5C3EK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c3eK00
1R9TC 4Y7NK 4JK1A 1TWFC 2R93K 3HOUK 2A69A 2E2IC 2JA7K 3GTQC 4YG2A 1Y1WK 1TWHK 3GTLC 3I4NK 3GTPC 5TMFA 4BY1K 4G7ZA 3HOXK 3S2HK 5FJ8K 4A3LK 4BBSK 4XSZA 3S14C 3FKIK 4KN7A 3M4OC 3S17C 4A93C 4A3IK 5C3EK 5FLMC 2NVQC 2JA6C 3M3YK 2E2HC 2YU9C 1TWAC 5C44C 2VUMK 3HOZC 5IYCC 3I4MK 1I6HC 5IYDK 3PO2K 4OINA 3GTGK 4G7OA 3HKZD 1XPPA 4A3JC 2NVXK 4A3EK 1I3QC 2JA5K 3RZDC 3H0GC 3CQZK 2CW0A 2WB1L 4BBRK 4A3FK 1TWCC 4Y52K 1WCMK 1TWGC 3S1NC 3K7AC 4C2MK 3HOYC 4G7HA 5M3MK 3S1RC 3GTKC 3S16K 1ZYRA 4A3MK 3S15C 3PO3K 4Y7NC 4BBSC 1K83K 2PPBA 1BDFA 3S1QK 3HOUC 2R93C 2NVYC 5C4JK 2JA7C 1Y1WC 3GTOK 1TWHC 3I4NC 4GZYA 2WAQL 2NVTK 3HOWC 2JA8K 3GTMK 3S2DK 4BXXK 4BY1C 4A3GC 1SFOK 3HOXC 2B63K 3S2HC 5M5YK 2E2JK 4QJVA 4A3LC 5IP9C 4XSXA 3M3YC 1Y1VK 5C4XC 2WB1D 3I4MC 2R92C 5IYDC 2VUMC 4X6AC 1I50K 3PO2C 5IYBC 4Q4ZA 3GTJC 4OIQA 4KN4A 2R7ZC 2NVXC 4BY7K 4AYBL 3S14K 3HOVC 4LJZA 4A3KK 3S17K 4BBRC 4A3BK 5FLMK 4A3DK 1WCMC 3HOZK 1TWAK 4LK1A 5C44K 2A6HA 1I6HK 2A68A 4A3CK 2O5IA 1YNJA 4MEYA 2WAQD 3H3VD 2PMZD 3S1MC 4A3MC 3RZOK 3H3VL 2PMZL 5IP7K 4C3JK 3S1MK 1R9TK 4C3IK 4C3HK 4XLNA 3GTOC 1TWFK 3K7AK 2PA8D 2NVTC 1I6VA 3EQLA 2JA8C 3GTMC 4BXXC 3FKIC 2E2IK 4MQ9A 3S1RK 2PA8L 4NOIA 4QIWD 1SFOC 2B63C 3GTLK 4A3IC 4MEXA 5C3EC 2E2JC 2O5JA 4LLGA 4ZH4A 4QIWL 3GTPK 1SMYA 1IW7A 4OIPA 2NVYK 5TMCA 4AYBD 4YFKA 3GTGC 4OIOA 1Y1VC 3HOWK 4A3EC 2Y0SD 2JA5C 3CQZC 1I50C 4A3GK 3M4OK 4A93K 2Y0SL 4Y52C 4A3FC 2JA6K 2NVQK 1HQMA 4YFXA 4XLPA 5M3FK 2E2HK 5IP9K 5IYCK 2YU9K 4KMUA 4BY7C 2A6EA 4OIRA 3WODA 4A3KC 3PO3C 3S16C 4Q5SA 4QJVB 4A3BC 4A3JK 4A3DC 5C4XK 5D4DA 1I3QK 2BE5A 3RZDK 3H0GK 2R92K 1K83C 3S1QC 4A3CC 4X6AK 5IYBK 3GTQK 5M5WK 1TWCK 4LK0A 5C4JC 3GTJK 1TWGK 3DXJA 4YFNA 2R7ZK 3RZOC 3S1NK 1YNNA 3HKZL 3HOVK 3S2DC 3HOYK 5IP7C 3GTKK 3S15K 5M5XK
chains in the Genus database with same CATH superfamily
1R9TC 4Y7NK 1TWFC 2R93K 4G0WA 4LQYA 1ZQ1C 3GTQC 2P5MA 4BLBA 3OPFA 4KMHA 1F7VA 3IPJA 1IE0A 4WJ3M 3FKIK 4KDDA 3OEPA 1TWAC 5C44C 2VUMK 1WIHA 3PO2K 3GTGK 3H0GA 4A3EK 2JA5K 3CQZK 2ZUEA 4BBRK 4A3FK 4KARA 4C3IC 2GAHC 3GTKA 1EQRA 3A8IA 3S15C 3PO3K 2PPBA 2JA7A 3GIRA 1Y1WC 3LAPA 1INNA 4GZYA 4KB4A 4GTEA 3GTMK 4BXXK 3GEEA 1SFOK 4KMDA 5M5YK 4A3LC 5HL8A 1O26A 1WQFA 3M3YC 5C4XC 2WB1D 1WORA 1XXAA 4OIQA 5IORA 2NVXC 3HOVC 3ADAC 1JVIA 1WCMC 4AH6A 1WQHA 1TWAK 5C44K 2XCRB 4A3CK 3MMLB 2WAQD 3AH5A 3RZOK 2W7VA 2PMZL 5CHPA 3GEIA 1KQ4A 4C3IK 3BP3A 1I6VA 5IOSA 2E2IK 2B63C 1EFWA 4A3IC 5C3EC 2O5JA 4LLGA 4ZH4A 2XCOA 5EGEA 5TMCA 4O2DA 4Y52C 5M3FK 4BY7C 4KMUA 3WODA 4A3BC 4A3JK 5C4XK 1I3QK 3RZDK 3S1QC 1XZQA 2XCQA 1TWCK 3DXJA 3HOVK 4GTAA 3S2DC 3HOYK 1WOSA 4C3JC 1IS1A 4JK1A 2GSOA 4XCHA 3HOUK 2A69A 3GTLA 1TWHK 1F93A 3GTPA 3A8JA 1VH2A 3GSIA 3HOXK 4P5BA 5FJ8K 1F9NA 4XSZA 3T02A 3M4OC 1WSRA 2JA6A 4A93C 4A3IK 2YU9A 5C3EK 2NVQC 2E2HA 3I4MK 5IOQA 3HKZD 1XPPA 4GFQA 3CAGA 3H0GC 1ZXOA 3GTJA 2WB1L 4Y52K 1TWGA 2R7ZA 2V6UA 3LAJA 4P5AA 4G7HA 3GTKC 2RH6A 4A3MK 1O24A 2R93A 1EK8A 4G0VA 3S1QK 1HI9A 3TFIA 3AQOA 2NVYC 2JA7C 3GTOK 5CJ9A 3I4NC 3TFHA 2WAQL 2NVTK 3S2DK 1O28A 4BY1C 3BUEA 2CFAA 3S2HC 2V6TA 4QJVA 4PABA 1J6VA 1USMA 2JH3A 4XSXA 1Y1VK 2VUMA 2R92C 5IYDC 1I50K 3GEHA 4KASA 4G0UA 1F7UA 2JA5A 4KN4A 4LJZA 1IQ0A 3A8KA 4LK1A 2A68A 1B4BA 2O5IA 5EGHA 4MEYA 3H3VD 1DCHA 1GE9A 3G4AA 1O29A 5IP7K 4M1XA 1R9TK 3G4CA 1TWFK 3GTMA 2PA8D 4GTLA 2JA8C 1O2FB 4KATA 1SFOA 4MQ9A 3GTQK 3AQPA 4NOIA 4MEXA 2E2JC 4FM9A 4QIWL 2D6FC 1SMYA 1IW7A 5E68A 2NVYK 4OIPA 2GSNA 2Y3PA 1V5VA 2Y0SL 1HQMA 4C2MC 2A6EA 1X31C 4OIRA 4A3KC 1TWAA 3AD8C 5D4DA 4A3DC 3NUHA 3FOFA 2R92K 1K83C 5M5WK 4LK0A 3AD9C 1VJEA 3HKZL 3HXAA 4KM8A 3S15K 3S1MC 2FQTA 1DCOA 4C3HC 5L46A 3AD7C 2E2IA 4YG2A 1Y1WK 3GTLC 1C0AA 4GTBA 1XZPB 5IOTA 3GTPC 1O2AA 5TMFA 4G7ZA 3SZYA 3SZZA 4A3LK 3S14C 3S17C 2JA6C 4KMAA 1ZBSA 3M3YK 2E2HC 2YU9C 3HOZC 1I6HC 5IYCC 2KWAA 4OINA 1IBAA 1I3QA 2NVXK 1RU0A 3JSTA 1TWCA 3N3YA 1WCMK 1TWGC 3S1NC 2RGRA 4C2MK 2V6SA 5M3MK 1WQGA 1ZYRA 4BBSC 4Y7NC 1K83K 2R93C 1BDFA 4DDQA 1TWHA 4GTCA 1J6WA 3HOWC 2B63K 3LPXA 2VUMC 1J6XA 3GDZA 4LR2A 2PHCB 3PO2C 4Q4ZA 3BP8C 4FZBA 4BY7K 3S14K 2GAGC 3S17K 4BBRC 1O2BA 4A3BK 1WOPA 3HOZK 1JQWA 1I6HK 1USOA 2PMZD 1PJ5A 4C3JK 3N0CA 3GTOA 3QX3A 3L4JA 1ZVUA 3FKIA 3GTMC 4BXXC 1SFOC 1BJTA 3TFJA 3L4KA 3GTGA 4AYBD 1Y1VA 3HOWK 1EI6A 3CQZA 1I50A 4WJ4A 3M4OK 4A93K 3FOEA 2NVQK 1ISEA 4YFXA 1O25A 1G51A 3S16C 1DCPA 3H0GK 4KC6A 4A3CC 4BLAA 5JFEA 4LOWA 4PAAA 5C4JC 1WSVA 1IL2A 3RZOC 1YNNA 3GTKK 1R9TA 2P8TA 5M5XK 4P9SA 1TWFA 3GTQA 2E2IC 2JA7K 3I4NK 2EBBA 2NVYA 4KM9A 4BY1K 4GTFA 3S2HK 4KN7A 5FLMC 5IYDK 1XXBA 2GSUA 4G7OA 1VLOA 4A3JC 2R92A 4ILDA 1I3QC 3RZDC 2CW0A 1TWCC 2ZFZA 3K7AC 3HOYC 4KAWX 3S1RC 3S16K 3HOUC 1Y1WA 5C4JK 1TWHC 3FHZA 2FQOA 5TJ3A 1XZQB 1VRQC 2JA8K 4A3GC 3HOXC 4GTDA 2E2JK 5IP9C 1WOOA 3T00A 1BGWA 3Q3QA 3I4MC 4X6AC 4RMFA 5IYBC 1BS2A 3V4GA 3GTJC 2NVXA 1YCLA 2R7ZC 4AYBL 1PJ7A 4A3KK 1WCMA 3T01A 5FLMK 4A3DK 2A6HA 2ZUFA 1XZPA 1YNJA 3N0BA 1XXCA 4A3MC 1VGXA 1K83A 4BKWA 3H3VL 3TTGA 1UV7A 3S1MK 1JOEA 4GT9A 4C3HK 4XLNA 3GTOC 3K7AK 2NVTC 3EQLA 3ERED 3FKIC 2B63A 3S1RK 2PA8L 4QIWD 3GTLK 5JVOA 4KB2A 3GTPK 1EH1A 4YFKA 3GTGC 4C45A 4OIOA 1Y1VC 4A3EC 2Y0SD 1AB4A 4WILA 2JA5C 3CQZC 1I50C 4A3GK 4A3FC 2JA6K 1PJ6A 3OREA 3VA7A 4XLPA 2E2HK 5IP9K 5IYCK 1DD5A 2YU9K 2CFAB 4J3NA 4Q5SA 3PO3C 4QJVB 2BE5A 4X6AK 3S0XA 1J98A 5IYBK 3GTJK 1TWGK 2R7ZK 4YFNA 3S1NK 1L0WA 5IP7C 1YX2A 1B4AA 1O27A 4BBSK
chains in the Genus database with same CATH topology
1R9TC 4Y7NK 4JK1A 1TWFC 2R93K 3HOUK 2A69A 2E2IC 2JA7K 3GTQC 4YG2A 1Y1WK 1TWHK 3GTLC 3I4NK 3GTPC 5TMFA 4BY1K 4G7ZA 3HOXK 3S2HK 5FJ8K 4A3LK 4BBSK 4XSZA 3S14C 3FKIK 4KN7A 3M4OC 3S17C 4A93C 4A3IK 5C3EK 5FLMC 2NVQC 2JA6C 3M3YK 2E2HC 2YU9C 1TWAC 5C44C 2VUMK 3HOZC 5IYCC 3I4MK 1I6HC 5IYDK 3PO2K 4OINA 3GTGK 4G7OA 3HKZD 1XPPA 4A3JC 2NVXK 4A3EK 1I3QC 2JA5K 3RZDC 3H0GC 3CQZK 2CW0A 2WB1L 4BBRK 4A3FK 1TWCC 4Y52K 1WCMK 1TWGC 3S1NC 3K7AC 4C2MK 3HOYC 4G7HA 5M3MK 3S1RC 3GTKC 3S16K 1ZYRA 4A3MK 3S15C 3PO3K 4Y7NC 4BBSC 1K83K 2PPBA 1BDFA 3S1QK 3HOUC 2R93C 2NVYC 5C4JK 2JA7C 1Y1WC 3GTOK 1TWHC 3I4NC 4GZYA 2WAQL 2NVTK 3HOWC 2JA8K 3GTMK 3S2DK 4BXXK 4BY1C 4A3GC 1SFOK 3HOXC 2B63K 3S2HC 5M5YK 2E2JK 4QJVA 4A3LC 5IP9C 4XSXA 3M3YC 1Y1VK 5C4XC 2WB1D 3I4MC 2R92C 5IYDC 2VUMC 4X6AC 1I50K 3PO2C 5IYBC 4Q4ZA 3GTJC 4OIQA 4KN4A 2R7ZC 2NVXC 4BY7K 4AYBL 3S14K 3HOVC 4LJZA 4A3KK 3S17K 4BBRC 4A3BK 5FLMK 4A3DK 1WCMC 3HOZK 1TWAK 4LK1A 5C44K 2A6HA 1I6HK 2A68A 4A3CK 2O5IA 1YNJA 4MEYA 2WAQD 3H3VD 2PMZD 3S1MC 4A3MC 3RZOK 3H3VL 2PMZL 5IP7K 4C3JK 3S1MK 1R9TK 4C3IK 4C3HK 4XLNA 3GTOC 1TWFK 3K7AK 2PA8D 2NVTC 1I6VA 3EQLA 2JA8C 3GTMC 4BXXC 3FKIC 2E2IK 4MQ9A 3S1RK 2PA8L 4NOIA 4QIWD 1SFOC 2B63C 3GTLK 4A3IC 4MEXA 5C3EC 2E2JC 2O5JA 4LLGA 4ZH4A 4QIWL 3GTPK 1SMYA 1IW7A 4OIPA 2NVYK 5TMCA 4AYBD 4YFKA 3GTGC 4OIOA 1Y1VC 3HOWK 4A3EC 2Y0SD 2JA5C 3CQZC 1I50C 4A3GK 3M4OK 4A93K 2Y0SL 4Y52C 4A3FC 2JA6K 2NVQK 1HQMA 4YFXA 4XLPA 5M3FK 2E2HK 5IP9K 5IYCK 2YU9K 4KMUA 4BY7C 2A6EA 4OIRA 3WODA 4A3KC 3PO3C 3S16C 4Q5SA 4QJVB 4A3BC 4A3JK 4A3DC 5C4XK 5D4DA 1I3QK 2BE5A 3RZDK 3H0GK 2R92K 1K83C 3S1QC 4A3CC 4X6AK 5IYBK 3GTQK 5M5WK 1TWCK 4LK0A 5C4JC 3GTJK 1TWGK 3DXJA 4YFNA 2R7ZK 3RZOC 3S1NK 1YNNA 3HKZL 3HOVK 3S2DC 3HOYK 5IP7C 3GTKK 3S15K 5M5XK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T C;  4Y7N K;  4JK1 A;  1TWF C;  2R93 K;  3HOU K;  2A69 A;  2E2I C;  2JA7 K;  3GTQ C;  4YG2 A;  1Y1W K;  1TWH K;  3GTL C;  3I4N K;  3GTP C;  5TMF A;  4BY1 K;  4G7Z A;  3HOX K;  3S2H K;  5FJ8 K;  4A3L K;  4BBS K;  4XSZ A;  3S14 C;  3FKI K;  4KN7 A;  3M4O C;  3S17 C;  4A93 C;  4A3I K;  5C3E K;  5FLM C;  2NVQ C;  2JA6 C;  3M3Y K;  2E2H C;  2YU9 C;  1TWA C;  5C44 C;  2VUM K;  3HOZ C;  5IYC C;  3I4M K;  1I6H C;  5IYD K;  3PO2 K;  4OIN A;  3GTG K;  4G7O A;  3HKZ D;  1XPP A;  4A3J C;  2NVX K;  4A3E K;  1I3Q C;  2JA5 K;  3RZD C;  3H0G C;  3CQZ K;  2CW0 A;  2WB1 L;  4BBR K;  4A3F K;  1TWC C;  4Y52 K;  1WCM K;  1TWG C;  3S1N C;  3K7A C;  4C2M K;  3HOY C;  4G7H A;  5M3M K;  3S1R C;  3GTK C;  3S16 K;  1ZYR A;  4A3M K;  3S15 C;  3PO3 K;  4Y7N C;  4BBS C;  1K83 K;  2PPB A;  1BDF A;  3S1Q K;  3HOU C;  2R93 C;  2NVY C;  5C4J K;  2JA7 C;  1Y1W C;  3GTO K;  1TWH C;  3I4N C;  4GZY A;  2WAQ L;  2NVT K;  3HOW C;  2JA8 K;  3GTM K;  3S2D K;  4BXX K;  4BY1 C;  4A3G C;  1SFO K;  3HOX C;  2B63 K;  3S2H C;  5M5Y K;  2E2J K;  4QJV A;  4A3L C;  5IP9 C;  4XSX A;  3M3Y C;  1Y1V K;  5C4X C;  2WB1 D;  3I4M C;  2R92 C;  5IYD C;  2VUM C;  4X6A C;  1I50 K;  3PO2 C;  5IYB C;  4Q4Z A;  3GTJ C;  4OIQ A;  4KN4 A;  2R7Z C;  2NVX C;  4BY7 K;  4AYB L;  3S14 K;  3HOV C;  4LJZ A;  4A3K K;  3S17 K;  4BBR C;  4A3B K;  5FLM K;  4A3D K;  1WCM C;  3HOZ K;  1TWA K;  4LK1 A;  5C44 K;  2A6H A;  1I6H K;  2A68 A;  4A3C K;  2O5I A;  1YNJ A;  4MEY A;  2WAQ D;  3H3V D;  2PMZ D;  3S1M C;  4A3M C;  3RZO K;  3H3V L;  2PMZ L;  5IP7 K;  4C3J K;  3S1M K;  1R9T K;  4C3I K;  4C3H K;  4XLN A;  3GTO C;  1TWF K;  3K7A K;  2PA8 D;  2NVT C;  1I6V A;  3EQL A;  2JA8 C;  3GTM C;  4BXX C;  3FKI C;  2E2I K;  4MQ9 A;  3S1R K;  2PA8 L;  4NOI A;  4QIW D;  1SFO C;  2B63 C;  3GTL K;  4A3I C;  4MEX A;  5C3E C;  2E2J C;  2O5J A;  4LLG A;  4ZH4 A;  4QIW L;  3GTP K;  1SMY A;  1IW7 A;  4OIP A;  2NVY K;  5TMC A;  4AYB D;  4YFK A;  3GTG C;  4OIO A;  1Y1V C;  3HOW K;  4A3E C;  2Y0S D;  2JA5 C;  3CQZ C;  1I50 C;  4A3G K;  3M4O K;  4A93 K;  2Y0S L;  4Y52 C;  4A3F C;  2JA6 K;  2NVQ K;  1HQM A;  4YFX A;  4XLP A;  5M3F K;  2E2H K;  5IP9 K;  5IYC K;  2YU9 K;  4KMU A;  4BY7 C;  2A6E A;  4OIR A;  3WOD A;  4A3K C;  3PO3 C;  3S16 C;  4Q5S A;  4QJV B;  4A3B C;  4A3J K;  4A3D C;  5C4X K;  5D4D A;  1I3Q K;  2BE5 A;  3RZD K;  3H0G K;  2R92 K;  1K83 C;  3S1Q C;  4A3C C;  4X6A K;  5IYB K;  3GTQ K;  5M5W K;  1TWC K;  4LK0 A;  5C4J C;  3GTJ K;  1TWG K;  3DXJ A;  4YFN A;  2R7Z K;  3RZO C;  3S1N K;  1YNN A;  3HKZ L;  3HOV K;  3S2D C;  3HOY K;  5IP7 C;  3GTK K;  3S15 K;  5M5X K; 
#chains in the Genus database with same CATH topology
 1R9T C;  4Y7N K;  1TWF C;  2R93 K;  4G0W A;  4LQY A;  1ZQ1 C;  3GTQ C;  2P5M A;  4BLB A;  3OPF A;  4KMH A;  1F7V A;  3IPJ A;  1IE0 A;  4WJ3 M;  3FKI K;  4KDD A;  3OEP A;  1TWA C;  5C44 C;  2VUM K;  1WIH A;  3PO2 K;  3GTG K;  3H0G A;  4A3E K;  2JA5 K;  3CQZ K;  2ZUE A;  4BBR K;  4A3F K;  4KAR A;  4C3I C;  2GAH C;  3GTK A;  1EQR A;  3A8I A;  3S15 C;  3PO3 K;  2PPB A;  2JA7 A;  3GIR A;  1Y1W C;  3LAP A;  1INN A;  4GZY A;  4KB4 A;  4GTE A;  3GTM K;  4BXX K;  3GEE A;  1SFO K;  4KMD A;  5M5Y K;  4A3L C;  5HL8 A;  1O26 A;  1WQF A;  3M3Y C;  5C4X C;  2WB1 D;  1WOR A;  1XXA A;  4OIQ A;  5IOR A;  2NVX C;  3HOV C;  3ADA C;  1JVI A;  1WCM C;  4AH6 A;  1WQH A;  1TWA K;  5C44 K;  2XCR B;  4A3C K;  3MML B;  2WAQ D;  3AH5 A;  3RZO K;  2W7V A;  2PMZ L;  5CHP A;  3GEI A;  1KQ4 A;  4C3I K;  3BP3 A;  1I6V A;  5IOS A;  2E2I K;  2B63 C;  1EFW A;  4A3I C;  5C3E C;  2O5J A;  4LLG A;  4ZH4 A;  2XCO A;  5EGE A;  5TMC A;  4O2D A;  4Y52 C;  5M3F K;  4BY7 C;  4KMU A;  3WOD A;  4A3B C;  4A3J K;  5C4X K;  1I3Q K;  3RZD K;  3S1Q C;  1XZQ A;  2XCQ A;  1TWC K;  3DXJ A;  3HOV K;  4GTA A;  3S2D C;  3HOY K;  1WOS A;  4C3J C;  1IS1 A;  4JK1 A;  2GSO A;  4XCH A;  3HOU K;  2A69 A;  3GTL A;  1TWH K;  1F93 A;  3GTP A;  3A8J A;  1VH2 A;  3GSI A;  3HOX K;  4P5B A;  5FJ8 K;  1F9N A;  4XSZ A;  3T02 A;  3M4O C;  1WSR A;  2JA6 A;  4A93 C;  4A3I K;  2YU9 A;  5C3E K;  2NVQ C;  2E2H A;  3I4M K;  5IOQ A;  3HKZ D;  1XPP A;  4GFQ A;  3CAG A;  3H0G C;  1ZXO A;  3GTJ A;  2WB1 L;  4Y52 K;  1TWG A;  2R7Z A;  2V6U A;  3LAJ A;  4P5A A;  4G7H A;  3GTK C;  2RH6 A;  4A3M K;  1O24 A;  2R93 A;  1EK8 A;  4G0V A;  3S1Q K;  1HI9 A;  3TFI A;  3AQO A;  2NVY C;  2JA7 C;  3GTO K;  5CJ9 A;  3I4N C;  3TFH A;  2WAQ L;  2NVT K;  3S2D K;  1O28 A;  4BY1 C;  3BUE A;  2CFA A;  3S2H C;  2V6T A;  4QJV A;  4PAB A;  1J6V A;  1USM A;  2JH3 A;  4XSX A;  1Y1V K;  2VUM A;  2R92 C;  5IYD C;  1I50 K;  3GEH A;  4KAS A;  4G0U A;  1F7U A;  2JA5 A;  4KN4 A;  4LJZ A;  1IQ0 A;  3A8K A;  4LK1 A;  2A68 A;  1B4B A;  2O5I A;  5EGH A;  4MEY A;  3H3V D;  1DCH A;  1GE9 A;  3G4A A;  1O29 A;  5IP7 K;  4M1X A;  1R9T K;  3G4C A;  1TWF K;  3GTM A;  2PA8 D;  4GTL A;  2JA8 C;  1O2F B;  4KAT A;  1SFO A;  4MQ9 A;  3GTQ K;  3AQP A;  4NOI A;  4MEX A;  2E2J C;  4FM9 A;  4QIW L;  2D6F C;  1SMY A;  1IW7 A;  5E68 A;  2NVY K;  4OIP A;  2GSN A;  2Y3P A;  1V5V A;  2Y0S L;  1HQM A;  4C2M C;  2A6E A;  1X31 C;  4OIR A;  4A3K C;  1TWA A;  3AD8 C;  5D4D A;  4A3D C;  3NUH A;  3FOF A;  2R92 K;  1K83 C;  5M5W K;  4LK0 A;  3AD9 C;  1VJE A;  3HKZ L;  3HXA A;  4KM8 A;  3S15 K;  3S1M C;  2FQT A;  1DCO A;  4C3H C;  5L46 A;  3AD7 C;  2E2I A;  4YG2 A;  1Y1W K;  3GTL C;  1C0A A;  4GTB A;  1XZP B;  5IOT A;  3GTP C;  1O2A A;  5TMF A;  4G7Z A;  3SZY A;  3SZZ A;  4A3L K;  3S14 C;  3S17 C;  2JA6 C;  4KMA A;  1ZBS A;  3M3Y K;  2E2H C;  2YU9 C;  3HOZ C;  1I6H C;  5IYC C;  2KWA A;  4OIN A;  1IBA A;  1I3Q A;  2NVX K;  1RU0 A;  3JST A;  1TWC A;  3N3Y A;  1WCM K;  1TWG C;  3S1N C;  2RGR A;  4C2M K;  2V6S A;  5M3M K;  1WQG A;  1ZYR A;  4BBS C;  4Y7N C;  1K83 K;  2R93 C;  1BDF A;  4DDQ A;  1TWH A;  4GTC A;  1J6W A;  3HOW C;  2B63 K;  3LPX A;  2VUM C;  1J6X A;  3GDZ A;  4LR2 A;  2PHC B;  3PO2 C;  4Q4Z A;  3BP8 C;  4FZB A;  4BY7 K;  3S14 K;  2GAG C;  3S17 K;  4BBR C;  1O2B A;  4A3B K;  1WOP A;  3HOZ K;  1JQW A;  1I6H K;  1USO A;  2PMZ D;  1PJ5 A;  4C3J K;  3N0C A;  3GTO A;  3QX3 A;  3L4J A;  1ZVU A;  3FKI A;  3GTM C;  4BXX C;  1SFO C;  1BJT A;  3TFJ A;  3L4K A;  3GTG A;  4AYB D;  1Y1V A;  3HOW K;  1EI6 A;  3CQZ A;  1I50 A;  4WJ4 A;  3M4O K;  4A93 K;  3FOE A;  2NVQ K;  1ISE A;  4YFX A;  1O25 A;  1G51 A;  3S16 C;  1DCP A;  3H0G K;  4KC6 A;  4A3C C;  4BLA A;  5JFE A;  4LOW A;  4PAA A;  5C4J C;  1WSV A;  1IL2 A;  3RZO C;  1YNN A;  3GTK K;  1R9T A;  2P8T A;  5M5X K;  4P9S A;  1TWF A;  3GTQ A;  2E2I C;  2JA7 K;  3I4N K;  2EBB A;  2NVY A;  4KM9 A;  4BY1 K;  4GTF A;  3S2H K;  4KN7 A;  5FLM C;  5IYD K;  1XXB A;  2GSU A;  4G7O A;  1VLO A;  4A3J C;  2R92 A;  4ILD A;  1I3Q C;  3RZD C;  2CW0 A;  1TWC C;  2ZFZ A;  3K7A C;  3HOY C;  4KAW X;  3S1R C;  3S16 K;  3HOU C;  1Y1W A;  5C4J K;  1TWH C;  3FHZ A;  2FQO A;  5TJ3 A;  1XZQ B;  1VRQ C;  2JA8 K;  4A3G C;  3HOX C;  4GTD A;  2E2J K;  5IP9 C;  1WOO A;  3T00 A;  1BGW A;  3Q3Q A;  3I4M C;  4X6A C;  4RMF A;  5IYB C;  1BS2 A;  3V4G A;  3GTJ C;  2NVX A;  1YCL A;  2R7Z C;  4AYB L;  1PJ7 A;  4A3K K;  1WCM A;  3T01 A;  5FLM K;  4A3D K;  2A6H A;  2ZUF A;  1XZP A;  1YNJ A;  3N0B A;  1XXC A;  4A3M C;  1VGX A;  1K83 A;  4BKW A;  3H3V L;  3TTG A;  1UV7 A;  3S1M K;  1JOE A;  4GT9 A;  4C3H K;  4XLN A;  3GTO C;  3K7A K;  2NVT C;  3EQL A;  3ERE D;  3FKI C;  2B63 A;  3S1R K;  2PA8 L;  4QIW D;  3GTL K;  5JVO A;  4KB2 A;  3GTP K;  1EH1 A;  4YFK A;  3GTG C;  4C45 A;  4OIO A;  1Y1V C;  4A3E C;  2Y0S D;  1AB4 A;  4WIL A;  2JA5 C;  3CQZ C;  1I50 C;  4A3G K;  4A3F C;  2JA6 K;  1PJ6 A;  3ORE A;  3VA7 A;  4XLP A;  2E2H K;  5IP9 K;  5IYC K;  1DD5 A;  2YU9 K;  2CFA B;  4J3N A;  4Q5S A;  3PO3 C;  4QJV B;  2BE5 A;  4X6A K;  3S0X A;  1J98 A;  5IYB K;  3GTJ K;  1TWG K;  2R7Z K;  4YFN A;  3S1N K;  1L0W A;  5IP7 C;  1YX2 A;  1B4A A;  1O27 A;  4BBS K; 
#chains in the Genus database with same CATH homology
 1R9T C;  4Y7N K;  4JK1 A;  1TWF C;  2R93 K;  3HOU K;  2A69 A;  2E2I C;  2JA7 K;  3GTQ C;  4YG2 A;  1Y1W K;  1TWH K;  3GTL C;  3I4N K;  3GTP C;  5TMF A;  4BY1 K;  4G7Z A;  3HOX K;  3S2H K;  5FJ8 K;  4A3L K;  4BBS K;  4XSZ A;  3S14 C;  3FKI K;  4KN7 A;  3M4O C;  3S17 C;  4A93 C;  4A3I K;  5C3E K;  5FLM C;  2NVQ C;  2JA6 C;  3M3Y K;  2E2H C;  2YU9 C;  1TWA C;  5C44 C;  2VUM K;  3HOZ C;  5IYC C;  3I4M K;  1I6H C;  5IYD K;  3PO2 K;  4OIN A;  3GTG K;  4G7O A;  3HKZ D;  1XPP A;  4A3J C;  2NVX K;  4A3E K;  1I3Q C;  2JA5 K;  3RZD C;  3H0G C;  3CQZ K;  2CW0 A;  2WB1 L;  4BBR K;  4A3F K;  1TWC C;  4Y52 K;  1WCM K;  1TWG C;  3S1N C;  3K7A C;  4C2M K;  3HOY C;  4G7H A;  5M3M K;  3S1R C;  3GTK C;  3S16 K;  1ZYR A;  4A3M K;  3S15 C;  3PO3 K;  4Y7N C;  4BBS C;  1K83 K;  2PPB A;  1BDF A;  3S1Q K;  3HOU C;  2R93 C;  2NVY C;  5C4J K;  2JA7 C;  1Y1W C;  3GTO K;  1TWH C;  3I4N C;  4GZY A;  2WAQ L;  2NVT K;  3HOW C;  2JA8 K;  3GTM K;  3S2D K;  4BXX K;  4BY1 C;  4A3G C;  1SFO K;  3HOX C;  2B63 K;  3S2H C;  5M5Y K;  2E2J K;  4QJV A;  4A3L C;  5IP9 C;  4XSX A;  3M3Y C;  1Y1V K;  5C4X C;  2WB1 D;  3I4M C;  2R92 C;  5IYD C;  2VUM C;  4X6A C;  1I50 K;  3PO2 C;  5IYB C;  4Q4Z A;  3GTJ C;  4OIQ A;  4KN4 A;  2R7Z C;  2NVX C;  4BY7 K;  4AYB L;  3S14 K;  3HOV C;  4LJZ A;  4A3K K;  3S17 K;  4BBR C;  4A3B K;  5FLM K;  4A3D K;  1WCM C;  3HOZ K;  1TWA K;  4LK1 A;  5C44 K;  2A6H A;  1I6H K;  2A68 A;  4A3C K;  2O5I A;  1YNJ A;  4MEY A;  2WAQ D;  3H3V D;  2PMZ D;  3S1M C;  4A3M C;  3RZO K;  3H3V L;  2PMZ L;  5IP7 K;  4C3J K;  3S1M K;  1R9T K;  4C3I K;  4C3H K;  4XLN A;  3GTO C;  1TWF K;  3K7A K;  2PA8 D;  2NVT C;  1I6V A;  3EQL A;  2JA8 C;  3GTM C;  4BXX C;  3FKI C;  2E2I K;  4MQ9 A;  3S1R K;  2PA8 L;  4NOI A;  4QIW D;  1SFO C;  2B63 C;  3GTL K;  4A3I C;  4MEX A;  5C3E C;  2E2J C;  2O5J A;  4LLG A;  4ZH4 A;  4QIW L;  3GTP K;  1SMY A;  1IW7 A;  4OIP A;  2NVY K;  5TMC A;  4AYB D;  4YFK A;  3GTG C;  4OIO A;  1Y1V C;  3HOW K;  4A3E C;  2Y0S D;  2JA5 C;  3CQZ C;  1I50 C;  4A3G K;  3M4O K;  4A93 K;  2Y0S L;  4Y52 C;  4A3F C;  2JA6 K;  2NVQ K;  1HQM A;  4YFX A;  4XLP A;  5M3F K;  2E2H K;  5IP9 K;  5IYC K;  2YU9 K;  4KMU A;  4BY7 C;  2A6E A;  4OIR A;  3WOD A;  4A3K C;  3PO3 C;  3S16 C;  4Q5S A;  4QJV B;  4A3B C;  4A3J K;  4A3D C;  5C4X K;  5D4D A;  1I3Q K;  2BE5 A;  3RZD K;  3H0G K;  2R92 K;  1K83 C;  3S1Q C;  4A3C C;  4X6A K;  5IYB K;  3GTQ K;  5M5W K;  1TWC K;  4LK0 A;  5C4J C;  3GTJ K;  1TWG K;  3DXJ A;  4YFN A;  2R7Z K;  3RZO C;  3S1N K;  1YNN A;  3HKZ L;  3HOV K;  3S2D C;  3HOY K;  5IP7 C;  3GTK K;  3S15 K;  5M5X K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...