5C3EK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c3eK00
4OIOA 4A3LK 1TWCK 2R93C 4OIPA 3M3YK 1TWAK 5IYCC 4A3LC 3HOZK 3HOWK 4KMUA 1Y1WC 2WB1D 4MEYA 4OINA 1SFOK 2B63C 2A68A 3FKIC 5C44C 5IP9K 4C3IK 2YU9C 2NVQC 3GTPC 1YNJA 5FLMC 2PA8D 3GTJK 3S1RC 2R92C 3EQLA 5C4XC 4Q4ZA 4A3EK 3GTOC 3GTQK 3S15K 3K7AK 3S16K 2R92K 5M5XK 3GTJC 4BY1K 3I4NK 4A3DC 3GTPK 4BBSK 4G7OA 4C2MK 4Y52K 3CQZK 5IP9C 1R9TK 1TWHC 2NVYK 3H0GK 4XSXA 4QJVB 2JA5C 3RZOC 4BBSC 3I4MC 4ZH4A 3I4NC 5M5WK 3GTKC 3GTOK 3K7AC 1Y1VK 2E2JC 2JA8C 2PMZD 1TWAC 2WAQD 4YFXA 5D4DA 4NOIA 4A3FC 4C3JK 5FLMK 2NVQK 4OIQA 4AYBD 3GTMC 4XSZA 4A3JK 3HOVK 2PA8L 5IP7K 2JA7K 2O5JA 2BE5A 4Y52C 3PO3C 4QJVA 4OIRA 4BBRK 2WB1L 4JK1A 4LK1A 2A69A 5IYBC 1I6VA 3S2HK 5C4XK 4A93C 3M3YC 4Y7NC 1K83K 3HOUC 4X6AK 5IP7C 1Y1WK 4A3IC 2JA7C 1ZYRA 3S1QC 3HKZL 1WCMC 2E2IC 4Y7NK 4A3FK 3S1MC 3HOXK 4G7ZA 5FJ8K 2JA6C 3S17K 1TWFK 3RZDK 3S2HC 4A93K 3HOXC 4A3MK 4BBRC 3GTLC 1IW7A 3S1QK 3I4MK 5C3EK 4MEXA 1I3QK 2E2HK 4BY7K 3RZOK 3HOUK 3H3VL 4A3JC 1YNNA 2R7ZC 1K83C 1TWHK 2NVYC 3H0GC 3GTMK 5TMFA 2NVXC 2Y0SD 1I6HC 3WODA 3DXJA 3PO2C 3S1NC 2VUMK 3M4OK 1I50C 4A3BK 4A3GC 1Y1VC 2Y0SL 4LJZA 2E2JK 2JA8K 2PPBA 3GTGC 2VUMC 5M5YK 3GTKK 3M4OC 5IYDK 4QIWD 3PO3K 1I6HK 5M3MK 2YU9K 3S2DC 4A3CC 4LK0A 1R9TC 2JA5K 4A3KC 3HOYC 4KN7A 3S2DK 4A3CK 2NVTK 5C3EC 5IYDC 2E2HC 4BXXK 1XPPA 4MQ9A 4AYBL 3GTGK 4A3EC 3HOZC 3S16C 4XLPA 3GTQC 3HKZD 1TWFC 3RZDC 1BDFA 1I50K 4Q5SA 2JA6K 2WAQL 3PO2K 3S1RK 3S1NK 2NVTC 4BXXC 1WCMK 5C44K 2E2IK 4A3KK 2A6HA 2B63K 1HQMA 1SMYA 3CQZC 4YFKA 1I3QC 4BY1C 4BY7C 3HOWC 4A3DK 4LLGA 5TMCA 5M3FK 4A3MC 3GTLK 3H3VD 5IYCK 5C4JK 4YFNA 3S14K 3S15C 2A6EA 4A3BC 4A3GK 2O5IA 5IYBK 1TWCC 4C3HK 4YG2A 3S17C 3S1MK 5C4JC 1TWGK 2R93K 3S14C 2NVXK 3HOYK 4KN4A 3FKIK 4XLNA 2R7ZK 4X6AC 1SFOC 4A3IK 4QIWL 4G7HA 3HOVC 2CW0A 2PMZL 1TWGC 4GZYA
chains in the Genus database with same CATH superfamily
4OIOA 1EI6A 1TWCK 2R93C 1TWAK 2W7VA 2R93A 1XZPB 4MEYA 2GAHC 5C44C 5IP9K 3A8JA 2YU9C 3GTPC 2PA8D 3N0CA 2R92C 4KMDA 4PABA 3N0BA 2R92K 1B4BA 4KARA 3GTPK 4G7OA 2NVYK 4QJVB 2JA7A 4C3JC 3I4MC 4ZH4A 3QX3A 3K7AC 1Y1VK 1AB4A 4FM9A 3GTQA 2ZUEA 4GTAA 4C3JK 1PJ5A 3CQZA 4A3JK 5HL8A 3OPFA 2BE5A 3AD9C 3PO3C 4QJVA 4OIRA 2PHCB 5CJ9A 4BLBA 4WILA 1UV7A 4XCHA 1I6VA 1HI9A 2V6SA 1ZQ1C 4Y7NC 1IS1A 4P9SA 1F7UA 2XCOA 2GSOA 1PJ6A 4DDQA 5FJ8K 2JA6C 3S0XA 4PAAA 4A3MK 3GTLC 4MEXA 2GSUA 4KATA 2RH6A 2NVYC 1XZQB 3GTGA 2VUMK 3M4OK 1J6XA 1ZVUA 4A3GC 2Y0SL 2E2JK 3GTGC 3GTKK 5IYDK 4QIWD 2ZFZA 1I3QA 4A3CC 4KDDA 1DCPA 2JA5K 1TWHA 4KN7A 1WIHA 1XXBA 3TFIA 3GEEA 4XLPA 3HKZD 1TWFC 3RZDC 1BDFA 1BJTA 1TWGA 3PO2K 3S1RK 2E2IK 5C44K 4LR2A 5CHPA 4BY7C 4KASA 4GTFA 5TMCA 5M3FK 3LAPA 4A3BC 4YG2A 4P5BA 5C4JC 4KN4A 3FKIK 4XLNA 2R7ZK 4X6AC 1WOPA 2PMZL 5JVOA 4GZYA 4A3LK 4OIPA 3M3YK 3GEIA 3HOZK 1Y1WC 3H0GA 1SFOK 4RMFA 5IORA 2NVQC 5FLMC 3GTJK 3GTOA 5C4XC 4G0WA 3CAGA 1WSVA 3GTOC 4KB4A 3OREA 4BY1K 4A3DC 4Y52K 4C2MK 1R9TK 3TFHA 1J98A 4GTEA 3I4NC 1EH1A 4GTLA 1DCHA 4A3FC 2Y3PA 5FLMK 1BS2A 3GTPA 3GTMC 4XSZA 2GSNA 1O26A 2PA8L 2CFAB 5IP7K 2JA7K 1G51A 1PJ7A 1O29A 2JH3A 1Y1VA 1TWFA 5IYBC 3M3YC 1ZXOA 3HOUC 1J6VA 5IP7C 1Y1WK 1O2FB 2JA7C 1ZYRA 2E2IC 2FQOA 4A3FK 3S1MC 3AD7C 3N3YA 5E68A 1VJEA 4BKWA 1K83A 4BY7K 3HOUK 1K83C 3BUEA 3GTMK 5TMFA 1C0AA 3WODA 3PO2C 3BP3A 4LJZA 1DD5A 2JA8K 2P8TA 2VUMC 3M4OC 3T01A 1I6HK 3L4KA 5TJ3A 1R9TC 4A3CK 4WJ3M 3VA7A 3GTLA 4MQ9A 3HOZC 1YX2A 4Q5SA 3T00A 2WAQL 3ADAC 1WCMK 1VGXA 4C3IC 1ISEA 2B63K 1HQMA 2RGRA 3CQZC 1RU0A 4BY1C 4A3DK 3HOWC 2KWAA 3H3VD 4O2DA 5IYCK 4YFNA 2P5MA 2A6EA 1VH2A 4A3GK 2R93K 3BP8C 2NVXK 3HOYK 1XXAA 3LAJA 4KM8A 1JQWA 1SFOC 4G7HA 2EBBA 1TWGC 1EK8A 1EFWA 1F93A 4GTCA 4A3LC 3FKIA 3TFJA 2R7ZA 1O2AA 2WB1D 4OINA 3HXAA 1V5VA 3FKIC 4C3IK 3GIRA 1YNJA 1XZQA 3EQLA 4KB2A 4C45A 3S16K 3S15K 3K7AK 3T02A 5M5XK 5IP9C 3H0GK 4XSXA 3V4GA 4KC6A 1INNA 1XZPA 4BBSC 3GTJA 5M5WK 3GTOK 2E2JC 2JA8C 2PMZD 1O28A 1TWAC 5D4DA 2R92A 4NOIA 2NVQK 2CFAA 4OIQA 1B4AA 1R9TA 4KMHA 1J6WA 5IOSA 1USMA 2E2HA 4X6AK 1JOEA 3Q3QA 4GTDA 1WCMC 1IE0A 4WJ4A 3G4AA 2V6TA 4GFQA 3S2HC 4A93K 3FOFA 1IQ0A 4BBRC 1IW7A 3MMLB 3I4MK 4P5AA 1BGWA 4A3JC 1YNNA 1Y1WA 4AH6A 1WQGA 3H0GC 3TTGA 2JA5A 2NVXC 1I6HC 3DXJA 1I50C 1Y1VC 3JSTA 4ILDA 1I50A 2JA6A 1O25A 1X31C 5IOQA 3PO3K 2XCQA 2E2IA 2YU9K 4LK0A 4A3KC 5C3EC 5IYDC 2E2HC 1XPPA 1IL2A 4BLAA 4AYBL 3GTGK 3S16C 3GTQC 3A8IA 1O24A 3AQOA 3S1NK 4LOWA 2NVTC 4BXXC 4GTBA 2A6HA 1SMYA 1JVIA 3AD8C 1I3QC 3IPJA 4A3MC 5EGEA 1F9NA 1TWCA 3S15C 1TWAA 3FHZA 5L46A 5IYBK 1TWCC 4C3HK 2O5IA 3S17C 1TWGK 4KM9A 3S14C 5IOTA 3FOEA 4A3IK 4QIWL 3HOVC 2CW0A 4J3NA 3AQPA 3GEHA 5IYCC 2XCRB 4KAWX 4M1XA 3HOWK 4KMUA 2NVYA 2B63C 2A68A 1WQHA 3G4CA 3S1RC 1WSRA 4KMAA 5EGHA 3SZYA 4Q4ZA 4A3EK 3GTQK 1WOSA 4GT9A 3GTJC 3NUHA 3I4NK 4BBSK 3SZZA 3CQZK 1TWHC 2JA5C 1SFOA 3RZOC 3GSIA 3GTKC 1KQ4A 1DCOA 1USOA 4G0VA 1IBAA 2WAQD 4YFXA 1O2BA 4AYBD 3HOVK 2O5JA 3AH5A 4C2MC 4Y52C 1XXCA 4BBRK 2WB1L 4JK1A 4LK1A 2A69A 3A8KA 1O27A 3S2HK 5C4XK 4A93C 1K83K 1WORA 2GAGC 4FZBA 4A3IC 3GTMA 1ZBSA 3S1QC 3HKZL 4Y7NK 3HOXK 4G7ZA 1VRQC 2D6FC 2VUMA 1GE9A 1WQFA 4C3HC 1TWFK 3RZDK 3S17K 3LPXA 3HOXC 1WOOA 3GTKA 3S1QK 5C3EK 2E2HK 1I3QK 5JFEA 3RZOK 3H3VL 2R7ZC 1TWHK 1VLOA 2Y0SD 3S1NC 4A3BK 1EQRA 3GDZA 2PPBA 4G0UA 5M5YK 2FQTA 1WCMA 5M3MK 3S2DC 2B63A 2V6UA 3S2DK 3OEPA 2NVTK 4BXXK 1L0WA 2ZUFA 4A3EC 1F7VA 1I50K 2JA6K 2NVXA 2YU9A 4A3KK 4YFKA 4LLGA 3S14K 3GTLK 3L4JA 5C4JK 1YCLA 3S1MK 4LQYA 3ERED 3HOYC
chains in the Genus database with same CATH topology
4OIOA 4A3LK 1TWCK 2R93C 4OIPA 3M3YK 1TWAK 5IYCC 4A3LC 3HOZK 3HOWK 4KMUA 1Y1WC 2WB1D 4MEYA 4OINA 1SFOK 2B63C 2A68A 3FKIC 5C44C 5IP9K 4C3IK 2YU9C 2NVQC 3GTPC 1YNJA 5FLMC 2PA8D 3GTJK 3S1RC 2R92C 3EQLA 5C4XC 4Q4ZA 4A3EK 3GTOC 3GTQK 3S15K 3K7AK 3S16K 2R92K 5M5XK 3GTJC 4BY1K 3I4NK 4A3DC 3GTPK 4BBSK 4G7OA 4C2MK 4Y52K 3CQZK 5IP9C 1R9TK 1TWHC 2NVYK 3H0GK 4XSXA 4QJVB 2JA5C 3RZOC 4BBSC 3I4MC 4ZH4A 3I4NC 5M5WK 3GTKC 3GTOK 3K7AC 1Y1VK 2E2JC 2JA8C 2PMZD 1TWAC 2WAQD 4YFXA 5D4DA 4NOIA 4A3FC 4C3JK 5FLMK 2NVQK 4OIQA 4AYBD 3GTMC 4XSZA 4A3JK 3HOVK 2PA8L 5IP7K 2JA7K 2O5JA 2BE5A 4Y52C 3PO3C 4QJVA 4OIRA 4BBRK 2WB1L 4JK1A 4LK1A 2A69A 5IYBC 1I6VA 3S2HK 5C4XK 4A93C 3M3YC 4Y7NC 1K83K 3HOUC 4X6AK 5IP7C 1Y1WK 4A3IC 2JA7C 1ZYRA 3S1QC 3HKZL 1WCMC 2E2IC 4Y7NK 4A3FK 3S1MC 3HOXK 4G7ZA 5FJ8K 2JA6C 3S17K 1TWFK 3RZDK 3S2HC 4A93K 3HOXC 4A3MK 4BBRC 3GTLC 1IW7A 3S1QK 3I4MK 5C3EK 4MEXA 1I3QK 2E2HK 4BY7K 3RZOK 3HOUK 3H3VL 4A3JC 1YNNA 2R7ZC 1K83C 1TWHK 2NVYC 3H0GC 3GTMK 5TMFA 2NVXC 2Y0SD 1I6HC 3WODA 3DXJA 3PO2C 3S1NC 2VUMK 3M4OK 1I50C 4A3BK 4A3GC 1Y1VC 2Y0SL 4LJZA 2E2JK 2JA8K 2PPBA 3GTGC 2VUMC 5M5YK 3GTKK 3M4OC 5IYDK 4QIWD 3PO3K 1I6HK 5M3MK 2YU9K 3S2DC 4A3CC 4LK0A 1R9TC 2JA5K 4A3KC 3HOYC 4KN7A 3S2DK 4A3CK 2NVTK 5C3EC 5IYDC 2E2HC 4BXXK 1XPPA 4MQ9A 4AYBL 3GTGK 4A3EC 3HOZC 3S16C 4XLPA 3GTQC 3HKZD 1TWFC 3RZDC 1BDFA 1I50K 4Q5SA 2JA6K 2WAQL 3PO2K 3S1RK 3S1NK 2NVTC 4BXXC 1WCMK 5C44K 2E2IK 4A3KK 2A6HA 2B63K 1HQMA 1SMYA 3CQZC 4YFKA 1I3QC 4BY1C 4BY7C 3HOWC 4A3DK 4LLGA 5TMCA 5M3FK 4A3MC 3GTLK 3H3VD 5IYCK 5C4JK 4YFNA 3S14K 3S15C 2A6EA 4A3BC 4A3GK 2O5IA 5IYBK 1TWCC 4C3HK 4YG2A 3S17C 3S1MK 5C4JC 1TWGK 2R93K 3S14C 2NVXK 3HOYK 4KN4A 3FKIK 4XLNA 2R7ZK 4X6AC 1SFOC 4A3IK 4QIWL 4G7HA 3HOVC 2CW0A 2PMZL 1TWGC 4GZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO A;  4A3L K;  1TWC K;  2R93 C;  4OIP A;  3M3Y K;  1TWA K;  5IYC C;  4A3L C;  3HOZ K;  3HOW K;  4KMU A;  1Y1W C;  2WB1 D;  4MEY A;  4OIN A;  1SFO K;  2B63 C;  2A68 A;  3FKI C;  5C44 C;  5IP9 K;  4C3I K;  2YU9 C;  2NVQ C;  3GTP C;  1YNJ A;  5FLM C;  2PA8 D;  3GTJ K;  3S1R C;  2R92 C;  3EQL A;  5C4X C;  4Q4Z A;  4A3E K;  3GTO C;  3GTQ K;  3S15 K;  3K7A K;  3S16 K;  2R92 K;  5M5X K;  3GTJ C;  4BY1 K;  3I4N K;  4A3D C;  3GTP K;  4BBS K;  4G7O A;  4C2M K;  4Y52 K;  3CQZ K;  5IP9 C;  1R9T K;  1TWH C;  2NVY K;  3H0G K;  4XSX A;  4QJV B;  2JA5 C;  3RZO C;  4BBS C;  3I4M C;  4ZH4 A;  3I4N C;  5M5W K;  3GTK C;  3GTO K;  3K7A C;  1Y1V K;  2E2J C;  2JA8 C;  2PMZ D;  1TWA C;  2WAQ D;  4YFX A;  5D4D A;  4NOI A;  4A3F C;  4C3J K;  5FLM K;  2NVQ K;  4OIQ A;  4AYB D;  3GTM C;  4XSZ A;  4A3J K;  3HOV K;  2PA8 L;  5IP7 K;  2JA7 K;  2O5J A;  2BE5 A;  4Y52 C;  3PO3 C;  4QJV A;  4OIR A;  4BBR K;  2WB1 L;  4JK1 A;  4LK1 A;  2A69 A;  5IYB C;  1I6V A;  3S2H K;  5C4X K;  4A93 C;  3M3Y C;  4Y7N C;  1K83 K;  3HOU C;  4X6A K;  5IP7 C;  1Y1W K;  4A3I C;  2JA7 C;  1ZYR A;  3S1Q C;  3HKZ L;  1WCM C;  2E2I C;  4Y7N K;  4A3F K;  3S1M C;  3HOX K;  4G7Z A;  5FJ8 K;  2JA6 C;  3S17 K;  1TWF K;  3RZD K;  3S2H C;  4A93 K;  3HOX C;  4A3M K;  4BBR C;  3GTL C;  1IW7 A;  3S1Q K;  3I4M K;  5C3E K;  4MEX A;  1I3Q K;  2E2H K;  4BY7 K;  3RZO K;  3HOU K;  3H3V L;  4A3J C;  1YNN A;  2R7Z C;  1K83 C;  1TWH K;  2NVY C;  3H0G C;  3GTM K;  5TMF A;  2NVX C;  2Y0S D;  1I6H C;  3WOD A;  3DXJ A;  3PO2 C;  3S1N C;  2VUM K;  3M4O K;  1I50 C;  4A3B K;  4A3G C;  1Y1V C;  2Y0S L;  4LJZ A;  2E2J K;  2JA8 K;  2PPB A;  3GTG C;  2VUM C;  5M5Y K;  3GTK K;  3M4O C;  5IYD K;  4QIW D;  3PO3 K;  1I6H K;  5M3M K;  2YU9 K;  3S2D C;  4A3C C;  4LK0 A;  1R9T C;  2JA5 K;  4A3K C;  3HOY C;  4KN7 A;  3S2D K;  4A3C K;  2NVT K;  5C3E C;  5IYD C;  2E2H C;  4BXX K;  1XPP A;  4MQ9 A;  4AYB L;  3GTG K;  4A3E C;  3HOZ C;  3S16 C;  4XLP A;  3GTQ C;  3HKZ D;  1TWF C;  3RZD C;  1BDF A;  1I50 K;  4Q5S A;  2JA6 K;  2WAQ L;  3PO2 K;  3S1R K;  3S1N K;  2NVT C;  4BXX C;  1WCM K;  5C44 K;  2E2I K;  4A3K K;  2A6H A;  2B63 K;  1HQM A;  1SMY A;  3CQZ C;  4YFK A;  1I3Q C;  4BY1 C;  4BY7 C;  3HOW C;  4A3D K;  4LLG A;  5TMC A;  5M3F K;  4A3M C;  3GTL K;  3H3V D;  5IYC K;  5C4J K;  4YFN A;  3S14 K;  3S15 C;  2A6E A;  4A3B C;  4A3G K;  2O5I A;  5IYB K;  1TWC C;  4C3H K;  4YG2 A;  3S17 C;  3S1M K;  5C4J C;  1TWG K;  2R93 K;  3S14 C;  2NVX K;  3HOY K;  4KN4 A;  3FKI K;  4XLN A;  2R7Z K;  4X6A C;  1SFO C;  4A3I K;  4QIW L;  4G7H A;  3HOV C;  2CW0 A;  2PMZ L;  1TWG C;  4GZY A; 
#chains in the Genus database with same CATH topology
 4OIO A;  1EI6 A;  1TWC K;  2R93 C;  1TWA K;  2W7V A;  2R93 A;  1XZP B;  4MEY A;  2GAH C;  5C44 C;  5IP9 K;  3A8J A;  2YU9 C;  3GTP C;  2PA8 D;  3N0C A;  2R92 C;  4KMD A;  4PAB A;  3N0B A;  2R92 K;  1B4B A;  4KAR A;  3GTP K;  4G7O A;  2NVY K;  4QJV B;  2JA7 A;  4C3J C;  3I4M C;  4ZH4 A;  3QX3 A;  3K7A C;  1Y1V K;  1AB4 A;  4FM9 A;  3GTQ A;  2ZUE A;  4GTA A;  4C3J K;  1PJ5 A;  3CQZ A;  4A3J K;  5HL8 A;  3OPF A;  2BE5 A;  3AD9 C;  3PO3 C;  4QJV A;  4OIR A;  2PHC B;  5CJ9 A;  4BLB A;  4WIL A;  1UV7 A;  4XCH A;  1I6V A;  1HI9 A;  2V6S A;  1ZQ1 C;  4Y7N C;  1IS1 A;  4P9S A;  1F7U A;  2XCO A;  2GSO A;  1PJ6 A;  4DDQ A;  5FJ8 K;  2JA6 C;  3S0X A;  4PAA A;  4A3M K;  3GTL C;  4MEX A;  2GSU A;  4KAT A;  2RH6 A;  2NVY C;  1XZQ B;  3GTG A;  2VUM K;  3M4O K;  1J6X A;  1ZVU A;  4A3G C;  2Y0S L;  2E2J K;  3GTG C;  3GTK K;  5IYD K;  4QIW D;  2ZFZ A;  1I3Q A;  4A3C C;  4KDD A;  1DCP A;  2JA5 K;  1TWH A;  4KN7 A;  1WIH A;  1XXB A;  3TFI A;  3GEE A;  4XLP A;  3HKZ D;  1TWF C;  3RZD C;  1BDF A;  1BJT A;  1TWG A;  3PO2 K;  3S1R K;  2E2I K;  5C44 K;  4LR2 A;  5CHP A;  4BY7 C;  4KAS A;  4GTF A;  5TMC A;  5M3F K;  3LAP A;  4A3B C;  4YG2 A;  4P5B A;  5C4J C;  4KN4 A;  3FKI K;  4XLN A;  2R7Z K;  4X6A C;  1WOP A;  2PMZ L;  5JVO A;  4GZY A;  4A3L K;  4OIP A;  3M3Y K;  3GEI A;  3HOZ K;  1Y1W C;  3H0G A;  1SFO K;  4RMF A;  5IOR A;  2NVQ C;  5FLM C;  3GTJ K;  3GTO A;  5C4X C;  4G0W A;  3CAG A;  1WSV A;  3GTO C;  4KB4 A;  3ORE A;  4BY1 K;  4A3D C;  4Y52 K;  4C2M K;  1R9T K;  3TFH A;  1J98 A;  4GTE A;  3I4N C;  1EH1 A;  4GTL A;  1DCH A;  4A3F C;  2Y3P A;  5FLM K;  1BS2 A;  3GTP A;  3GTM C;  4XSZ A;  2GSN A;  1O26 A;  2PA8 L;  2CFA B;  5IP7 K;  2JA7 K;  1G51 A;  1PJ7 A;  1O29 A;  2JH3 A;  1Y1V A;  1TWF A;  5IYB C;  3M3Y C;  1ZXO A;  3HOU C;  1J6V A;  5IP7 C;  1Y1W K;  1O2F B;  2JA7 C;  1ZYR A;  2E2I C;  2FQO A;  4A3F K;  3S1M C;  3AD7 C;  3N3Y A;  5E68 A;  1VJE A;  4BKW A;  1K83 A;  4BY7 K;  3HOU K;  1K83 C;  3BUE A;  3GTM K;  5TMF A;  1C0A A;  3WOD A;  3PO2 C;  3BP3 A;  4LJZ A;  1DD5 A;  2JA8 K;  2P8T A;  2VUM C;  3M4O C;  3T01 A;  1I6H K;  3L4K A;  5TJ3 A;  1R9T C;  4A3C K;  4WJ3 M;  3VA7 A;  3GTL A;  4MQ9 A;  3HOZ C;  1YX2 A;  4Q5S A;  3T00 A;  2WAQ L;  3ADA C;  1WCM K;  1VGX A;  4C3I C;  1ISE A;  2B63 K;  1HQM A;  2RGR A;  3CQZ C;  1RU0 A;  4BY1 C;  4A3D K;  3HOW C;  2KWA A;  3H3V D;  4O2D A;  5IYC K;  4YFN A;  2P5M A;  2A6E A;  1VH2 A;  4A3G K;  2R93 K;  3BP8 C;  2NVX K;  3HOY K;  1XXA A;  3LAJ A;  4KM8 A;  1JQW A;  1SFO C;  4G7H A;  2EBB A;  1TWG C;  1EK8 A;  1EFW A;  1F93 A;  4GTC A;  4A3L C;  3FKI A;  3TFJ A;  2R7Z A;  1O2A A;  2WB1 D;  4OIN A;  3HXA A;  1V5V A;  3FKI C;  4C3I K;  3GIR A;  1YNJ A;  1XZQ A;  3EQL A;  4KB2 A;  4C45 A;  3S16 K;  3S15 K;  3K7A K;  3T02 A;  5M5X K;  5IP9 C;  3H0G K;  4XSX A;  3V4G A;  4KC6 A;  1INN A;  1XZP A;  4BBS C;  3GTJ A;  5M5W K;  3GTO K;  2E2J C;  2JA8 C;  2PMZ D;  1O28 A;  1TWA C;  5D4D A;  2R92 A;  4NOI A;  2NVQ K;  2CFA A;  4OIQ A;  1B4A A;  1R9T A;  4KMH A;  1J6W A;  5IOS A;  1USM A;  2E2H A;  4X6A K;  1JOE A;  3Q3Q A;  4GTD A;  1WCM C;  1IE0 A;  4WJ4 A;  3G4A A;  2V6T A;  4GFQ A;  3S2H C;  4A93 K;  3FOF A;  1IQ0 A;  4BBR C;  1IW7 A;  3MML B;  3I4M K;  4P5A A;  1BGW A;  4A3J C;  1YNN A;  1Y1W A;  4AH6 A;  1WQG A;  3H0G C;  3TTG A;  2JA5 A;  2NVX C;  1I6H C;  3DXJ A;  1I50 C;  1Y1V C;  3JST A;  4ILD A;  1I50 A;  2JA6 A;  1O25 A;  1X31 C;  5IOQ A;  3PO3 K;  2XCQ A;  2E2I A;  2YU9 K;  4LK0 A;  4A3K C;  5C3E C;  5IYD C;  2E2H C;  1XPP A;  1IL2 A;  4BLA A;  4AYB L;  3GTG K;  3S16 C;  3GTQ C;  3A8I A;  1O24 A;  3AQO A;  3S1N K;  4LOW A;  2NVT C;  4BXX C;  4GTB A;  2A6H A;  1SMY A;  1JVI A;  3AD8 C;  1I3Q C;  3IPJ A;  4A3M C;  5EGE A;  1F9N A;  1TWC A;  3S15 C;  1TWA A;  3FHZ A;  5L46 A;  5IYB K;  1TWC C;  4C3H K;  2O5I A;  3S17 C;  1TWG K;  4KM9 A;  3S14 C;  5IOT A;  3FOE A;  4A3I K;  4QIW L;  3HOV C;  2CW0 A;  4J3N A;  3AQP A;  3GEH A;  5IYC C;  2XCR B;  4KAW X;  4M1X A;  3HOW K;  4KMU A;  2NVY A;  2B63 C;  2A68 A;  1WQH A;  3G4C A;  3S1R C;  1WSR A;  4KMA A;  5EGH A;  3SZY A;  4Q4Z A;  4A3E K;  3GTQ K;  1WOS A;  4GT9 A;  3GTJ C;  3NUH A;  3I4N K;  4BBS K;  3SZZ A;  3CQZ K;  1TWH C;  2JA5 C;  1SFO A;  3RZO C;  3GSI A;  3GTK C;  1KQ4 A;  1DCO A;  1USO A;  4G0V A;  1IBA A;  2WAQ D;  4YFX A;  1O2B A;  4AYB D;  3HOV K;  2O5J A;  3AH5 A;  4C2M C;  4Y52 C;  1XXC A;  4BBR K;  2WB1 L;  4JK1 A;  4LK1 A;  2A69 A;  3A8K A;  1O27 A;  3S2H K;  5C4X K;  4A93 C;  1K83 K;  1WOR A;  2GAG C;  4FZB A;  4A3I C;  3GTM A;  1ZBS A;  3S1Q C;  3HKZ L;  4Y7N K;  3HOX K;  4G7Z A;  1VRQ C;  2D6F C;  2VUM A;  1GE9 A;  1WQF A;  4C3H C;  1TWF K;  3RZD K;  3S17 K;  3LPX A;  3HOX C;  1WOO A;  3GTK A;  3S1Q K;  5C3E K;  2E2H K;  1I3Q K;  5JFE A;  3RZO K;  3H3V L;  2R7Z C;  1TWH K;  1VLO A;  2Y0S D;  3S1N C;  4A3B K;  1EQR A;  3GDZ A;  2PPB A;  4G0U A;  5M5Y K;  2FQT A;  1WCM A;  5M3M K;  3S2D C;  2B63 A;  2V6U A;  3S2D K;  3OEP A;  2NVT K;  4BXX K;  1L0W A;  2ZUF A;  4A3E C;  1F7V A;  1I50 K;  2JA6 K;  2NVX A;  2YU9 A;  4A3K K;  4YFK A;  4LLG A;  3S14 K;  3GTL K;  3L4J A;  5C4J K;  1YCL A;  3S1M K;  4LQY A;  3ERE D;  3HOY C; 
#chains in the Genus database with same CATH homology
 4OIO A;  4A3L K;  1TWC K;  2R93 C;  4OIP A;  3M3Y K;  1TWA K;  5IYC C;  4A3L C;  3HOZ K;  3HOW K;  4KMU A;  1Y1W C;  2WB1 D;  4MEY A;  4OIN A;  1SFO K;  2B63 C;  2A68 A;  3FKI C;  5C44 C;  5IP9 K;  4C3I K;  2YU9 C;  2NVQ C;  3GTP C;  1YNJ A;  5FLM C;  2PA8 D;  3GTJ K;  3S1R C;  2R92 C;  3EQL A;  5C4X C;  4Q4Z A;  4A3E K;  3GTO C;  3GTQ K;  3S15 K;  3K7A K;  3S16 K;  2R92 K;  5M5X K;  3GTJ C;  4BY1 K;  3I4N K;  4A3D C;  3GTP K;  4BBS K;  4G7O A;  4C2M K;  4Y52 K;  3CQZ K;  5IP9 C;  1R9T K;  1TWH C;  2NVY K;  3H0G K;  4XSX A;  4QJV B;  2JA5 C;  3RZO C;  4BBS C;  3I4M C;  4ZH4 A;  3I4N C;  5M5W K;  3GTK C;  3GTO K;  3K7A C;  1Y1V K;  2E2J C;  2JA8 C;  2PMZ D;  1TWA C;  2WAQ D;  4YFX A;  5D4D A;  4NOI A;  4A3F C;  4C3J K;  5FLM K;  2NVQ K;  4OIQ A;  4AYB D;  3GTM C;  4XSZ A;  4A3J K;  3HOV K;  2PA8 L;  5IP7 K;  2JA7 K;  2O5J A;  2BE5 A;  4Y52 C;  3PO3 C;  4QJV A;  4OIR A;  4BBR K;  2WB1 L;  4JK1 A;  4LK1 A;  2A69 A;  5IYB C;  1I6V A;  3S2H K;  5C4X K;  4A93 C;  3M3Y C;  4Y7N C;  1K83 K;  3HOU C;  4X6A K;  5IP7 C;  1Y1W K;  4A3I C;  2JA7 C;  1ZYR A;  3S1Q C;  3HKZ L;  1WCM C;  2E2I C;  4Y7N K;  4A3F K;  3S1M C;  3HOX K;  4G7Z A;  5FJ8 K;  2JA6 C;  3S17 K;  1TWF K;  3RZD K;  3S2H C;  4A93 K;  3HOX C;  4A3M K;  4BBR C;  3GTL C;  1IW7 A;  3S1Q K;  3I4M K;  5C3E K;  4MEX A;  1I3Q K;  2E2H K;  4BY7 K;  3RZO K;  3HOU K;  3H3V L;  4A3J C;  1YNN A;  2R7Z C;  1K83 C;  1TWH K;  2NVY C;  3H0G C;  3GTM K;  5TMF A;  2NVX C;  2Y0S D;  1I6H C;  3WOD A;  3DXJ A;  3PO2 C;  3S1N C;  2VUM K;  3M4O K;  1I50 C;  4A3B K;  4A3G C;  1Y1V C;  2Y0S L;  4LJZ A;  2E2J K;  2JA8 K;  2PPB A;  3GTG C;  2VUM C;  5M5Y K;  3GTK K;  3M4O C;  5IYD K;  4QIW D;  3PO3 K;  1I6H K;  5M3M K;  2YU9 K;  3S2D C;  4A3C C;  4LK0 A;  1R9T C;  2JA5 K;  4A3K C;  3HOY C;  4KN7 A;  3S2D K;  4A3C K;  2NVT K;  5C3E C;  5IYD C;  2E2H C;  4BXX K;  1XPP A;  4MQ9 A;  4AYB L;  3GTG K;  4A3E C;  3HOZ C;  3S16 C;  4XLP A;  3GTQ C;  3HKZ D;  1TWF C;  3RZD C;  1BDF A;  1I50 K;  4Q5S A;  2JA6 K;  2WAQ L;  3PO2 K;  3S1R K;  3S1N K;  2NVT C;  4BXX C;  1WCM K;  5C44 K;  2E2I K;  4A3K K;  2A6H A;  2B63 K;  1HQM A;  1SMY A;  3CQZ C;  4YFK A;  1I3Q C;  4BY1 C;  4BY7 C;  3HOW C;  4A3D K;  4LLG A;  5TMC A;  5M3F K;  4A3M C;  3GTL K;  3H3V D;  5IYC K;  5C4J K;  4YFN A;  3S14 K;  3S15 C;  2A6E A;  4A3B C;  4A3G K;  2O5I A;  5IYB K;  1TWC C;  4C3H K;  4YG2 A;  3S17 C;  3S1M K;  5C4J C;  1TWG K;  2R93 K;  3S14 C;  2NVX K;  3HOY K;  4KN4 A;  3FKI K;  4XLN A;  2R7Z K;  4X6A C;  1SFO C;  4A3I K;  4QIW L;  4G7H A;  3HOV C;  2CW0 A;  2PMZ L;  1TWG C;  4GZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...