5C3EK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c3eK00
3GTJK 2CW0A 5FJ8K 1I6HC 4XLNA 5IYCC 2PA8D 3S1RK 3S2HK 2JA5K 4KMUA 3GTGC 2E2JC 4OIOA 3GTPK 4AYBL 2NVXC 3M4OK 3HOZC 1Y1VC 2JA6K 3M4OC 4KN7A 4C3JK 1Y1VK 1R9TK 1SFOK 3GTMK 4A3GK 4X6AC 3PO2C 4A3LC 3GTGK 2JA5C 4A3FC 5D4DA 1I6VA 5TMFA 3S1RC 1TWCC 3S2HC 1I6HK 3HKZL 4LK1A 3GTJC 4QIWD 5FLMK 3I4NC 4KN4A 2YU9C 4A3KC 2B63K 3GTOK 3CQZC 4YFNA 1TWAC 4LJZA 3K7AK 1I50C 5C4JC 2E2HK 3H3VL 2NVQK 5IYDK 3GTKC 3WODA 3RZDK 4A3CC 3HOWK 4BBSK 2E2IC 3H0GC 3DXJA 3S1MC 4A3EC 3HKZD 4A3MC 5C4XC 2A69A 4A3EK 5IYBC 1TWHK 4OIQA 3HOXK 3HOVC 3GTOC 2VUMC 1ZYRA 1WCMC 3K7AC 5C4JK 2NVYC 1IW7A 4BXXK 4Q5SA 4QJVB 3M3YK 2JA8C 4QJVA 4OIRA 5C44C 5M3FK 5FLMC 4BY1K 3I4NK 3RZOK 2PA8L 4XSXA 2PMZL 1TWCK 2WAQD 4G7ZA 2R7ZC 3S14C 3PO3K 4A3FK 2R93C 4XLPA 5TMCA 1YNJA 5IP7K 4A3LK 3HOUK 3PO2K 3S1QC 2Y0SL 1SFOC 4BXXC 4A3GC 4JK1A 1HQMA 1R9TC 4X6AK 4Y52C 4Y7NK 2VUMK 2NVXK 4YG2A 2A6HA 2E2JK 3EQLA 1BDFA 3GTQK 2WAQL 2PMZD 4C3HK 4A3MK 3S1NK 5IYCK 4A93C 4C3IK 1I3QC 1YNNA 4BBSC 4BBRC 3S16C 3GTKK 1Y1WK 2NVQC 3I4MK 5IYDC 1TWGC 2E2HC 1TWFK 2NVTK 3H3VD 2Y0SD 2B63C 4LK0A 2YU9K 4OINA 4MEXA 2NVTC 4A3IK 1Y1WC 3I4MC 3S16K 4BBRK 1I3QK 2R92C 3FKIC 4YFXA 3GTQC 4A93K 3S1NC 3HOYC 4A3BC 5IP9C 3S2DK 5C3EC 3GTMC 2JA6C 4Y7NC 3HOZK 1SMYA 4Y52K 3GTPC 4BY7K 3HOUC 4AYBD 3S1QK 4MQ9A 4ZH4A 4QIWL 4OIPA 5IP7C 5M3MK 4A3JK 3GTLC 2R7ZK 2R93K 3PO3C 3S14K 5M5XK 3GTLK 3RZOC 2A68A 2JA8K 4A3JC 5C44K 4BY1C 3M3YC 1XPPA 3S17K 2JA7C 4BY7C 4A3DK 4C2MK 1WCMK 2NVYK 3S15C 3HOVK 2A6EA 2WB1L 5C3EK 5IP9K 4G7HA 3S2DC 4G7OA 4A3BK 3HOXC 1K83C 2PPBA 3HOYK 1TWHC 4YFKA 5IYBK 3FKIK 2O5IA 5C4XK 2BE5A 3H0GK 5M5YK 2E2IK 2R92K 1K83K 3S1MK 3RZDC 4A3CK 3HOWC 4XSZA 1I50K 2WB1D 4A3IC 3S15K 2O5JA 4A3DC 5M5WK 3CQZK 4LLGA 2JA7K 1TWAK 3S17C 4A3KK 1TWFC 4GZYA 1TWGK 4MEYA 4Q4ZA 4NOIA
chains in the Genus database with same CATH superfamily
2CW0A 1PJ7A 1I6HC 3AQOA 1DD5A 4KN7A 4C3JK 1Y1VK 3GTMK 4BLBA 1XZPB 2KWAA 3GTGK 5D4DA 3V4GA 3S1RC 5JVOA 2V6SA 3GTJC 1TWCA 3JSTA 4QIWD 3I4NC 5EGEA 1F7UA 1F9NA 2YU9C 1BGWA 5IYDK 3CQZA 3WODA 4A3CC 4KM9A 4BBSK 2E2IC 1YX2A 4C3HC 1JQWA 1TWHK 3G4CA 3HOVC 1ZYRA 1IW7A 1EK8A 1TWGA 2GSUA 4KC6A 3GSIA 1IL2A 5HL8A 3TFHA 4PABA 2WAQD 1TWCK 2R7ZC 3PO2K 4BXXC 4YG2A 3S1NK 1VRQC 2PMZD 4A93C 5IYCK 3Q3QA 4GFQA 4C3IK 1YNNA 4BBRC 3S16C 1INNA 3GTKK 2CFAB 3I4MK 1XZQB 2E2HC 1C0AA 5TJ3A 1WIHA 1O2AA 2B63C 2NVTC 1HI9A 1Y1WC 1TWAA 3I4MC 1WOSA 4GT9A 1ZVUA 3GTKA 3GTQC 5IP9C 5C3EC 1SMYA 3FOFA 3S1QK 4MQ9A 4ZH4A 5M3MK 5IP7C 1BS2A 4GTBA 3S14K 4GTCA 3AD9C 3GTLK 3N0BA 4ILDA 4A3DK 2ZUEA 1WCMK 3TFIA 5C3EK 4A3BK 2PPBA 1TWHC 4FM9A 5C4XK 3LPXA 3HOWC 4XSZA 1I50K 2WB1D 2Y3PA 1VLOA 3CQZK 3LAPA 2JA7K 1TWAK 4KATA 3GTOC 4OIRA 4NOIA 1VGXA 3GEHA 1TWFA 4GTAA 3S1RK 2E2IA 1SFOA 5CHPA 3ADAC 1XZPA 3GTMA 4A3LC 2JA5C 4KMDA 3S2HC 1I6VA 1TWCC 3OREA 2W7VA 4LK1A 4GTEA 3GTOA 4BKWA 2PHCB 3GTKC 1GE9A 2XCQA 3H0GC 1EQRA 1ZXOA 3A8JA 4A3EC 1VH2A 4A3MC 1K83A 1TWHA 3HOXK 3AQPA 1WCMC 5C4JK 2NVYC 4C2MC 1PJ5A 1WSVA 4QJVA 1IQ0A 5FLMC 3NUHA 5IOSA 2R93C 1DCHA 4GTDA 5TMCA 5IP7K 4KARA 1SFOC 4JK1A 3AH5A 4Y7NK 4FZBA 2NVYA 3GTQK 4C3HK 1V5VA 3MMLB 2RH6A 4BBSC 1L0WA 3GDZA 5IYDC 1TWGC 1J6WA 2GAGC 5JFEA 2V6TA 4J3NA 2GAHC 4GTLA 4A3IK 3S16K 4YFXA 2RGRA 4XCHA 3HOYC 3GTMC 3BP8C 3SZZA 4C45A 4WJ3M 4Y52K 3AD8C 3A8KA 4AYBD 1O27A 2EBBA 3PO3C 2A68A 5C44K 4BY1C 1J98A 3M3YC 3S17K 1XXCA 3GEIA 4C2MK 3S15C 3HOVK 3H0GA 2A6EA 3S2DC 4G7OA 3HOXC 1K83C 1WQHA 3HOYK 4YFKA 5IYBK 3FKIK 2O5IA 5M5YK 2E2IK 1USOA 3RZDC 4KAWX 4A3IC 3S15K 3S17C 4A3KK 4GZYA 1TWGK 1WOOA 1WORA 1XZQA 3S2HK 3L4JA 4OIOA 1I50A 3GTPK 1XXBA 3ERED 1SFOK 1WCMA 3A8IA 4A3FC 1BJTA 4RMFA 5TMFA 1I6HK 3HKZL 3N0CA 5FLMK 3GTOK 1TWAC 3GTGA 4O2DA 5C4JC 2NVQK 4KDDA 1Y1VA 2P8TA 3RZDK 3FKIA 3HOWK 4LQYA 3T01A 3HKZD 1O29A 5C4XC 4A3EK 4G0VA 1WSRA 3QX3A 2GSOA 1EFWA 3K7AC 3GTJA 1JOEA 1USMA 4Q5SA 1J6XA 4QJVB 3M3YK 2JA8C 5M3FK 2PA8L 1WQFA 4G7ZA 1J6VA 3S14C 1RU0A 4XLPA 2R7ZA 4A3LK 3HOUK 2Y0SL 4A3GC 1HQMA 1R9TC 4X6AK 3TFJA 2CFAA 2VUMK 3AD7C 5L46A 2NVXK 2E2JK 1PJ6A 1R9TA 3GTQA 1BDFA 4A3MK 1ISEA 3HXAA 2NVTK 3H3VD 2Y0SD 4LK0A 2YU9A 4OINA 4MEXA 3SZYA 2FQOA 2XCOA 1F7VA 2R93A 2R92C 5EGHA 4G0WA 3FHZA 2R92A 4A3BC 1I3QA 2JA6C 3HOZK 5IOTA 4BY7K 1IE0A 1O28A 1DCOA 4KASA 4A3JK 3L4KA 3GTLC 4DDQA 4BLAA 1G51A 2JA7A 4A3JC 2JA7C 4BY7C 1WQGA 1EH1A 5IP9K 4G7HA 2JA6A 4KMAA 3FOEA 2BE5A 2JA5A 3H0GK 3LAJA 2R92K 4KMHA 4A3DC 5M5WK 4LLGA 1O25A 4MEYA 3GTJK 5FJ8K 4XLNA 5IYCC 1O26A 2PA8D 2JA5K 3TTGA 4KMUA 3GTGC 2E2JC 4PAAA 4AYBL 2NVXC 3M4OK 3HOZC 1Y1VC 2JA6K 3M4OC 1R9TK 4X6AC 4A3GK 2NVXA 3PO2C 1O2BA 2GSNA 3GTPA 5IORA 3N3YA 4KB4A 1O2FB 2FQTA 4KN4A 4A3KC 2B63K 3CQZC 4YFNA 4KM8A 4LJZA 3GEEA 3K7AK 1I50C 3H3VL 3T00A 2E2HK 5CJ9A 3DXJA 3S1MC 1JVIA 3IPJA 2A69A 5IYBC 4OIQA 1KQ4A 1DCPA 5IOQA 2VUMC 4P5BA 4BXXK 2V6UA 3OEPA 4P9SA 5C44C 4BY1K 3I4NK 2ZFZA 3RZOK 1YCLA 4XSXA 2P5MA 2PMZL 3PO3K 4GTFA 4A3FK 1YNJA 3G4AA 4KB2A 3S1QC 1Y1WA 4C3JC 1B4BA 4LR2A 4Y52C 2VUMA 3S0XA 1X31C 2A6HA 3EQLA 2WAQL 3OPFA 1I3QC 2XCRB 1WOPA 1Y1WK 2NVQC 1TWFK 2YU9K 1VJEA 4BBRK 1ZQ1C 4C3IC 1I3QK 1UV7A 3BUEA 3FKIC 4A93K 4G0UA 3S1NC 1O24A 3T02A 3S2DK 2ZUFA 2JH3A 3CAGA 3GIRA 5E68A 3VA7A 4Y7NC 3GTPC 3HOUC 4QIWL 4OIPA 1XXAA 1EI6A 2B63A 1ZBSA 3BP3A 2R7ZK 2R93K 2E2HA 5M5XK 3GTLA 3RZOC 2JA8K 1XPPA 4WJ4A 2NVYK 1F93A 2WB1L 2D6FC 1IBAA 4M1XA 4AH6A 3S1MK 1K83K 1IS1A 4A3CK 1AB4A 4LOWA 2O5JA 4P5AA 4WILA 1TWFC 1B4AA 4Q4ZA
chains in the Genus database with same CATH topology
3GTJK 2CW0A 5FJ8K 1I6HC 4XLNA 5IYCC 2PA8D 3S1RK 3S2HK 2JA5K 4KMUA 3GTGC 2E2JC 4OIOA 3GTPK 4AYBL 2NVXC 3M4OK 3HOZC 1Y1VC 2JA6K 3M4OC 4KN7A 4C3JK 1Y1VK 1R9TK 1SFOK 3GTMK 4A3GK 4X6AC 3PO2C 4A3LC 3GTGK 2JA5C 4A3FC 5D4DA 1I6VA 5TMFA 3S1RC 1TWCC 3S2HC 1I6HK 3HKZL 4LK1A 3GTJC 4QIWD 5FLMK 3I4NC 4KN4A 2YU9C 4A3KC 2B63K 3GTOK 3CQZC 4YFNA 1TWAC 4LJZA 3K7AK 1I50C 5C4JC 2E2HK 3H3VL 2NVQK 5IYDK 3GTKC 3WODA 3RZDK 4A3CC 3HOWK 4BBSK 2E2IC 3H0GC 3DXJA 3S1MC 4A3EC 3HKZD 4A3MC 5C4XC 2A69A 4A3EK 5IYBC 1TWHK 4OIQA 3HOXK 3HOVC 3GTOC 2VUMC 1ZYRA 1WCMC 3K7AC 5C4JK 2NVYC 1IW7A 4BXXK 4Q5SA 4QJVB 3M3YK 2JA8C 4QJVA 4OIRA 5C44C 5M3FK 5FLMC 4BY1K 3I4NK 3RZOK 2PA8L 4XSXA 2PMZL 1TWCK 2WAQD 4G7ZA 2R7ZC 3S14C 3PO3K 4A3FK 2R93C 4XLPA 5TMCA 1YNJA 5IP7K 4A3LK 3HOUK 3PO2K 3S1QC 2Y0SL 1SFOC 4BXXC 4A3GC 4JK1A 1HQMA 1R9TC 4X6AK 4Y52C 4Y7NK 2VUMK 2NVXK 4YG2A 2A6HA 2E2JK 3EQLA 1BDFA 3GTQK 2WAQL 2PMZD 4C3HK 4A3MK 3S1NK 5IYCK 4A93C 4C3IK 1I3QC 1YNNA 4BBSC 4BBRC 3S16C 3GTKK 1Y1WK 2NVQC 3I4MK 5IYDC 1TWGC 2E2HC 1TWFK 2NVTK 3H3VD 2Y0SD 2B63C 4LK0A 2YU9K 4OINA 4MEXA 2NVTC 4A3IK 1Y1WC 3I4MC 3S16K 4BBRK 1I3QK 2R92C 3FKIC 4YFXA 3GTQC 4A93K 3S1NC 3HOYC 4A3BC 5IP9C 3S2DK 5C3EC 3GTMC 2JA6C 4Y7NC 3HOZK 1SMYA 4Y52K 3GTPC 4BY7K 3HOUC 4AYBD 3S1QK 4MQ9A 4ZH4A 4QIWL 4OIPA 5IP7C 5M3MK 4A3JK 3GTLC 2R7ZK 2R93K 3PO3C 3S14K 5M5XK 3GTLK 3RZOC 2A68A 2JA8K 4A3JC 5C44K 4BY1C 3M3YC 1XPPA 3S17K 2JA7C 4BY7C 4A3DK 4C2MK 1WCMK 2NVYK 3S15C 3HOVK 2A6EA 2WB1L 5C3EK 5IP9K 4G7HA 3S2DC 4G7OA 4A3BK 3HOXC 1K83C 2PPBA 3HOYK 1TWHC 4YFKA 5IYBK 3FKIK 2O5IA 5C4XK 2BE5A 3H0GK 5M5YK 2E2IK 2R92K 1K83K 3S1MK 3RZDC 4A3CK 3HOWC 4XSZA 1I50K 2WB1D 4A3IC 3S15K 2O5JA 4A3DC 5M5WK 3CQZK 4LLGA 2JA7K 1TWAK 3S17C 4A3KK 1TWFC 4GZYA 1TWGK 4MEYA 4Q4ZA 4NOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ K;  2CW0 A;  5FJ8 K;  1I6H C;  4XLN A;  5IYC C;  2PA8 D;  3S1R K;  3S2H K;  2JA5 K;  4KMU A;  3GTG C;  2E2J C;  4OIO A;  3GTP K;  4AYB L;  2NVX C;  3M4O K;  3HOZ C;  1Y1V C;  2JA6 K;  3M4O C;  4KN7 A;  4C3J K;  1Y1V K;  1R9T K;  1SFO K;  3GTM K;  4A3G K;  4X6A C;  3PO2 C;  4A3L C;  3GTG K;  2JA5 C;  4A3F C;  5D4D A;  1I6V A;  5TMF A;  3S1R C;  1TWC C;  3S2H C;  1I6H K;  3HKZ L;  4LK1 A;  3GTJ C;  4QIW D;  5FLM K;  3I4N C;  4KN4 A;  2YU9 C;  4A3K C;  2B63 K;  3GTO K;  3CQZ C;  4YFN A;  1TWA C;  4LJZ A;  3K7A K;  1I50 C;  5C4J C;  2E2H K;  3H3V L;  2NVQ K;  5IYD K;  3GTK C;  3WOD A;  3RZD K;  4A3C C;  3HOW K;  4BBS K;  2E2I C;  3H0G C;  3DXJ A;  3S1M C;  4A3E C;  3HKZ D;  4A3M C;  5C4X C;  2A69 A;  4A3E K;  5IYB C;  1TWH K;  4OIQ A;  3HOX K;  3HOV C;  3GTO C;  2VUM C;  1ZYR A;  1WCM C;  3K7A C;  5C4J K;  2NVY C;  1IW7 A;  4BXX K;  4Q5S A;  4QJV B;  3M3Y K;  2JA8 C;  4QJV A;  4OIR A;  5C44 C;  5M3F K;  5FLM C;  4BY1 K;  3I4N K;  3RZO K;  2PA8 L;  4XSX A;  2PMZ L;  1TWC K;  2WAQ D;  4G7Z A;  2R7Z C;  3S14 C;  3PO3 K;  4A3F K;  2R93 C;  4XLP A;  5TMC A;  1YNJ A;  5IP7 K;  4A3L K;  3HOU K;  3PO2 K;  3S1Q C;  2Y0S L;  1SFO C;  4BXX C;  4A3G C;  4JK1 A;  1HQM A;  1R9T C;  4X6A K;  4Y52 C;  4Y7N K;  2VUM K;  2NVX K;  4YG2 A;  2A6H A;  2E2J K;  3EQL A;  1BDF A;  3GTQ K;  2WAQ L;  2PMZ D;  4C3H K;  4A3M K;  3S1N K;  5IYC K;  4A93 C;  4C3I K;  1I3Q C;  1YNN A;  4BBS C;  4BBR C;  3S16 C;  3GTK K;  1Y1W K;  2NVQ C;  3I4M K;  5IYD C;  1TWG C;  2E2H C;  1TWF K;  2NVT K;  3H3V D;  2Y0S D;  2B63 C;  4LK0 A;  2YU9 K;  4OIN A;  4MEX A;  2NVT C;  4A3I K;  1Y1W C;  3I4M C;  3S16 K;  4BBR K;  1I3Q K;  2R92 C;  3FKI C;  4YFX A;  3GTQ C;  4A93 K;  3S1N C;  3HOY C;  4A3B C;  5IP9 C;  3S2D K;  5C3E C;  3GTM C;  2JA6 C;  4Y7N C;  3HOZ K;  1SMY A;  4Y52 K;  3GTP C;  4BY7 K;  3HOU C;  4AYB D;  3S1Q K;  4MQ9 A;  4ZH4 A;  4QIW L;  4OIP A;  5IP7 C;  5M3M K;  4A3J K;  3GTL C;  2R7Z K;  2R93 K;  3PO3 C;  3S14 K;  5M5X K;  3GTL K;  3RZO C;  2A68 A;  2JA8 K;  4A3J C;  5C44 K;  4BY1 C;  3M3Y C;  1XPP A;  3S17 K;  2JA7 C;  4BY7 C;  4A3D K;  4C2M K;  1WCM K;  2NVY K;  3S15 C;  3HOV K;  2A6E A;  2WB1 L;  5C3E K;  5IP9 K;  4G7H A;  3S2D C;  4G7O A;  4A3B K;  3HOX C;  1K83 C;  2PPB A;  3HOY K;  1TWH C;  4YFK A;  5IYB K;  3FKI K;  2O5I A;  5C4X K;  2BE5 A;  3H0G K;  5M5Y K;  2E2I K;  2R92 K;  1K83 K;  3S1M K;  3RZD C;  4A3C K;  3HOW C;  4XSZ A;  1I50 K;  2WB1 D;  4A3I C;  3S15 K;  2O5J A;  4A3D C;  5M5W K;  3CQZ K;  4LLG A;  2JA7 K;  1TWA K;  3S17 C;  4A3K K;  1TWF C;  4GZY A;  1TWG K;  4MEY A;  4Q4Z A;  4NOI A; 
#chains in the Genus database with same CATH topology
 2CW0 A;  1PJ7 A;  1I6H C;  3AQO A;  1DD5 A;  4KN7 A;  4C3J K;  1Y1V K;  3GTM K;  4BLB A;  1XZP B;  2KWA A;  3GTG K;  5D4D A;  3V4G A;  3S1R C;  5JVO A;  2V6S A;  3GTJ C;  1TWC A;  3JST A;  4QIW D;  3I4N C;  5EGE A;  1F7U A;  1F9N A;  2YU9 C;  1BGW A;  5IYD K;  3CQZ A;  3WOD A;  4A3C C;  4KM9 A;  4BBS K;  2E2I C;  1YX2 A;  4C3H C;  1JQW A;  1TWH K;  3G4C A;  3HOV C;  1ZYR A;  1IW7 A;  1EK8 A;  1TWG A;  2GSU A;  4KC6 A;  3GSI A;  1IL2 A;  5HL8 A;  3TFH A;  4PAB A;  2WAQ D;  1TWC K;  2R7Z C;  3PO2 K;  4BXX C;  4YG2 A;  3S1N K;  1VRQ C;  2PMZ D;  4A93 C;  5IYC K;  3Q3Q A;  4GFQ A;  4C3I K;  1YNN A;  4BBR C;  3S16 C;  1INN A;  3GTK K;  2CFA B;  3I4M K;  1XZQ B;  2E2H C;  1C0A A;  5TJ3 A;  1WIH A;  1O2A A;  2B63 C;  2NVT C;  1HI9 A;  1Y1W C;  1TWA A;  3I4M C;  1WOS A;  4GT9 A;  1ZVU A;  3GTK A;  3GTQ C;  5IP9 C;  5C3E C;  1SMY A;  3FOF A;  3S1Q K;  4MQ9 A;  4ZH4 A;  5M3M K;  5IP7 C;  1BS2 A;  4GTB A;  3S14 K;  4GTC A;  3AD9 C;  3GTL K;  3N0B A;  4ILD A;  4A3D K;  2ZUE A;  1WCM K;  3TFI A;  5C3E K;  4A3B K;  2PPB A;  1TWH C;  4FM9 A;  5C4X K;  3LPX A;  3HOW C;  4XSZ A;  1I50 K;  2WB1 D;  2Y3P A;  1VLO A;  3CQZ K;  3LAP A;  2JA7 K;  1TWA K;  4KAT A;  3GTO C;  4OIR A;  4NOI A;  1VGX A;  3GEH A;  1TWF A;  4GTA A;  3S1R K;  2E2I A;  1SFO A;  5CHP A;  3ADA C;  1XZP A;  3GTM A;  4A3L C;  2JA5 C;  4KMD A;  3S2H C;  1I6V A;  1TWC C;  3ORE A;  2W7V A;  4LK1 A;  4GTE A;  3GTO A;  4BKW A;  2PHC B;  3GTK C;  1GE9 A;  2XCQ A;  3H0G C;  1EQR A;  1ZXO A;  3A8J A;  4A3E C;  1VH2 A;  4A3M C;  1K83 A;  1TWH A;  3HOX K;  3AQP A;  1WCM C;  5C4J K;  2NVY C;  4C2M C;  1PJ5 A;  1WSV A;  4QJV A;  1IQ0 A;  5FLM C;  3NUH A;  5IOS A;  2R93 C;  1DCH A;  4GTD A;  5TMC A;  5IP7 K;  4KAR A;  1SFO C;  4JK1 A;  3AH5 A;  4Y7N K;  4FZB A;  2NVY A;  3GTQ K;  4C3H K;  1V5V A;  3MML B;  2RH6 A;  4BBS C;  1L0W A;  3GDZ A;  5IYD C;  1TWG C;  1J6W A;  2GAG C;  5JFE A;  2V6T A;  4J3N A;  2GAH C;  4GTL A;  4A3I K;  3S16 K;  4YFX A;  2RGR A;  4XCH A;  3HOY C;  3GTM C;  3BP8 C;  3SZZ A;  4C45 A;  4WJ3 M;  4Y52 K;  3AD8 C;  3A8K A;  4AYB D;  1O27 A;  2EBB A;  3PO3 C;  2A68 A;  5C44 K;  4BY1 C;  1J98 A;  3M3Y C;  3S17 K;  1XXC A;  3GEI A;  4C2M K;  3S15 C;  3HOV K;  3H0G A;  2A6E A;  3S2D C;  4G7O A;  3HOX C;  1K83 C;  1WQH A;  3HOY K;  4YFK A;  5IYB K;  3FKI K;  2O5I A;  5M5Y K;  2E2I K;  1USO A;  3RZD C;  4KAW X;  4A3I C;  3S15 K;  3S17 C;  4A3K K;  4GZY A;  1TWG K;  1WOO A;  1WOR A;  1XZQ A;  3S2H K;  3L4J A;  4OIO A;  1I50 A;  3GTP K;  1XXB A;  3ERE D;  1SFO K;  1WCM A;  3A8I A;  4A3F C;  1BJT A;  4RMF A;  5TMF A;  1I6H K;  3HKZ L;  3N0C A;  5FLM K;  3GTO K;  1TWA C;  3GTG A;  4O2D A;  5C4J C;  2NVQ K;  4KDD A;  1Y1V A;  2P8T A;  3RZD K;  3FKI A;  3HOW K;  4LQY A;  3T01 A;  3HKZ D;  1O29 A;  5C4X C;  4A3E K;  4G0V A;  1WSR A;  3QX3 A;  2GSO A;  1EFW A;  3K7A C;  3GTJ A;  1JOE A;  1USM A;  4Q5S A;  1J6X A;  4QJV B;  3M3Y K;  2JA8 C;  5M3F K;  2PA8 L;  1WQF A;  4G7Z A;  1J6V A;  3S14 C;  1RU0 A;  4XLP A;  2R7Z A;  4A3L K;  3HOU K;  2Y0S L;  4A3G C;  1HQM A;  1R9T C;  4X6A K;  3TFJ A;  2CFA A;  2VUM K;  3AD7 C;  5L46 A;  2NVX K;  2E2J K;  1PJ6 A;  1R9T A;  3GTQ A;  1BDF A;  4A3M K;  1ISE A;  3HXA A;  2NVT K;  3H3V D;  2Y0S D;  4LK0 A;  2YU9 A;  4OIN A;  4MEX A;  3SZY A;  2FQO A;  2XCO A;  1F7V A;  2R93 A;  2R92 C;  5EGH A;  4G0W A;  3FHZ A;  2R92 A;  4A3B C;  1I3Q A;  2JA6 C;  3HOZ K;  5IOT A;  4BY7 K;  1IE0 A;  1O28 A;  1DCO A;  4KAS A;  4A3J K;  3L4K A;  3GTL C;  4DDQ A;  4BLA A;  1G51 A;  2JA7 A;  4A3J C;  2JA7 C;  4BY7 C;  1WQG A;  1EH1 A;  5IP9 K;  4G7H A;  2JA6 A;  4KMA A;  3FOE A;  2BE5 A;  2JA5 A;  3H0G K;  3LAJ A;  2R92 K;  4KMH A;  4A3D C;  5M5W K;  4LLG A;  1O25 A;  4MEY A;  3GTJ K;  5FJ8 K;  4XLN A;  5IYC C;  1O26 A;  2PA8 D;  2JA5 K;  3TTG A;  4KMU A;  3GTG C;  2E2J C;  4PAA A;  4AYB L;  2NVX C;  3M4O K;  3HOZ C;  1Y1V C;  2JA6 K;  3M4O C;  1R9T K;  4X6A C;  4A3G K;  2NVX A;  3PO2 C;  1O2B A;  2GSN A;  3GTP A;  5IOR A;  3N3Y A;  4KB4 A;  1O2F B;  2FQT A;  4KN4 A;  4A3K C;  2B63 K;  3CQZ C;  4YFN A;  4KM8 A;  4LJZ A;  3GEE A;  3K7A K;  1I50 C;  3H3V L;  3T00 A;  2E2H K;  5CJ9 A;  3DXJ A;  3S1M C;  1JVI A;  3IPJ A;  2A69 A;  5IYB C;  4OIQ A;  1KQ4 A;  1DCP A;  5IOQ A;  2VUM C;  4P5B A;  4BXX K;  2V6U A;  3OEP A;  4P9S A;  5C44 C;  4BY1 K;  3I4N K;  2ZFZ A;  3RZO K;  1YCL A;  4XSX A;  2P5M A;  2PMZ L;  3PO3 K;  4GTF A;  4A3F K;  1YNJ A;  3G4A A;  4KB2 A;  3S1Q C;  1Y1W A;  4C3J C;  1B4B A;  4LR2 A;  4Y52 C;  2VUM A;  3S0X A;  1X31 C;  2A6H A;  3EQL A;  2WAQ L;  3OPF A;  1I3Q C;  2XCR B;  1WOP A;  1Y1W K;  2NVQ C;  1TWF K;  2YU9 K;  1VJE A;  4BBR K;  1ZQ1 C;  4C3I C;  1I3Q K;  1UV7 A;  3BUE A;  3FKI C;  4A93 K;  4G0U A;  3S1N C;  1O24 A;  3T02 A;  3S2D K;  2ZUF A;  2JH3 A;  3CAG A;  3GIR A;  5E68 A;  3VA7 A;  4Y7N C;  3GTP C;  3HOU C;  4QIW L;  4OIP A;  1XXA A;  1EI6 A;  2B63 A;  1ZBS A;  3BP3 A;  2R7Z K;  2R93 K;  2E2H A;  5M5X K;  3GTL A;  3RZO C;  2JA8 K;  1XPP A;  4WJ4 A;  2NVY K;  1F93 A;  2WB1 L;  2D6F C;  1IBA A;  4M1X A;  4AH6 A;  3S1M K;  1K83 K;  1IS1 A;  4A3C K;  1AB4 A;  4LOW A;  2O5J A;  4P5A A;  4WIL A;  1TWF C;  1B4A A;  4Q4Z A; 
#chains in the Genus database with same CATH homology
 3GTJ K;  2CW0 A;  5FJ8 K;  1I6H C;  4XLN A;  5IYC C;  2PA8 D;  3S1R K;  3S2H K;  2JA5 K;  4KMU A;  3GTG C;  2E2J C;  4OIO A;  3GTP K;  4AYB L;  2NVX C;  3M4O K;  3HOZ C;  1Y1V C;  2JA6 K;  3M4O C;  4KN7 A;  4C3J K;  1Y1V K;  1R9T K;  1SFO K;  3GTM K;  4A3G K;  4X6A C;  3PO2 C;  4A3L C;  3GTG K;  2JA5 C;  4A3F C;  5D4D A;  1I6V A;  5TMF A;  3S1R C;  1TWC C;  3S2H C;  1I6H K;  3HKZ L;  4LK1 A;  3GTJ C;  4QIW D;  5FLM K;  3I4N C;  4KN4 A;  2YU9 C;  4A3K C;  2B63 K;  3GTO K;  3CQZ C;  4YFN A;  1TWA C;  4LJZ A;  3K7A K;  1I50 C;  5C4J C;  2E2H K;  3H3V L;  2NVQ K;  5IYD K;  3GTK C;  3WOD A;  3RZD K;  4A3C C;  3HOW K;  4BBS K;  2E2I C;  3H0G C;  3DXJ A;  3S1M C;  4A3E C;  3HKZ D;  4A3M C;  5C4X C;  2A69 A;  4A3E K;  5IYB C;  1TWH K;  4OIQ A;  3HOX K;  3HOV C;  3GTO C;  2VUM C;  1ZYR A;  1WCM C;  3K7A C;  5C4J K;  2NVY C;  1IW7 A;  4BXX K;  4Q5S A;  4QJV B;  3M3Y K;  2JA8 C;  4QJV A;  4OIR A;  5C44 C;  5M3F K;  5FLM C;  4BY1 K;  3I4N K;  3RZO K;  2PA8 L;  4XSX A;  2PMZ L;  1TWC K;  2WAQ D;  4G7Z A;  2R7Z C;  3S14 C;  3PO3 K;  4A3F K;  2R93 C;  4XLP A;  5TMC A;  1YNJ A;  5IP7 K;  4A3L K;  3HOU K;  3PO2 K;  3S1Q C;  2Y0S L;  1SFO C;  4BXX C;  4A3G C;  4JK1 A;  1HQM A;  1R9T C;  4X6A K;  4Y52 C;  4Y7N K;  2VUM K;  2NVX K;  4YG2 A;  2A6H A;  2E2J K;  3EQL A;  1BDF A;  3GTQ K;  2WAQ L;  2PMZ D;  4C3H K;  4A3M K;  3S1N K;  5IYC K;  4A93 C;  4C3I K;  1I3Q C;  1YNN A;  4BBS C;  4BBR C;  3S16 C;  3GTK K;  1Y1W K;  2NVQ C;  3I4M K;  5IYD C;  1TWG C;  2E2H C;  1TWF K;  2NVT K;  3H3V D;  2Y0S D;  2B63 C;  4LK0 A;  2YU9 K;  4OIN A;  4MEX A;  2NVT C;  4A3I K;  1Y1W C;  3I4M C;  3S16 K;  4BBR K;  1I3Q K;  2R92 C;  3FKI C;  4YFX A;  3GTQ C;  4A93 K;  3S1N C;  3HOY C;  4A3B C;  5IP9 C;  3S2D K;  5C3E C;  3GTM C;  2JA6 C;  4Y7N C;  3HOZ K;  1SMY A;  4Y52 K;  3GTP C;  4BY7 K;  3HOU C;  4AYB D;  3S1Q K;  4MQ9 A;  4ZH4 A;  4QIW L;  4OIP A;  5IP7 C;  5M3M K;  4A3J K;  3GTL C;  2R7Z K;  2R93 K;  3PO3 C;  3S14 K;  5M5X K;  3GTL K;  3RZO C;  2A68 A;  2JA8 K;  4A3J C;  5C44 K;  4BY1 C;  3M3Y C;  1XPP A;  3S17 K;  2JA7 C;  4BY7 C;  4A3D K;  4C2M K;  1WCM K;  2NVY K;  3S15 C;  3HOV K;  2A6E A;  2WB1 L;  5C3E K;  5IP9 K;  4G7H A;  3S2D C;  4G7O A;  4A3B K;  3HOX C;  1K83 C;  2PPB A;  3HOY K;  1TWH C;  4YFK A;  5IYB K;  3FKI K;  2O5I A;  5C4X K;  2BE5 A;  3H0G K;  5M5Y K;  2E2I K;  2R92 K;  1K83 K;  3S1M K;  3RZD C;  4A3C K;  3HOW C;  4XSZ A;  1I50 K;  2WB1 D;  4A3I C;  3S15 K;  2O5J A;  4A3D C;  5M5W K;  3CQZ K;  4LLG A;  2JA7 K;  1TWA K;  3S17 C;  4A3K K;  1TWF C;  4GZY A;  1TWG K;  4MEY A;  4Q4Z A;  4NOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...