5C3EK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c3eK00
1YNJA 2A6HA 5IYCC 4Y7NK 2PMZD 2YU9C 3HOWK 4BXXK 2R93K 1TWHK 3M4OK 5TMCA 4A93C 3GTPC 5IP9C 2A68A 5C4XC 5M5WK 5M3FK 4BBSC 4BBRC 3S2HK 3HOVC 1TWAK 3K7AK 5M3MK 4A3MK 2E2IC 3S17K 5C3EC 5IYDK 2PA8D 4LK0A 4A3EC 5IP7K 4Y52K 3EQLA 5IYBC 4A3FC 5IYCK 5M5YK 4ZH4A 5TMFA 3HOZK 1I50C 2YU9K 3GTQC 1I6HC 2BE5A 4LLGA 2WB1D 3GTPK 1Y1WC 1K83K 4A3BK 4KN4A 5C4XK 3I4MC 1YNNA 4C2MK 3RZDC 2A69A 4BY7C 5C44C 2B63K 2NVQK 3H3VD 4A3KC 5C3EK 4KMUA 2R7ZC 5FLMC 3S2DK 4A3JC 4A3GC 4G7HA 3PO3C 3HKZL 3FKIK 2NVXC 2JA8C 4LK1A 4XLNA 3GTKC 4OINA 4BY7K 2A6EA 3H0GC 2NVYC 3S1RC 2CW0A 1R9TC 3S1NK 5C4JK 2VUMK 5FLMK 4Q4ZA 2JA7K 3CQZC 5M5XK 2JA5C 1TWFK 2R92C 2R7ZK 4MQ9A 3GTOK 4Q5SA 1SFOC 3HOUC 4JK1A 4QJVB 1XPPA 4QIWL 3HOXC 4YG2A 4C3IK 2O5IA 4A93K 5IP9K 4BBSK 4X6AC 1ZYRA 4AYBD 2Y0SL 4BBRK 4C3JK 3HOVK 1TWFC 2E2IK 3S15C 3S1QC 1TWCC 2E2JC 2E2HC 2PMZL 2WAQD 3CQZK 4BY1C 4A3EK 3HOYC 1TWGC 4YFNA 5IYBK 4A3FK 1I6HK 1I50K 3GTJC 3GTQK 3I4NC 3GTLC 3S1MC 5D4DA 1Y1WK 1WCMC 3RZOC 2PA8L 4GZYA 3I4MK 1BDFA 2JA6C 4A3CC 3RZDK 5C44K 1I3QC 3GTGC 3M3YC 4A3KK 3GTMC 3S14C 4A3IC 4QJVA 2WB1L 4Y7NC 3PO2C 4BXXC 1Y1VC 3HOWC 4A3JK 4A3GK 2R93C 3M4OC 2PPBA 3PO3K 3H3VL 3S1MK 2NVXK 2JA8K 3S17C 1TWAC 3K7AC 4A3MC 3RZOK 4OIOA 5FJ8K 3GTKK 4A3DC 3S16C 3H0GK 4LJZA 2NVYK 5IYDC 3S1RK 4A3LC 4Y52C 5IP7C 3S14K 4XSXA 1R9TK 3HOZC 3PO2K 1Y1VK 3DXJA 2R92K 2JA5K 1HQMA 1K83C 4A3BC 1SFOK 3HOUK 4NOIA 4C3HK 3HOXK 4YFXA 4MEXA 2B63C 2NVQC 3HKZD 4A3DK 4X6AK 3S16K 4A3LK 4MEYA 3S15K 3S1QK 3S2DC 1TWCK 2E2JK 2E2HK 2NVTC 4KN7A 4XSZA 4BY1K 3HOYK 1TWGK 3FKIC 1TWHC 4OIRA 4AYBL 1I6VA 3GTJK 3I4NK 3GTLK 2O5JA 4G7ZA 3S2HC 2WAQL 1WCMK 4XLPA 4QIWD 1IW7A 3GTMK 3WODA 2JA6K 4A3CK 3S1NC 5C4JC 4OIPA 2VUMC 4G7OA 1I3QK 4OIQA 4YFKA 2NVTK 2JA7C 2Y0SD 3GTGK 3M3YK 3GTOC 1SMYA 4A3IK
chains in the Genus database with same CATH superfamily
1YNJA 4O2DA 2PMZD 1TWHK 1EH1A 3GEIA 5TMCA 3M4OK 2A68A 1ZVUA 5M5WK 1WSRA 1PJ7A 2YU9A 4C3JC 4LQYA 1XXBA 5M3MK 5C3EC 1VRQC 5IYBC 5M5YK 4ZH4A 3GTQC 4LLGA 1F93A 1K83K 4A3BK 3QX3A 2A69A 2B63K 3TFIA 2NVQK 3H3VD 5C3EK 1XXCA 3S2DK 3GSIA 3ADAC 1USOA 1J6WA 4P5AA 3HKZL 2JA7A 3AQPA 3GTOA 1DCOA 1USMA 5JVOA 4ILDA 4FM9A 5L46A 3S1NK 2VUMK 1BGWA 5IOQA 4BKWA 4Q5SA 2D6FC 4A93K 5IP9K 2KWAA 1ZYRA 3GTQA 4KATA 3HOVK 3S1QC 3MMLB 4G0WA 1IBAA 1TWCC 2E2JC 2P8TA 3SZZA 1TWGC 3GEHA 4A3FK 4KC6A 3BUEA 1WQFA 3N3YA 1Y1WK 3S1MC 2PA8L 3HXAA 4A3CC 3RZDK 1JOEA 3M3YC 3GTGC 4A3KK 3T00A 4QJVA 3S0XA 4LR2A 2R93C 4A3JK 1Y1VA 3S1MK 2NVXK 1TWAC 3K7AC 4OIOA 1YX2A 3DXJA 3AH5A 1TWCA 1SFOK 4GTBA 4C3HK 1O27A 3AD9C 3HOXK 1TWGA 3HKZD 4BLBA 5CHPA 2E2HK 3GDZA 1UV7A 4XSZA 4BY1K 3HOYK 4PAAA 3GTGA 4OIRA 3GTJK 2R93A 2WAQL 1WCMK 4XLPA 1IW7A 4G7OA 4AH6A 4OIQA 1TWAA 3GTMK 1TWFC 5IYCC 4Y7NK 2YU9C 4BXXK 3HOWK 1X31C 1O2AA 2V6SA 5C4XC 4GTCA 4BBSC 4BBRC 2E2IC 3GTPA 5IYDK 2PA8D 4A3EC 1RU0A 5IP7K 5IYCK 1I6HC 1I50C 2YU9K 2BE5A 2JH3A 5C4XK 4P5BA 3OREA 5C44C 1WQGA 4KMUA 5FLMC 3LPXA 4A3GC 1WOOA 4G7HA 1XZPB 3FKIK 1TWFA 4XLNA 3VA7A 3H0GC 3S1RC 2CW0A 1R9TC 5FLMK 4Q4ZA 2JA7K 5M5XK 2R92C 2E2IA 4MQ9A 3GTOK 1PJ5A 1XPPA 3CQZA 2O5IA 1VH2A 3TFJA 2XCOA 1I50A 4C3JK 3S15C 4KARA 2WAQD 4KM9A 3N0BA 2PHCB 3AD8C 4GT9A 5IYBK 3GTQK 1L0WA 3T02A 2ZUEA 1EFWA 1BDFA 4KM8A 1B4AA 1DCPA 3H0GA 1Y1VC 3T01A 5E68A 2CFAB 1R9TA 2FQTA 3S17C 2R92A 4A3MC 3N0CA 3S16C 2RH6A 4GTLA 1O25A 3CAGA 4Y52C 4KDDA 1C0AA 3HOZC 1Y1VK 4BLAA 1HQMA 2XCQA 1IE0A 4YFXA 1J6VA 3AD7C 2V6TA 3S16K 4PABA 3S1QK 1TWCK 2E2JK 4KN7A 1EK8A 1TWGK 1VJEA 4AYBL 1I6VA 3A8IA 3L4KA 1IL2A 2O5JA 4G7ZA 2GSUA 3S2HC 3WODA 4KASA 4A3CK 5C4JC 4WJ3M 1ZXOA 3M3YK 1DD5A 3GTGK 2R7ZC 4GFQA 2R93K 3LAJA 1F9NA 4C3IC 3GTPC 5M3FK 4LOWA 4C2MC 3S2HK 1TWAK 3K7AK 5EGHA 3NUHA 5IORA 3EQLA 1JQWA 1ZBSA 4XCHA 3LAPA 3GTPK 4KN4A 1AB4A 3I4MC 1YNNA 4C2MK 4BY7C 4GTEA 2RGRA 2XCRB 1WIHA 3SZYA 3PO3C 4C45A 1F7UA 2JA8C 2R7ZA 1XZQA 1O24A 4OINA 3GTKC 2A6EA 4BY7K 2NVYC 2FQOA 1EQRA 1WQHA 4GTDA 4G0VA 3CQZC 2JA5C 3AQOA 1TWFK 1WOPA 3HOUC 4QIWL 4YG2A 4BBSK 4X6AC 4AYBD 4BBRK 4J3NA 2E2IK 1ISEA 5IOTA 1O2BA 3CQZK 4A3EK 3V4GA 1I6HK 1I50K 3I4NC 3GTLC 5CJ9A 5D4DA 3TFHA 4GZYA 2JA6C 1IQ0A 5C44K 1I3QC 3S14C 4A3IC 3GTKA 2WB1L 3OEPA 2NVYA 4A3GK 2GAHC 3M4OC 3G4CA 2JA5A 5FJ8K 3A8KA 4A3DC 3H0GK 3Q3QA 3S1RK 4KB4A 4A3LC 1BS2A 3S14K 4XSXA 1R9TK 1WSVA 3BP8C 2R92K 4GTFA 1K83C 4A3BC 2Y3PA 4MEXA 2B63C 2ZFZA 2NVQC 2P5MA 4A3DK 4A3LK 4MEYA 3S15K 3GTLA 2CFAA 1J6XA 3G4AA 1F7VA 3S2DC 4FZBA 2JA6A 1VLOA 3OPFA 1I3QA 1HI9A 3FHZA 3FKIA 3FOFA 1TWHA 4QIWD 3GIRA 3S1NC 2VUMC 1JVIA 1O2FB 4YFKA 2V6UA 2A6HA 2W7VA 4A93C 4KB2A 5IP9C 3JSTA 4WILA 3HOVC 3S17K 4A3MK 1K83A 3TTGA 4LK0A 4Y52K 2B63A 1O29A 4A3FC 3ERED 5TMFA 3HOZK 2GSOA 2WB1D 4KAWX 1Y1WC 4G0UA 3RZDC 4A3KC 4A3JC 4M1XA 3GEEA 3IPJA 2VUMA 1XXAA 2NVXC 1EI6A 4LK1A 1WOSA 5TJ3A 1V5VA 4WJ4A 1GE9A 5C4JK 2GSNA 2R7ZK 1SFOC 4JK1A 4QJVB 4C3HC 3HOXC 4C3IK 2EBBA 3L4JA 2Y0SL 2GAGC 1IS1A 1Y1WA 2E2HC 2PMZL 4RMFA 1PJ6A 4BY1C 3HOYC 4YFNA 3GTJC 4KMAA 4DDQA 1WCMC 3RZOC 3I4MK 3A8JA 2NVXA 1YCLA 3GTMC 5EGEA 1B4BA 4Y7NC 3PO2C 5IOSA 3HOWC 4BXXC 1INNA 2PPBA 3PO3K 3H3VL 2JA8K 2ZUFA 3RZOK 3GTKK 1SFOA 4LJZA 5IYDC 2NVYK 5IP7C 1XZPA 3PO2K 1BJTA 2JA5K 4P9SA 1O26A 2E2HA 1G51A 1O28A 1DCHA 3HOUK 4NOIA 1J98A 1ZQ1C 5JFEA 4KMHA 3FOEA 1VGXA 4X6AK 4GTAA 3GTJA 1XZQB 1WCMA 2NVTC 5HL8A 3FKIC 1TWHC 3GTMA 3I4NK 3GTLK 3BP3A 1WORA 4KMDA 2JA6K 1KQ4A 4OIPA 1I3QK 2JA7C 2NVTK 2Y0SD 3GTOC 1SMYA 4A3IK
chains in the Genus database with same CATH topology
1YNJA 2A6HA 5IYCC 4Y7NK 2PMZD 2YU9C 3HOWK 4BXXK 2R93K 1TWHK 3M4OK 5TMCA 4A93C 3GTPC 5IP9C 2A68A 5C4XC 5M5WK 5M3FK 4BBSC 4BBRC 3S2HK 3HOVC 1TWAK 3K7AK 5M3MK 4A3MK 2E2IC 3S17K 5C3EC 5IYDK 2PA8D 4LK0A 4A3EC 5IP7K 4Y52K 3EQLA 5IYBC 4A3FC 5IYCK 5M5YK 4ZH4A 5TMFA 3HOZK 1I50C 2YU9K 3GTQC 1I6HC 2BE5A 4LLGA 2WB1D 3GTPK 1Y1WC 1K83K 4A3BK 4KN4A 5C4XK 3I4MC 1YNNA 4C2MK 3RZDC 2A69A 4BY7C 5C44C 2B63K 2NVQK 3H3VD 4A3KC 5C3EK 4KMUA 2R7ZC 5FLMC 3S2DK 4A3JC 4A3GC 4G7HA 3PO3C 3HKZL 3FKIK 2NVXC 2JA8C 4LK1A 4XLNA 3GTKC 4OINA 4BY7K 2A6EA 3H0GC 2NVYC 3S1RC 2CW0A 1R9TC 3S1NK 5C4JK 2VUMK 5FLMK 4Q4ZA 2JA7K 3CQZC 5M5XK 2JA5C 1TWFK 2R92C 2R7ZK 4MQ9A 3GTOK 4Q5SA 1SFOC 3HOUC 4JK1A 4QJVB 1XPPA 4QIWL 3HOXC 4YG2A 4C3IK 2O5IA 4A93K 5IP9K 4BBSK 4X6AC 1ZYRA 4AYBD 2Y0SL 4BBRK 4C3JK 3HOVK 1TWFC 2E2IK 3S15C 3S1QC 1TWCC 2E2JC 2E2HC 2PMZL 2WAQD 3CQZK 4BY1C 4A3EK 3HOYC 1TWGC 4YFNA 5IYBK 4A3FK 1I6HK 1I50K 3GTJC 3GTQK 3I4NC 3GTLC 3S1MC 5D4DA 1Y1WK 1WCMC 3RZOC 2PA8L 4GZYA 3I4MK 1BDFA 2JA6C 4A3CC 3RZDK 5C44K 1I3QC 3GTGC 3M3YC 4A3KK 3GTMC 3S14C 4A3IC 4QJVA 2WB1L 4Y7NC 3PO2C 4BXXC 1Y1VC 3HOWC 4A3JK 4A3GK 2R93C 3M4OC 2PPBA 3PO3K 3H3VL 3S1MK 2NVXK 2JA8K 3S17C 1TWAC 3K7AC 4A3MC 3RZOK 4OIOA 5FJ8K 3GTKK 4A3DC 3S16C 3H0GK 4LJZA 2NVYK 5IYDC 3S1RK 4A3LC 4Y52C 5IP7C 3S14K 4XSXA 1R9TK 3HOZC 3PO2K 1Y1VK 3DXJA 2R92K 2JA5K 1HQMA 1K83C 4A3BC 1SFOK 3HOUK 4NOIA 4C3HK 3HOXK 4YFXA 4MEXA 2B63C 2NVQC 3HKZD 4A3DK 4X6AK 3S16K 4A3LK 4MEYA 3S15K 3S1QK 3S2DC 1TWCK 2E2JK 2E2HK 2NVTC 4KN7A 4XSZA 4BY1K 3HOYK 1TWGK 3FKIC 1TWHC 4OIRA 4AYBL 1I6VA 3GTJK 3I4NK 3GTLK 2O5JA 4G7ZA 3S2HC 2WAQL 1WCMK 4XLPA 4QIWD 1IW7A 3GTMK 3WODA 2JA6K 4A3CK 3S1NC 5C4JC 4OIPA 2VUMC 4G7OA 1I3QK 4OIQA 4YFKA 2NVTK 2JA7C 2Y0SD 3GTGK 3M3YK 3GTOC 1SMYA 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNJ A;  2A6H A;  5IYC C;  4Y7N K;  2PMZ D;  2YU9 C;  3HOW K;  4BXX K;  2R93 K;  1TWH K;  3M4O K;  5TMC A;  4A93 C;  3GTP C;  5IP9 C;  2A68 A;  5C4X C;  5M5W K;  5M3F K;  4BBS C;  4BBR C;  3S2H K;  3HOV C;  1TWA K;  3K7A K;  5M3M K;  4A3M K;  2E2I C;  3S17 K;  5C3E C;  5IYD K;  2PA8 D;  4LK0 A;  4A3E C;  5IP7 K;  4Y52 K;  3EQL A;  5IYB C;  4A3F C;  5IYC K;  5M5Y K;  4ZH4 A;  5TMF A;  3HOZ K;  1I50 C;  2YU9 K;  3GTQ C;  1I6H C;  2BE5 A;  4LLG A;  2WB1 D;  3GTP K;  1Y1W C;  1K83 K;  4A3B K;  4KN4 A;  5C4X K;  3I4M C;  1YNN A;  4C2M K;  3RZD C;  2A69 A;  4BY7 C;  5C44 C;  2B63 K;  2NVQ K;  3H3V D;  4A3K C;  5C3E K;  4KMU A;  2R7Z C;  5FLM C;  3S2D K;  4A3J C;  4A3G C;  4G7H A;  3PO3 C;  3HKZ L;  3FKI K;  2NVX C;  2JA8 C;  4LK1 A;  4XLN A;  3GTK C;  4OIN A;  4BY7 K;  2A6E A;  3H0G C;  2NVY C;  3S1R C;  2CW0 A;  1R9T C;  3S1N K;  5C4J K;  2VUM K;  5FLM K;  4Q4Z A;  2JA7 K;  3CQZ C;  5M5X K;  2JA5 C;  1TWF K;  2R92 C;  2R7Z K;  4MQ9 A;  3GTO K;  4Q5S A;  1SFO C;  3HOU C;  4JK1 A;  4QJV B;  1XPP A;  4QIW L;  3HOX C;  4YG2 A;  4C3I K;  2O5I A;  4A93 K;  5IP9 K;  4BBS K;  4X6A C;  1ZYR A;  4AYB D;  2Y0S L;  4BBR K;  4C3J K;  3HOV K;  1TWF C;  2E2I K;  3S15 C;  3S1Q C;  1TWC C;  2E2J C;  2E2H C;  2PMZ L;  2WAQ D;  3CQZ K;  4BY1 C;  4A3E K;  3HOY C;  1TWG C;  4YFN A;  5IYB K;  4A3F K;  1I6H K;  1I50 K;  3GTJ C;  3GTQ K;  3I4N C;  3GTL C;  3S1M C;  5D4D A;  1Y1W K;  1WCM C;  3RZO C;  2PA8 L;  4GZY A;  3I4M K;  1BDF A;  2JA6 C;  4A3C C;  3RZD K;  5C44 K;  1I3Q C;  3GTG C;  3M3Y C;  4A3K K;  3GTM C;  3S14 C;  4A3I C;  4QJV A;  2WB1 L;  4Y7N C;  3PO2 C;  4BXX C;  1Y1V C;  3HOW C;  4A3J K;  4A3G K;  2R93 C;  3M4O C;  2PPB A;  3PO3 K;  3H3V L;  3S1M K;  2NVX K;  2JA8 K;  3S17 C;  1TWA C;  3K7A C;  4A3M C;  3RZO K;  4OIO A;  5FJ8 K;  3GTK K;  4A3D C;  3S16 C;  3H0G K;  4LJZ A;  2NVY K;  5IYD C;  3S1R K;  4A3L C;  4Y52 C;  5IP7 C;  3S14 K;  4XSX A;  1R9T K;  3HOZ C;  3PO2 K;  1Y1V K;  3DXJ A;  2R92 K;  2JA5 K;  1HQM A;  1K83 C;  4A3B C;  1SFO K;  3HOU K;  4NOI A;  4C3H K;  3HOX K;  4YFX A;  4MEX A;  2B63 C;  2NVQ C;  3HKZ D;  4A3D K;  4X6A K;  3S16 K;  4A3L K;  4MEY A;  3S15 K;  3S1Q K;  3S2D C;  1TWC K;  2E2J K;  2E2H K;  2NVT C;  4KN7 A;  4XSZ A;  4BY1 K;  3HOY K;  1TWG K;  3FKI C;  1TWH C;  4OIR A;  4AYB L;  1I6V A;  3GTJ K;  3I4N K;  3GTL K;  2O5J A;  4G7Z A;  3S2H C;  2WAQ L;  1WCM K;  4XLP A;  4QIW D;  1IW7 A;  3GTM K;  3WOD A;  2JA6 K;  4A3C K;  3S1N C;  5C4J C;  4OIP A;  2VUM C;  4G7O A;  1I3Q K;  4OIQ A;  4YFK A;  2NVT K;  2JA7 C;  2Y0S D;  3GTG K;  3M3Y K;  3GTO C;  1SMY A;  4A3I K; 
#chains in the Genus database with same CATH topology
 1YNJ A;  4O2D A;  2PMZ D;  1TWH K;  1EH1 A;  3GEI A;  5TMC A;  3M4O K;  2A68 A;  1ZVU A;  5M5W K;  1WSR A;  1PJ7 A;  2YU9 A;  4C3J C;  4LQY A;  1XXB A;  5M3M K;  5C3E C;  1VRQ C;  5IYB C;  5M5Y K;  4ZH4 A;  3GTQ C;  4LLG A;  1F93 A;  1K83 K;  4A3B K;  3QX3 A;  2A69 A;  2B63 K;  3TFI A;  2NVQ K;  3H3V D;  5C3E K;  1XXC A;  3S2D K;  3GSI A;  3ADA C;  1USO A;  1J6W A;  4P5A A;  3HKZ L;  2JA7 A;  3AQP A;  3GTO A;  1DCO A;  1USM A;  5JVO A;  4ILD A;  4FM9 A;  5L46 A;  3S1N K;  2VUM K;  1BGW A;  5IOQ A;  4BKW A;  4Q5S A;  2D6F C;  4A93 K;  5IP9 K;  2KWA A;  1ZYR A;  3GTQ A;  4KAT A;  3HOV K;  3S1Q C;  3MML B;  4G0W A;  1IBA A;  1TWC C;  2E2J C;  2P8T A;  3SZZ A;  1TWG C;  3GEH A;  4A3F K;  4KC6 A;  3BUE A;  1WQF A;  3N3Y A;  1Y1W K;  3S1M C;  2PA8 L;  3HXA A;  4A3C C;  3RZD K;  1JOE A;  3M3Y C;  3GTG C;  4A3K K;  3T00 A;  4QJV A;  3S0X A;  4LR2 A;  2R93 C;  4A3J K;  1Y1V A;  3S1M K;  2NVX K;  1TWA C;  3K7A C;  4OIO A;  1YX2 A;  3DXJ A;  3AH5 A;  1TWC A;  1SFO K;  4GTB A;  4C3H K;  1O27 A;  3AD9 C;  3HOX K;  1TWG A;  3HKZ D;  4BLB A;  5CHP A;  2E2H K;  3GDZ A;  1UV7 A;  4XSZ A;  4BY1 K;  3HOY K;  4PAA A;  3GTG A;  4OIR A;  3GTJ K;  2R93 A;  2WAQ L;  1WCM K;  4XLP A;  1IW7 A;  4G7O A;  4AH6 A;  4OIQ A;  1TWA A;  3GTM K;  1TWF C;  5IYC C;  4Y7N K;  2YU9 C;  4BXX K;  3HOW K;  1X31 C;  1O2A A;  2V6S A;  5C4X C;  4GTC A;  4BBS C;  4BBR C;  2E2I C;  3GTP A;  5IYD K;  2PA8 D;  4A3E C;  1RU0 A;  5IP7 K;  5IYC K;  1I6H C;  1I50 C;  2YU9 K;  2BE5 A;  2JH3 A;  5C4X K;  4P5B A;  3ORE A;  5C44 C;  1WQG A;  4KMU A;  5FLM C;  3LPX A;  4A3G C;  1WOO A;  4G7H A;  1XZP B;  3FKI K;  1TWF A;  4XLN A;  3VA7 A;  3H0G C;  3S1R C;  2CW0 A;  1R9T C;  5FLM K;  4Q4Z A;  2JA7 K;  5M5X K;  2R92 C;  2E2I A;  4MQ9 A;  3GTO K;  1PJ5 A;  1XPP A;  3CQZ A;  2O5I A;  1VH2 A;  3TFJ A;  2XCO A;  1I50 A;  4C3J K;  3S15 C;  4KAR A;  2WAQ D;  4KM9 A;  3N0B A;  2PHC B;  3AD8 C;  4GT9 A;  5IYB K;  3GTQ K;  1L0W A;  3T02 A;  2ZUE A;  1EFW A;  1BDF A;  4KM8 A;  1B4A A;  1DCP A;  3H0G A;  1Y1V C;  3T01 A;  5E68 A;  2CFA B;  1R9T A;  2FQT A;  3S17 C;  2R92 A;  4A3M C;  3N0C A;  3S16 C;  2RH6 A;  4GTL A;  1O25 A;  3CAG A;  4Y52 C;  4KDD A;  1C0A A;  3HOZ C;  1Y1V K;  4BLA A;  1HQM A;  2XCQ A;  1IE0 A;  4YFX A;  1J6V A;  3AD7 C;  2V6T A;  3S16 K;  4PAB A;  3S1Q K;  1TWC K;  2E2J K;  4KN7 A;  1EK8 A;  1TWG K;  1VJE A;  4AYB L;  1I6V A;  3A8I A;  3L4K A;  1IL2 A;  2O5J A;  4G7Z A;  2GSU A;  3S2H C;  3WOD A;  4KAS A;  4A3C K;  5C4J C;  4WJ3 M;  1ZXO A;  3M3Y K;  1DD5 A;  3GTG K;  2R7Z C;  4GFQ A;  2R93 K;  3LAJ A;  1F9N A;  4C3I C;  3GTP C;  5M3F K;  4LOW A;  4C2M C;  3S2H K;  1TWA K;  3K7A K;  5EGH A;  3NUH A;  5IOR A;  3EQL A;  1JQW A;  1ZBS A;  4XCH A;  3LAP A;  3GTP K;  4KN4 A;  1AB4 A;  3I4M C;  1YNN A;  4C2M K;  4BY7 C;  4GTE A;  2RGR A;  2XCR B;  1WIH A;  3SZY A;  3PO3 C;  4C45 A;  1F7U A;  2JA8 C;  2R7Z A;  1XZQ A;  1O24 A;  4OIN A;  3GTK C;  2A6E A;  4BY7 K;  2NVY C;  2FQO A;  1EQR A;  1WQH A;  4GTD A;  4G0V A;  3CQZ C;  2JA5 C;  3AQO A;  1TWF K;  1WOP A;  3HOU C;  4QIW L;  4YG2 A;  4BBS K;  4X6A C;  4AYB D;  4BBR K;  4J3N A;  2E2I K;  1ISE A;  5IOT A;  1O2B A;  3CQZ K;  4A3E K;  3V4G A;  1I6H K;  1I50 K;  3I4N C;  3GTL C;  5CJ9 A;  5D4D A;  3TFH A;  4GZY A;  2JA6 C;  1IQ0 A;  5C44 K;  1I3Q C;  3S14 C;  4A3I C;  3GTK A;  2WB1 L;  3OEP A;  2NVY A;  4A3G K;  2GAH C;  3M4O C;  3G4C A;  2JA5 A;  5FJ8 K;  3A8K A;  4A3D C;  3H0G K;  3Q3Q A;  3S1R K;  4KB4 A;  4A3L C;  1BS2 A;  3S14 K;  4XSX A;  1R9T K;  1WSV A;  3BP8 C;  2R92 K;  4GTF A;  1K83 C;  4A3B C;  2Y3P A;  4MEX A;  2B63 C;  2ZFZ A;  2NVQ C;  2P5M A;  4A3D K;  4A3L K;  4MEY A;  3S15 K;  3GTL A;  2CFA A;  1J6X A;  3G4A A;  1F7V A;  3S2D C;  4FZB A;  2JA6 A;  1VLO A;  3OPF A;  1I3Q A;  1HI9 A;  3FHZ A;  3FKI A;  3FOF A;  1TWH A;  4QIW D;  3GIR A;  3S1N C;  2VUM C;  1JVI A;  1O2F B;  4YFK A;  2V6U A;  2A6H A;  2W7V A;  4A93 C;  4KB2 A;  5IP9 C;  3JST A;  4WIL A;  3HOV C;  3S17 K;  4A3M K;  1K83 A;  3TTG A;  4LK0 A;  4Y52 K;  2B63 A;  1O29 A;  4A3F C;  3ERE D;  5TMF A;  3HOZ K;  2GSO A;  2WB1 D;  4KAW X;  1Y1W C;  4G0U A;  3RZD C;  4A3K C;  4A3J C;  4M1X A;  3GEE A;  3IPJ A;  2VUM A;  1XXA A;  2NVX C;  1EI6 A;  4LK1 A;  1WOS A;  5TJ3 A;  1V5V A;  4WJ4 A;  1GE9 A;  5C4J K;  2GSN A;  2R7Z K;  1SFO C;  4JK1 A;  4QJV B;  4C3H C;  3HOX C;  4C3I K;  2EBB A;  3L4J A;  2Y0S L;  2GAG C;  1IS1 A;  1Y1W A;  2E2H C;  2PMZ L;  4RMF A;  1PJ6 A;  4BY1 C;  3HOY C;  4YFN A;  3GTJ C;  4KMA A;  4DDQ A;  1WCM C;  3RZO C;  3I4M K;  3A8J A;  2NVX A;  1YCL A;  3GTM C;  5EGE A;  1B4B A;  4Y7N C;  3PO2 C;  5IOS A;  3HOW C;  4BXX C;  1INN A;  2PPB A;  3PO3 K;  3H3V L;  2JA8 K;  2ZUF A;  3RZO K;  3GTK K;  1SFO A;  4LJZ A;  5IYD C;  2NVY K;  5IP7 C;  1XZP A;  3PO2 K;  1BJT A;  2JA5 K;  4P9S A;  1O26 A;  2E2H A;  1G51 A;  1O28 A;  1DCH A;  3HOU K;  4NOI A;  1J98 A;  1ZQ1 C;  5JFE A;  4KMH A;  3FOE A;  1VGX A;  4X6A K;  4GTA A;  3GTJ A;  1XZQ B;  1WCM A;  2NVT C;  5HL8 A;  3FKI C;  1TWH C;  3GTM A;  3I4N K;  3GTL K;  3BP3 A;  1WOR A;  4KMD A;  2JA6 K;  1KQ4 A;  4OIP A;  1I3Q K;  2JA7 C;  2NVT K;  2Y0S D;  3GTO C;  1SMY A;  4A3I K; 
#chains in the Genus database with same CATH homology
 1YNJ A;  2A6H A;  5IYC C;  4Y7N K;  2PMZ D;  2YU9 C;  3HOW K;  4BXX K;  2R93 K;  1TWH K;  3M4O K;  5TMC A;  4A93 C;  3GTP C;  5IP9 C;  2A68 A;  5C4X C;  5M5W K;  5M3F K;  4BBS C;  4BBR C;  3S2H K;  3HOV C;  1TWA K;  3K7A K;  5M3M K;  4A3M K;  2E2I C;  3S17 K;  5C3E C;  5IYD K;  2PA8 D;  4LK0 A;  4A3E C;  5IP7 K;  4Y52 K;  3EQL A;  5IYB C;  4A3F C;  5IYC K;  5M5Y K;  4ZH4 A;  5TMF A;  3HOZ K;  1I50 C;  2YU9 K;  3GTQ C;  1I6H C;  2BE5 A;  4LLG A;  2WB1 D;  3GTP K;  1Y1W C;  1K83 K;  4A3B K;  4KN4 A;  5C4X K;  3I4M C;  1YNN A;  4C2M K;  3RZD C;  2A69 A;  4BY7 C;  5C44 C;  2B63 K;  2NVQ K;  3H3V D;  4A3K C;  5C3E K;  4KMU A;  2R7Z C;  5FLM C;  3S2D K;  4A3J C;  4A3G C;  4G7H A;  3PO3 C;  3HKZ L;  3FKI K;  2NVX C;  2JA8 C;  4LK1 A;  4XLN A;  3GTK C;  4OIN A;  4BY7 K;  2A6E A;  3H0G C;  2NVY C;  3S1R C;  2CW0 A;  1R9T C;  3S1N K;  5C4J K;  2VUM K;  5FLM K;  4Q4Z A;  2JA7 K;  3CQZ C;  5M5X K;  2JA5 C;  1TWF K;  2R92 C;  2R7Z K;  4MQ9 A;  3GTO K;  4Q5S A;  1SFO C;  3HOU C;  4JK1 A;  4QJV B;  1XPP A;  4QIW L;  3HOX C;  4YG2 A;  4C3I K;  2O5I A;  4A93 K;  5IP9 K;  4BBS K;  4X6A C;  1ZYR A;  4AYB D;  2Y0S L;  4BBR K;  4C3J K;  3HOV K;  1TWF C;  2E2I K;  3S15 C;  3S1Q C;  1TWC C;  2E2J C;  2E2H C;  2PMZ L;  2WAQ D;  3CQZ K;  4BY1 C;  4A3E K;  3HOY C;  1TWG C;  4YFN A;  5IYB K;  4A3F K;  1I6H K;  1I50 K;  3GTJ C;  3GTQ K;  3I4N C;  3GTL C;  3S1M C;  5D4D A;  1Y1W K;  1WCM C;  3RZO C;  2PA8 L;  4GZY A;  3I4M K;  1BDF A;  2JA6 C;  4A3C C;  3RZD K;  5C44 K;  1I3Q C;  3GTG C;  3M3Y C;  4A3K K;  3GTM C;  3S14 C;  4A3I C;  4QJV A;  2WB1 L;  4Y7N C;  3PO2 C;  4BXX C;  1Y1V C;  3HOW C;  4A3J K;  4A3G K;  2R93 C;  3M4O C;  2PPB A;  3PO3 K;  3H3V L;  3S1M K;  2NVX K;  2JA8 K;  3S17 C;  1TWA C;  3K7A C;  4A3M C;  3RZO K;  4OIO A;  5FJ8 K;  3GTK K;  4A3D C;  3S16 C;  3H0G K;  4LJZ A;  2NVY K;  5IYD C;  3S1R K;  4A3L C;  4Y52 C;  5IP7 C;  3S14 K;  4XSX A;  1R9T K;  3HOZ C;  3PO2 K;  1Y1V K;  3DXJ A;  2R92 K;  2JA5 K;  1HQM A;  1K83 C;  4A3B C;  1SFO K;  3HOU K;  4NOI A;  4C3H K;  3HOX K;  4YFX A;  4MEX A;  2B63 C;  2NVQ C;  3HKZ D;  4A3D K;  4X6A K;  3S16 K;  4A3L K;  4MEY A;  3S15 K;  3S1Q K;  3S2D C;  1TWC K;  2E2J K;  2E2H K;  2NVT C;  4KN7 A;  4XSZ A;  4BY1 K;  3HOY K;  1TWG K;  3FKI C;  1TWH C;  4OIR A;  4AYB L;  1I6V A;  3GTJ K;  3I4N K;  3GTL K;  2O5J A;  4G7Z A;  3S2H C;  2WAQ L;  1WCM K;  4XLP A;  4QIW D;  1IW7 A;  3GTM K;  3WOD A;  2JA6 K;  4A3C K;  3S1N C;  5C4J C;  4OIP A;  2VUM C;  4G7O A;  1I3Q K;  4OIQ A;  4YFK A;  2NVT K;  2JA7 C;  2Y0S D;  3GTG K;  3M3Y K;  3GTO C;  1SMY A;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...