2JA7 A;  5JFE A;  3GTK K;  2PPB A;  1WSV A;  1O24 A;  3S1N K;  4KC6 A;  1R9T K;  3TTG A;  3A8I A;  1I50 K;  2VUM K;  1K83 A;  1EK8 A;  3GTG C;  3GTO K;  2R92 C;  1XXB A;  4C3I C;  3K7A K;  2D6F C;  4Q5S A;  2GSO A;  1INN A;  3BUE A;  5C3E K;  4QJV A;  1TWA C;  1I50 A;  2VUM A;  4OIP A;  4KN4 A;  3BP8 C;  2RH6 A;  4WJ4 A;  2Y0S L;  1Y1W K;  4QJV B;  2RGR A;  5TJ3 A;  4XCH A;  2KWA A;  1I6V A;  2NVX C;  1XZP A;  4G0W A;  1J98 A;  1WIH A;  4C3I K;  1ZBS A;  4BBS C;  4QIW D;  2NVQ C;  1VGX A;  5M5Y K;  1Y1W A;  1XZP B;  3T02 A;  4Q4Z A;  1TWA K;  2E2I K;  2WAQ L;  1O2A A;  1GE9 A;  1DCO A;  3M4O C;  4C3H C;  1BDF A;  4A3J C;  1TWF C;  4XLN A;  4LK0 A;  4KM9 A;  4A3D C;  2JA8 K;  1USO A;  2NVY K;  5CJ9 A;  4KB2 A;  1I3Q A;  1SFO C;  3H0G K;  4OIO A;  3M3Y K;  2E2I A;  4A3F K;  1G51 A;  3FHZ A;  4BBS K;  1X31 C;  2NVQ K;  1TWC C;  5IYB C;  2NVY A;  3M4O K;  4BXX K;  4A3J K;  5C4X C;  1TWF K;  3CQZ C;  3H0G A;  2Y0S D;  1J6W A;  1XZQ A;  2CW0 A;  4A3D K;  1SMY A;  2E2H C;  4BLA A;  2V6U A;  1WOR A;  3RZO K;  2JA5 K;  1XZQ B;  1O25 A;  2PMZ L;  4YFK A;  5IP7 K;  2PHC B;  1EQR A;  4AYB D;  3S2D K;  5IYB K;  1RU0 A;  4MEY A;  3GTM A;  3Q3Q A;  2JA5 A;  1KQ4 A;  3CQZ K;  2B63 K;  4BY1 K;  3AQP A;  1WQG A;  1O26 A;  3HOX C;  3GTQ C;  4A3L C;  3N0C A;  1PJ5 A;  4BY7 C;  4XLP A;  3S2H K;  3OPF A;  4GTA A;  1YCL A;  5E68 A;  1I6H C;  4A3M C;  3S15 C;  4KDD A;  3TFJ A;  2R7Z K;  4ILD A;  3S0X A;  5FJ8 K;  4A3C K;  1PJ6 A;  2GAH C;  4P5A A;  5IYD C;  3LPX A;  3FKI K;  2E2J C;  3G4C A;  3N0B A;  2JA6 A;  1V5V A;  4G0V A;  3GTQ K;  4YFN A;  4PAB A;  4A3E K;  2BE5 A;  2PMZ D;  1WCM A;  3GTL A;  3AH5 A;  1K83 C;  1TWG K;  1BGW A;  2R7Z A;  3NUH A;  4C3J C;  3HOU C;  5IP9 C;  3S15 K;  3BP3 A;  3FKI A;  4G7H A;  3HOW C;  3S14 C;  4WJ3 M;  4GFQ A;  4GTC A;  3RZD C;  3PO3 K;  1XXC A;  4FM9 A;  2E2J K;  3GTK A;  4P9S A;  3S1R C;  4DDQ A;  4OIR A;  2P8T A;  3G4A A;  2YU9 C;  3H3V L;  3S17 C;  5C44 C;  1R9T A;  3S1Q C;  1ZVU A;  3MML B;  1DD5 A;  5IP9 K;  3S14 K;  4A3B C;  4X6A C;  3T01 A;  4KMH A;  4OIQ A;  3GTO A;  5EGH A;  3RZD K;  1J6X A;  3HKZ D;  4LQY A;  3GTG K;  3GTP C;  4KMA A;  1F9N A;  2R92 K;  2A68 A;  2PA8 D;  2YU9 K;  3HOZ C;  1TWH C;  4GT9 A;  4O2D A;  2R93 C;  4LR2 A;  4BBR C;  4KAT A;  1BS2 A;  3GEH A;  2WB1 L;  2ZUF A;  4KAR A;  3I4N C;  1Y1V C;  3GEI A;  4YG2 A;  3GTG A;  4X6A K;  1HQM A;  4GTD A;  3TFI A;  4OIN A;  3HOY C;  4WIL A;  2NVX K;  1O2F B;  3LAP A;  1TWA A;  3V4G A;  3GTJ C;  2R93 K;  4KAW X;  4KB4 A;  3ADA C;  4A3K C;  3I4N K;  1ISE A;  4KMD A;  4C3H K;  1Y1V K;  5FLM C;  1DCH A;  4ZH4 A;  2NVX A;  3PO2 C;  3I4M C;  2FQO A;  4KM8 A;  4A3G C;  3S16 C;  1SFO K;  4A3I C;  4Y7N C;  1TWF A;  1VH2 A;  4BKW A;  2V6S A;  1TWC K;  2XCQ A;  1O2B A;  1O29 A;  2WAQ D;  3N3Y A;  1USM A;  2NVT C;  2O5I A;  1F93 A;  5FLM K;  1VJE A;  1VLO A;  5C4X K;  3FOE A;  1SFO A;  4MEX A;  3GEE A;  1BJT A;  4KMU A;  3PO2 K;  2E2H K;  1WSR A;  3GSI A;  3I4M K;  2XCR B;  3S16 K;  1TWC A;  1EFW A;  1JQW A;  3AQO A;  4Y52 C;  1EI6 A;  5TMC A;  5D4D A;  1B4B A;  2JA7 C;  3CQZ A;  4A93 C;  1C0A A;  2B63 A;  3HOV C;  1PJ7 A;  2A6H A;  2A69 A;  2E2H A;  1ZXO A;  4GTE A;  2GAG C;  4PAA A;  5IYC C;  3JST A;  4GTB A;  5IOS A;  3S1M C;  4G7O A;  3HOX K;  4AH6 A;  4A3L K;  1IW7 A;  1WOS A;  5JVO A;  2EBB A;  5IOT A;  5HL8 A;  3L4K A;  2ZUE A;  4BY7 K;  4Y52 K;  3OEP A;  4MQ9 A;  5M3F K;  4XSZ A;  1I6H K;  4KAS A;  4A3M K;  1IE0 A;  1F7U A;  3S1N C;  3HOV K;  2GSU A;  2V6T A;  4GTL A;  3GTQ A;  1J6V A;  1I50 C;  5IYD K;  2VUM C;  3LAJ A;  1TWG A;  3TFH A;  3WOD A;  3IPJ A;  3GIR A;  4JK1 A;  3K7A C;  1ZYR A;  3HXA A;  1K83 K;  4G7Z A;  4KN7 A;  4QIW L;  5C3E C;  4C3J K;  3HOU K;  3HOW K;  3AD9 C;  1IBA A;  1Y1W C;  4YFX A;  3ORE A;  3AD8 C;  1YNN A;  1EH1 A;  4FZB A;  1WOO A;  1B4A A;  3S1R K;  4LK1 A;  3ERE D;  1O27 A;  4GZY A;  5M5X K;  4J3N A;  3S17 K;  5C44 K;  5TMF A;  1I3Q C;  3S1Q K;  2E2I C;  4LLG A;  4A3B K;  4XSX A;  4RMF A;  2A6E A;  2R92 A;  5IOR A;  2JA8 C;  2YU9 A;  5M3M K;  2NVY C;  1IS1 A;  4NOI A;  3H0G C;  5EGE A;  3EQL A;  1UV7 A;  3GTP K;  3M3Y C;  1AB4 A;  3H3V D;  4A3F C;  4BLB A;  3CAG A;  3AD7 C;  1TWH K;  3HOZ K;  1I3Q K;  4AYB L;  4BBR K;  4GTF A;  2XCO A;  4BXX C;  5IOQ A; 
#chains in the Genus database with same CATH homology
 3AH5 A;  3GTP A;  1BGW A;  1I50 A;  2R7Z A;  2VUM A;  2XCR B;  2JH3 A;  3NUH A;  2Y3P A;  4C3J C;  2RH6 A;  1TWH A;  1TWC A;  3FOF A;  3FKI A;  2R93 A;  3AQO A;  2RGR A;  5TJ3 A;  1B4B A;  4GFQ A;  4GTC A;  2ZFZ A;  3CQZ A;  2B63 A;  1XXC A;  2KWA A;  4FM9 A;  3L4J A;  3GTK A;  1XXA A;  1ZXO A;  1Y1V A;  4G0W A;  2E2H A;  1WIH A;  4GTE A;  4DDQ A;  1ZBS A;  1O28 A;  3G4A A;  1Y1W A;  1WQF A;  4GTB A;  5IOS A;  1R9T A;  1O2A A;  1GE9 A;  1ZVU A;  4C3H C;  3MML B;  1DD5 A;  1WQH A;  5JVO A;  4P5B A;  3GTJ A;  5IOT A;  3L4K A;  4KM9 A;  3OEP A;  4KAS A;  4KMH A;  4M1X A;  3GTO A;  5EGH A;  5CJ9 A;  4KB2 A;  1I3Q A;  2GSU A;  4GTL A;  2E2I A;  4LQY A;  3GTQ A;  3LAJ A;  4KMA A;  1F9N A;  4C2M C;  3FHZ A;  1TWG A;  4GT9 A;  4LR2 A;  2NVY A;  4KAT A;  3H0G A;  3VA7 A;  4KAR A;  4BLA A;  3GTG A;  3QX3 A;  2GSN A;  4GTD A;  5CHP A;  1O25 A;  4G0U A;  2P5M A;  3ORE A;  2PHC B;  3LAP A;  1EH1 A;  1TWA A;  2CFA A;  4FZB A;  3V4G A;  1B4A A;  3ERE D;  1O27 A;  3GTM A;  3Q3Q A;  4KAW X;  2JA5 A;  4J3N A;  1KQ4 A;  4KB4 A;  2CFA B;  1ISE A;  3AQP A;  1WQG A;  5JFE A;  4KMD A;  2JA7 A;  1O26 A;  2NVX A;  3N0C A;  1O24 A;  2R92 A;  4KM8 A;  3OPF A;  4GTA A;  5IOR A;  4KC6 A;  2YU9 A;  1IS1 A;  4KDD A;  5EGE A;  4ILD A;  1AB4 A;  3S0X A;  1TWF A;  4BKW A;  1K83 A;  1EK8 A;  4P5A A;  4BLB A;  3CAG A;  3LPX A;  2XCQ A;  1O2B A;  1O29 A;  3N3Y A;  1XXB A;  3G4C A;  3N0B A;  4C3I C;  4GTF A;  2JA6 A;  3FOE A;  4G0V A;  1SFO A;  2XCO A;  1BJT A;  2GSO A;  1WCM A;  3GTL A;  3BUE A;  5IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...