5C3EK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c3eK00
4AYBL 2PA8L 1Y1VC 4A3KK 1IW7A 4OIPA 5M3FK 1BDFA 1TWGK 1TWFC 2NVYC 4BBRK 2BE5A 2A6HA 4YFXA 1I3QK 2E2HK 4LLGA 3GTQK 4C3IK 3I4MC 2A69A 3RZOC 2JA7C 3K7AC 5IYDK 4A3LK 3S1NC 2JA5C 3S16K 2Y0SD 2E2IC 3S1RK 1ZYRA 1WCMK 5M5WK 4BY7C 3GTKK 5IYBK 2YU9C 1TWAK 4A3DK 3HOZK 4YFNA 4XSXA 3PO3K 3FKIC 4A3CC 3CQZC 3GTGK 3PO2K 4X6AC 5IP9K 4BXXC 2R7ZC 4QJVA 3GTJK 3H0GK 2E2JK 2JA8C 1SMYA 3S1QC 2WAQD 4Y52K 4BY1C 5C4JK 3HOYK 5D4DA 2B63C 3HOWK 1I6HK 3S2HC 2NVQK 4A3IC 2R92K 1I50C 3S15K 4A3JK 1SFOK 3S17C 2PMZL 3HOUC 3HOXC 2WAQL 3S1MK 3DXJA 1TWCC 3M3YC 5C3EK 2R93C 5IP7K 4BBSK 5C4XK 3RZDK 5C44K 4XLPA 3GTOC 3S14C 3S2DK 4G7OA 2NVTC 1Y1WC 4A3BC 4A3MC 4XSZA 4OINA 3M4OK 3GTPK 1K83K 1XPPA 3CQZK 4Y7NK 2O5JA 3I4NC 2VUMK 5FJ8K 5FLMK 4A3EK 3GTLC 2PMZD 4MEXA 4A3KC 5TMCA 4LK0A 1TWGC 4BBRC 4ZH4A 4A93C 5IYDC 4A3FK 1I3QC 2A6EA 4KN7A 2E2HC 2NVXK 5TMFA 2JA6K 3GTQC 4Q5SA 1R9TK 1TWHC 4A3LC 1YNJA 4OIOA 5IYCK 4Q4ZA 3S16C 1Y1VK 1TWFK 2NVYK 5M5XK 1WCMC 3S1RC 3RZOK 3GTKC 5IYBC 5M5YK 1TWAC 3I4MK 3HOZC 4G7ZA 4KN4A 2JA7K 2WB1D 3PO3C 3K7AK 3GTGC 3PO2C 4LK1A 4YG2A 3S1NK 2JA5K 4C3JK 2E2IK 4OIRA 1HQMA 4YFKA 4LJZA 4QJVB 3H0GC 3GTJC 4G7HA 2E2JC 2YU9K 3HOVC 4A3CK 4A3GC 3FKIK 2WB1L 4X6AK 2A68A 4C2MK 5C4JC 3HOYC 3GTMC 4JK1A 4XLNA 2NVQC 2R7ZK 4BXXK 4QIWD 3HKZD 3S15C 4KMUA 1I6VA 4A3JC 1SFOC 2JA8K 4NOIA 3S1QK 5M3MK 4C3HK 4BY1K 3S1MC 2B63K 5C3EC 3S2HK 4A3IK 5IP7C 4BY7K 4BBSC 5C4XC 1I50K 1TWHK 3HKZL 4QIWL 5C44C 3RZDC 3WODA 3H3VL 3S17K 3HOUK 3HOXK 1I6HC 1TWCK 3M4OC 3M3YK 4MEYA 4A3DC 3GTPC 2R93K 3EQLA 4MQ9A 1K83C 3S14K 5IP9C 3GTOK 2PPBA 4Y7NC 2NVTK 2VUMC 4A93K 2Y0SL 5FLMC 4A3EC 1Y1WK 4A3MK 4A3BK 4AYBD 3HOVK 2PA8D 1YNNA 4A3GK 4Y52C 2O5IA 4OIQA 3HOWC 3S2DC 4A3FC 2NVXC 3I4NK 2JA6C 3GTMK 2R92C 1R9TC 4GZYA 3GTLK 2CW0A 3H3VD 5IYCC
chains in the Genus database with same CATH superfamily
1L0WA 3GTLA 2PA8L 2ZFZA 3S0XA 5M3FK 4GT9A 1TWFC 4A93K 1I3QK 5IORA 1ISEA 2JA5C 3QX3A 1WCMK 3A8IA 5M5WK 4G0WA 1VJEA 3OEPA 4XSXA 3PO3K 3FKIC 3G4AA 1XZPB 2JH3A 1DD5A 1F93A 1K83A 3GTJK 4M1XA 1B4AA 1O29A 2JA8C 1SMYA 1UV7A 1ZQ1C 5D4DA 1J98A 3HOWK 3S2HC 2R92K 1I50C 3S17C 4GTEA 3HOUC 5HL8A 3M3YC 5IP7K 1DCHA 1WOSA 3S14C 3GTOC 4G7OA 4KB4A 2JA5A 4A3BC 4A3MC 2XCQA 1XZPA 1XPPA 1PJ7A 2O5JA 3I4NC 5FJ8K 1USMA 2CFAB 4KMDA 4LK0A 4BBRC 4ZH4A 4KN7A 4C3IC 2JA6K 4Q5SA 1TWHC 4A3LC 1R9TA 3BUEA 4Q4ZA 2V6TA 1I50A 2NVYK 5M5XK 5M5YK 1TWAC 1WQGA 3I4MK 4G7ZA 1VH2A 4KN4A 3K7AK 1V5VA 3S1NK 1BGWA 4C3JK 3AD7C 2E2IK 3GTOA 3N0CA 4QJVB 3HOVC 2YU9K 4A3GC 1J6VA 1PJ6A 3A8JA 4G0UA 4X6AK 2A68A 4C2MK 3HOYC 4O2DA 2R7ZK 1EH1A 4KMUA 1SFOC 1WIHA 3S1QK 4C3HK 1IBAA 1USOA 5C3EC 1IQ0A 5C4XC 1O25A 1JVIA 1WSVA 1TWHA 4FZBA 1EQRA 4GTFA 3SZZA 2GSNA 4LR2A 3GTPC 5IP9C 1TWAA 2R93A 3AD8C 2NVTK 2GAHC 5IOQA 5FLMC 1Y1WK 3JSTA 3OREA 4KM9A 1YNNA 4OIQA 4GTDA 4A3FC 1HI9A 5EGHA 4GZYA 1EI6A 3GTLK 2CW0A 2ZUFA 1Y1VC 1IW7A 4OIPA 4KAWX 1SFOA 1VRQC 2A6HA 2E2HK 3RZOC 3GTQK 4LLGA 2V6UA 4LOWA 5IYDK 1IS1A 4DDQA 3MMLB 3S1RK 1ZYRA 1I6HK 4A3DK 3A8KA 4YFNA 4A3CC 3GTGK 4J3NA 3PO2K 3GTPA 4GTBA 1J6XA 4Y52K 4BY1C 5C4JK 2B63C 1RU0A 3G4CA 1O24A 2WAQL 1TWCC 4GTCA 4PAAA 1IL2A 4BBSK 4XLPA 1XXBA 3SZYA 3M4OK 5EGEA 1VLOA 3IPJA 1DCOA 4Y7NK 4GFQA 1ZBSA 4A3EK 2VUMA 1X31C 2PMZD 5IOSA 4A93C 1I3QC 1XZQA 2NVXK 5TMFA 1R9TK 2B63A 4AH6A 3FHZA 3FOFA 1WCMC 1AB4A 1TWFA 2JA7K 3PO3C 1TWCA 4OIRA 4KMHA 5CHPA 4YFKA 3NUHA 4XCHA 3GTJC 4G7HA 4BY7K 1YX2A 2WB1L 1KQ4A 3FKIA 1DCPA 1B4BA 4BXXK 2W7VA 3ADAC 3HKZD 1GE9A 4A3IK 5IP7C 3GEHA 4QIWL 1TWHK 1G51A 1I3QA 3HOXK 4MEYA 2R93K 1WCMA 3EQLA 4MQ9A 3GSIA 3GIRA 1PJ5A 4KMAA 4RMFA 2P8TA 2ZUEA 1WSRA 5JFEA 3HOVK 2GSUA 2PA8D 3AH5A 4A3GK 2O5IA 3GTJA 2JA6C 2CFAA 4KB2A 4AYBL 4A3KK 1BDFA 1TWGK 2NVYC 3L4KA 2BE5A 4YFXA 3S2DK 1WORA 3I4MC 2A69A 3TFJA 4ILDA 3K7AC 3S1NC 4C3JC 3S16K 2Y0SD 2E2IC 2D6FC 4KDDA 5IYBK 2YU9C 3GTKK 3HOZK 3CQZC 4X6AC 5IP9K 4C2MC 1BJTA 1O2AA 2R7ZC 3AQOA 4QJVA 3H0GK 2E2JK 3AD9C 4P9SA 3S1QC 4KARA 4C3HC 2NVQK 3S15K 4A3JK 4WJ3M 2PMZL 4LQYA 3DXJA 3S1MK 2NVYA 3RZDK 5C44K 3FOEA 2NVTC 1Y1WC 2RH6A 2E2IA 1K83K 2YU9A 3CQZA 2VUMK 3T00A 3GTLC 3OPFA 4WILA 5IYDC 2E2HC 2A6EA 1EFWA 3GTQC 3LPXA 4OIOA 5IYCK 2P5MA 1TWFK 3S1RC 1Y1VA 4KATA 3CAGA 1I6HC 4A3DC 1JQWA 3TFIA 3GTGC 3PO2C 4LK1A 4YG2A 1YCLA 2JA5K 4P5BA 4WJ4A 4PABA 1WQHA 1HQMA 1J6WA 3FKIK 3T02A 5C4JC 3GTMC 1EK8A 3BP8C 3LAPA 1WOPA 2Y3PA 2JA8K 1INNA 3ERED 3V4GA 4G0VA 3S2HK 4BBSC 2E2HA 1I50K 3GTQA 2GSOA 3S17K 5TJ3A 3HOUK 3M4OC 3M3YK 3S14K 3GTOK 4Y7NC 1O26A 4BLBA 1XXCA 2Y0SL 3GTGA 4A3EC 4A3BK 4A3MK 1XXAA 3HOWC 4KC6A 2NVXC 3I4NK 1O2BA 2R92C 1R9TC 3H3VD 3GTMA 4C45A 4KM8A 4BBRK 5JVOA 4C3IK 2JA7C 4BLAA 2RGRA 4A3LK 2XCOA 1O27A 4GTLA 4BY7C 1TWAK 2PHCB 2EBBA 4BXXC 1C0AA 1O2FB 3VA7A 2WAQD 3HOYK 3LAJA 5CJ9A 4A3IC 3TFHA 5IOTA 1JOEA 3GDZA 2NVXA 1SFOK 1BS2A 2R92A 3HOXC 5C3EK 2R93C 4FM9A 5C4XK 2JA7A 3L4JA 4OINA 4XSZA 2V6SA 3GTPK 1WQFA 3CQZK 1VGXA 4GTAA 5FLMK 3T01A 4MEXA 4A3KC 1ZVUA 5TMCA 1TWGC 3AQPA 4A3FK 3S2DC 5L46A 4P5AA 2JA6A 1YNJA 3S16C 1Y1VK 4BKWA 3RZOK 2KWAA 5IYBC 3GTKC 3HOZC 2WB1D 2FQOA 3N0BA 3TTGA 4LJZA 3H0GC 2E2JC 4A3CK 3BP3A 4JK1A 4XLNA 1F7VA 2NVQC 4QIWD 3S15C 1I6VA 2GAGC 4A3JC 2R7ZA 4NOIA 1WOOA 1ZXOA 5M3MK 4BY1K 3S1MC 2B63K 1F9NA 4KASA 1TWGA 1F7UA 3Q3QA 3HKZL 3RZDC 5C44C 3WODA 3H3VL 2XCRB 5E68A 3HXAA 1TWCK 1O28A 3GEIA 1K83C 3GTKA 2PPBA 2VUMC 3N3YA 3GEEA 4AYBD 1Y1WA 4Y52C 3H0GA 1XZQB 3GTMK 1IE0A 2FQTA 5IYCC
chains in the Genus database with same CATH topology
4AYBL 2PA8L 1Y1VC 4A3KK 1IW7A 4OIPA 5M3FK 1BDFA 1TWGK 1TWFC 2NVYC 4BBRK 2BE5A 2A6HA 4YFXA 1I3QK 2E2HK 4LLGA 3GTQK 4C3IK 3I4MC 2A69A 3RZOC 2JA7C 3K7AC 5IYDK 4A3LK 3S1NC 2JA5C 3S16K 2Y0SD 2E2IC 3S1RK 1ZYRA 1WCMK 5M5WK 4BY7C 3GTKK 5IYBK 2YU9C 1TWAK 4A3DK 3HOZK 4YFNA 4XSXA 3PO3K 3FKIC 4A3CC 3CQZC 3GTGK 3PO2K 4X6AC 5IP9K 4BXXC 2R7ZC 4QJVA 3GTJK 3H0GK 2E2JK 2JA8C 1SMYA 3S1QC 2WAQD 4Y52K 4BY1C 5C4JK 3HOYK 5D4DA 2B63C 3HOWK 1I6HK 3S2HC 2NVQK 4A3IC 2R92K 1I50C 3S15K 4A3JK 1SFOK 3S17C 2PMZL 3HOUC 3HOXC 2WAQL 3S1MK 3DXJA 1TWCC 3M3YC 5C3EK 2R93C 5IP7K 4BBSK 5C4XK 3RZDK 5C44K 4XLPA 3GTOC 3S14C 3S2DK 4G7OA 2NVTC 1Y1WC 4A3BC 4A3MC 4XSZA 4OINA 3M4OK 3GTPK 1K83K 1XPPA 3CQZK 4Y7NK 2O5JA 3I4NC 2VUMK 5FJ8K 5FLMK 4A3EK 3GTLC 2PMZD 4MEXA 4A3KC 5TMCA 4LK0A 1TWGC 4BBRC 4ZH4A 4A93C 5IYDC 4A3FK 1I3QC 2A6EA 4KN7A 2E2HC 2NVXK 5TMFA 2JA6K 3GTQC 4Q5SA 1R9TK 1TWHC 4A3LC 1YNJA 4OIOA 5IYCK 4Q4ZA 3S16C 1Y1VK 1TWFK 2NVYK 5M5XK 1WCMC 3S1RC 3RZOK 3GTKC 5IYBC 5M5YK 1TWAC 3I4MK 3HOZC 4G7ZA 4KN4A 2JA7K 2WB1D 3PO3C 3K7AK 3GTGC 3PO2C 4LK1A 4YG2A 3S1NK 2JA5K 4C3JK 2E2IK 4OIRA 1HQMA 4YFKA 4LJZA 4QJVB 3H0GC 3GTJC 4G7HA 2E2JC 2YU9K 3HOVC 4A3CK 4A3GC 3FKIK 2WB1L 4X6AK 2A68A 4C2MK 5C4JC 3HOYC 3GTMC 4JK1A 4XLNA 2NVQC 2R7ZK 4BXXK 4QIWD 3HKZD 3S15C 4KMUA 1I6VA 4A3JC 1SFOC 2JA8K 4NOIA 3S1QK 5M3MK 4C3HK 4BY1K 3S1MC 2B63K 5C3EC 3S2HK 4A3IK 5IP7C 4BY7K 4BBSC 5C4XC 1I50K 1TWHK 3HKZL 4QIWL 5C44C 3RZDC 3WODA 3H3VL 3S17K 3HOUK 3HOXK 1I6HC 1TWCK 3M4OC 3M3YK 4MEYA 4A3DC 3GTPC 2R93K 3EQLA 4MQ9A 1K83C 3S14K 5IP9C 3GTOK 2PPBA 4Y7NC 2NVTK 2VUMC 4A93K 2Y0SL 5FLMC 4A3EC 1Y1WK 4A3MK 4A3BK 4AYBD 3HOVK 2PA8D 1YNNA 4A3GK 4Y52C 2O5IA 4OIQA 3HOWC 3S2DC 4A3FC 2NVXC 3I4NK 2JA6C 3GTMK 2R92C 1R9TC 4GZYA 3GTLK 2CW0A 3H3VD 5IYCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB L;  2PA8 L;  1Y1V C;  4A3K K;  1IW7 A;  4OIP A;  5M3F K;  1BDF A;  1TWG K;  1TWF C;  2NVY C;  4BBR K;  2BE5 A;  2A6H A;  4YFX A;  1I3Q K;  2E2H K;  4LLG A;  3GTQ K;  4C3I K;  3I4M C;  2A69 A;  3RZO C;  2JA7 C;  3K7A C;  5IYD K;  4A3L K;  3S1N C;  2JA5 C;  3S16 K;  2Y0S D;  2E2I C;  3S1R K;  1ZYR A;  1WCM K;  5M5W K;  4BY7 C;  3GTK K;  5IYB K;  2YU9 C;  1TWA K;  4A3D K;  3HOZ K;  4YFN A;  4XSX A;  3PO3 K;  3FKI C;  4A3C C;  3CQZ C;  3GTG K;  3PO2 K;  4X6A C;  5IP9 K;  4BXX C;  2R7Z C;  4QJV A;  3GTJ K;  3H0G K;  2E2J K;  2JA8 C;  1SMY A;  3S1Q C;  2WAQ D;  4Y52 K;  4BY1 C;  5C4J K;  3HOY K;  5D4D A;  2B63 C;  3HOW K;  1I6H K;  3S2H C;  2NVQ K;  4A3I C;  2R92 K;  1I50 C;  3S15 K;  4A3J K;  1SFO K;  3S17 C;  2PMZ L;  3HOU C;  3HOX C;  2WAQ L;  3S1M K;  3DXJ A;  1TWC C;  3M3Y C;  5C3E K;  2R93 C;  5IP7 K;  4BBS K;  5C4X K;  3RZD K;  5C44 K;  4XLP A;  3GTO C;  3S14 C;  3S2D K;  4G7O A;  2NVT C;  1Y1W C;  4A3B C;  4A3M C;  4XSZ A;  4OIN A;  3M4O K;  3GTP K;  1K83 K;  1XPP A;  3CQZ K;  4Y7N K;  2O5J A;  3I4N C;  2VUM K;  5FJ8 K;  5FLM K;  4A3E K;  3GTL C;  2PMZ D;  4MEX A;  4A3K C;  5TMC A;  4LK0 A;  1TWG C;  4BBR C;  4ZH4 A;  4A93 C;  5IYD C;  4A3F K;  1I3Q C;  2A6E A;  4KN7 A;  2E2H C;  2NVX K;  5TMF A;  2JA6 K;  3GTQ C;  4Q5S A;  1R9T K;  1TWH C;  4A3L C;  1YNJ A;  4OIO A;  5IYC K;  4Q4Z A;  3S16 C;  1Y1V K;  1TWF K;  2NVY K;  5M5X K;  1WCM C;  3S1R C;  3RZO K;  3GTK C;  5IYB C;  5M5Y K;  1TWA C;  3I4M K;  3HOZ C;  4G7Z A;  4KN4 A;  2JA7 K;  2WB1 D;  3PO3 C;  3K7A K;  3GTG C;  3PO2 C;  4LK1 A;  4YG2 A;  3S1N K;  2JA5 K;  4C3J K;  2E2I K;  4OIR A;  1HQM A;  4YFK A;  4LJZ A;  4QJV B;  3H0G C;  3GTJ C;  4G7H A;  2E2J C;  2YU9 K;  3HOV C;  4A3C K;  4A3G C;  3FKI K;  2WB1 L;  4X6A K;  2A68 A;  4C2M K;  5C4J C;  3HOY C;  3GTM C;  4JK1 A;  4XLN A;  2NVQ C;  2R7Z K;  4BXX K;  4QIW D;  3HKZ D;  3S15 C;  4KMU A;  1I6V A;  4A3J C;  1SFO C;  2JA8 K;  4NOI A;  3S1Q K;  5M3M K;  4C3H K;  4BY1 K;  3S1M C;  2B63 K;  5C3E C;  3S2H K;  4A3I K;  5IP7 C;  4BY7 K;  4BBS C;  5C4X C;  1I50 K;  1TWH K;  3HKZ L;  4QIW L;  5C44 C;  3RZD C;  3WOD A;  3H3V L;  3S17 K;  3HOU K;  3HOX K;  1I6H C;  1TWC K;  3M4O C;  3M3Y K;  4MEY A;  4A3D C;  3GTP C;  2R93 K;  3EQL A;  4MQ9 A;  1K83 C;  3S14 K;  5IP9 C;  3GTO K;  2PPB A;  4Y7N C;  2NVT K;  2VUM C;  4A93 K;  2Y0S L;  5FLM C;  4A3E C;  1Y1W K;  4A3M K;  4A3B K;  4AYB D;  3HOV K;  2PA8 D;  1YNN A;  4A3G K;  4Y52 C;  2O5I A;  4OIQ A;  3HOW C;  3S2D C;  4A3F C;  2NVX C;  3I4N K;  2JA6 C;  3GTM K;  2R92 C;  1R9T C;  4GZY A;  3GTL K;  2CW0 A;  3H3V D;  5IYC C; 
#chains in the Genus database with same CATH topology
 1L0W A;  3GTL A;  2PA8 L;  2ZFZ A;  3S0X A;  5M3F K;  4GT9 A;  1TWF C;  4A93 K;  1I3Q K;  5IOR A;  1ISE A;  2JA5 C;  3QX3 A;  1WCM K;  3A8I A;  5M5W K;  4G0W A;  1VJE A;  3OEP A;  4XSX A;  3PO3 K;  3FKI C;  3G4A A;  1XZP B;  2JH3 A;  1DD5 A;  1F93 A;  1K83 A;  3GTJ K;  4M1X A;  1B4A A;  1O29 A;  2JA8 C;  1SMY A;  1UV7 A;  1ZQ1 C;  5D4D A;  1J98 A;  3HOW K;  3S2H C;  2R92 K;  1I50 C;  3S17 C;  4GTE A;  3HOU C;  5HL8 A;  3M3Y C;  5IP7 K;  1DCH A;  1WOS A;  3S14 C;  3GTO C;  4G7O A;  4KB4 A;  2JA5 A;  4A3B C;  4A3M C;  2XCQ A;  1XZP A;  1XPP A;  1PJ7 A;  2O5J A;  3I4N C;  5FJ8 K;  1USM A;  2CFA B;  4KMD A;  4LK0 A;  4BBR C;  4ZH4 A;  4KN7 A;  4C3I C;  2JA6 K;  4Q5S A;  1TWH C;  4A3L C;  1R9T A;  3BUE A;  4Q4Z A;  2V6T A;  1I50 A;  2NVY K;  5M5X K;  5M5Y K;  1TWA C;  1WQG A;  3I4M K;  4G7Z A;  1VH2 A;  4KN4 A;  3K7A K;  1V5V A;  3S1N K;  1BGW A;  4C3J K;  3AD7 C;  2E2I K;  3GTO A;  3N0C A;  4QJV B;  3HOV C;  2YU9 K;  4A3G C;  1J6V A;  1PJ6 A;  3A8J A;  4G0U A;  4X6A K;  2A68 A;  4C2M K;  3HOY C;  4O2D A;  2R7Z K;  1EH1 A;  4KMU A;  1SFO C;  1WIH A;  3S1Q K;  4C3H K;  1IBA A;  1USO A;  5C3E C;  1IQ0 A;  5C4X C;  1O25 A;  1JVI A;  1WSV A;  1TWH A;  4FZB A;  1EQR A;  4GTF A;  3SZZ A;  2GSN A;  4LR2 A;  3GTP C;  5IP9 C;  1TWA A;  2R93 A;  3AD8 C;  2NVT K;  2GAH C;  5IOQ A;  5FLM C;  1Y1W K;  3JST A;  3ORE A;  4KM9 A;  1YNN A;  4OIQ A;  4GTD A;  4A3F C;  1HI9 A;  5EGH A;  4GZY A;  1EI6 A;  3GTL K;  2CW0 A;  2ZUF A;  1Y1V C;  1IW7 A;  4OIP A;  4KAW X;  1SFO A;  1VRQ C;  2A6H A;  2E2H K;  3RZO C;  3GTQ K;  4LLG A;  2V6U A;  4LOW A;  5IYD K;  1IS1 A;  4DDQ A;  3MML B;  3S1R K;  1ZYR A;  1I6H K;  4A3D K;  3A8K A;  4YFN A;  4A3C C;  3GTG K;  4J3N A;  3PO2 K;  3GTP A;  4GTB A;  1J6X A;  4Y52 K;  4BY1 C;  5C4J K;  2B63 C;  1RU0 A;  3G4C A;  1O24 A;  2WAQ L;  1TWC C;  4GTC A;  4PAA A;  1IL2 A;  4BBS K;  4XLP A;  1XXB A;  3SZY A;  3M4O K;  5EGE A;  1VLO A;  3IPJ A;  1DCO A;  4Y7N K;  4GFQ A;  1ZBS A;  4A3E K;  2VUM A;  1X31 C;  2PMZ D;  5IOS A;  4A93 C;  1I3Q C;  1XZQ A;  2NVX K;  5TMF A;  1R9T K;  2B63 A;  4AH6 A;  3FHZ A;  3FOF A;  1WCM C;  1AB4 A;  1TWF A;  2JA7 K;  3PO3 C;  1TWC A;  4OIR A;  4KMH A;  5CHP A;  4YFK A;  3NUH A;  4XCH A;  3GTJ C;  4G7H A;  4BY7 K;  1YX2 A;  2WB1 L;  1KQ4 A;  3FKI A;  1DCP A;  1B4B A;  4BXX K;  2W7V A;  3ADA C;  3HKZ D;  1GE9 A;  4A3I K;  5IP7 C;  3GEH A;  4QIW L;  1TWH K;  1G51 A;  1I3Q A;  3HOX K;  4MEY A;  2R93 K;  1WCM A;  3EQL A;  4MQ9 A;  3GSI A;  3GIR A;  1PJ5 A;  4KMA A;  4RMF A;  2P8T A;  2ZUE A;  1WSR A;  5JFE A;  3HOV K;  2GSU A;  2PA8 D;  3AH5 A;  4A3G K;  2O5I A;  3GTJ A;  2JA6 C;  2CFA A;  4KB2 A;  4AYB L;  4A3K K;  1BDF A;  1TWG K;  2NVY C;  3L4K A;  2BE5 A;  4YFX A;  3S2D K;  1WOR A;  3I4M C;  2A69 A;  3TFJ A;  4ILD A;  3K7A C;  3S1N C;  4C3J C;  3S16 K;  2Y0S D;  2E2I C;  2D6F C;  4KDD A;  5IYB K;  2YU9 C;  3GTK K;  3HOZ K;  3CQZ C;  4X6A C;  5IP9 K;  4C2M C;  1BJT A;  1O2A A;  2R7Z C;  3AQO A;  4QJV A;  3H0G K;  2E2J K;  3AD9 C;  4P9S A;  3S1Q C;  4KAR A;  4C3H C;  2NVQ K;  3S15 K;  4A3J K;  4WJ3 M;  2PMZ L;  4LQY A;  3DXJ A;  3S1M K;  2NVY A;  3RZD K;  5C44 K;  3FOE A;  2NVT C;  1Y1W C;  2RH6 A;  2E2I A;  1K83 K;  2YU9 A;  3CQZ A;  2VUM K;  3T00 A;  3GTL C;  3OPF A;  4WIL A;  5IYD C;  2E2H C;  2A6E A;  1EFW A;  3GTQ C;  3LPX A;  4OIO A;  5IYC K;  2P5M A;  1TWF K;  3S1R C;  1Y1V A;  4KAT A;  3CAG A;  1I6H C;  4A3D C;  1JQW A;  3TFI A;  3GTG C;  3PO2 C;  4LK1 A;  4YG2 A;  1YCL A;  2JA5 K;  4P5B A;  4WJ4 A;  4PAB A;  1WQH A;  1HQM A;  1J6W A;  3FKI K;  3T02 A;  5C4J C;  3GTM C;  1EK8 A;  3BP8 C;  3LAP A;  1WOP A;  2Y3P A;  2JA8 K;  1INN A;  3ERE D;  3V4G A;  4G0V A;  3S2H K;  4BBS C;  2E2H A;  1I50 K;  3GTQ A;  2GSO A;  3S17 K;  5TJ3 A;  3HOU K;  3M4O C;  3M3Y K;  3S14 K;  3GTO K;  4Y7N C;  1O26 A;  4BLB A;  1XXC A;  2Y0S L;  3GTG A;  4A3E C;  4A3B K;  4A3M K;  1XXA A;  3HOW C;  4KC6 A;  2NVX C;  3I4N K;  1O2B A;  2R92 C;  1R9T C;  3H3V D;  3GTM A;  4C45 A;  4KM8 A;  4BBR K;  5JVO A;  4C3I K;  2JA7 C;  4BLA A;  2RGR A;  4A3L K;  2XCO A;  1O27 A;  4GTL A;  4BY7 C;  1TWA K;  2PHC B;  2EBB A;  4BXX C;  1C0A A;  1O2F B;  3VA7 A;  2WAQ D;  3HOY K;  3LAJ A;  5CJ9 A;  4A3I C;  3TFH A;  5IOT A;  1JOE A;  3GDZ A;  2NVX A;  1SFO K;  1BS2 A;  2R92 A;  3HOX C;  5C3E K;  2R93 C;  4FM9 A;  5C4X K;  2JA7 A;  3L4J A;  4OIN A;  4XSZ A;  2V6S A;  3GTP K;  1WQF A;  3CQZ K;  1VGX A;  4GTA A;  5FLM K;  3T01 A;  4MEX A;  4A3K C;  1ZVU A;  5TMC A;  1TWG C;  3AQP A;  4A3F K;  3S2D C;  5L46 A;  4P5A A;  2JA6 A;  1YNJ A;  3S16 C;  1Y1V K;  4BKW A;  3RZO K;  2KWA A;  5IYB C;  3GTK C;  3HOZ C;  2WB1 D;  2FQO A;  3N0B A;  3TTG A;  4LJZ A;  3H0G C;  2E2J C;  4A3C K;  3BP3 A;  4JK1 A;  4XLN A;  1F7V A;  2NVQ C;  4QIW D;  3S15 C;  1I6V A;  2GAG C;  4A3J C;  2R7Z A;  4NOI A;  1WOO A;  1ZXO A;  5M3M K;  4BY1 K;  3S1M C;  2B63 K;  1F9N A;  4KAS A;  1TWG A;  1F7U A;  3Q3Q A;  3HKZ L;  3RZD C;  5C44 C;  3WOD A;  3H3V L;  2XCR B;  5E68 A;  3HXA A;  1TWC K;  1O28 A;  3GEI A;  1K83 C;  3GTK A;  2PPB A;  2VUM C;  3N3Y A;  3GEE A;  4AYB D;  1Y1W A;  4Y52 C;  3H0G A;  1XZQ B;  3GTM K;  1IE0 A;  2FQT A;  5IYC C; 
#chains in the Genus database with same CATH homology
 4AYB L;  2PA8 L;  1Y1V C;  4A3K K;  1IW7 A;  4OIP A;  5M3F K;  1BDF A;  1TWG K;  1TWF C;  2NVY C;  4BBR K;  2BE5 A;  2A6H A;  4YFX A;  1I3Q K;  2E2H K;  4LLG A;  3GTQ K;  4C3I K;  3I4M C;  2A69 A;  3RZO C;  2JA7 C;  3K7A C;  5IYD K;  4A3L K;  3S1N C;  2JA5 C;  3S16 K;  2Y0S D;  2E2I C;  3S1R K;  1ZYR A;  1WCM K;  5M5W K;  4BY7 C;  3GTK K;  5IYB K;  2YU9 C;  1TWA K;  4A3D K;  3HOZ K;  4YFN A;  4XSX A;  3PO3 K;  3FKI C;  4A3C C;  3CQZ C;  3GTG K;  3PO2 K;  4X6A C;  5IP9 K;  4BXX C;  2R7Z C;  4QJV A;  3GTJ K;  3H0G K;  2E2J K;  2JA8 C;  1SMY A;  3S1Q C;  2WAQ D;  4Y52 K;  4BY1 C;  5C4J K;  3HOY K;  5D4D A;  2B63 C;  3HOW K;  1I6H K;  3S2H C;  2NVQ K;  4A3I C;  2R92 K;  1I50 C;  3S15 K;  4A3J K;  1SFO K;  3S17 C;  2PMZ L;  3HOU C;  3HOX C;  2WAQ L;  3S1M K;  3DXJ A;  1TWC C;  3M3Y C;  5C3E K;  2R93 C;  5IP7 K;  4BBS K;  5C4X K;  3RZD K;  5C44 K;  4XLP A;  3GTO C;  3S14 C;  3S2D K;  4G7O A;  2NVT C;  1Y1W C;  4A3B C;  4A3M C;  4XSZ A;  4OIN A;  3M4O K;  3GTP K;  1K83 K;  1XPP A;  3CQZ K;  4Y7N K;  2O5J A;  3I4N C;  2VUM K;  5FJ8 K;  5FLM K;  4A3E K;  3GTL C;  2PMZ D;  4MEX A;  4A3K C;  5TMC A;  4LK0 A;  1TWG C;  4BBR C;  4ZH4 A;  4A93 C;  5IYD C;  4A3F K;  1I3Q C;  2A6E A;  4KN7 A;  2E2H C;  2NVX K;  5TMF A;  2JA6 K;  3GTQ C;  4Q5S A;  1R9T K;  1TWH C;  4A3L C;  1YNJ A;  4OIO A;  5IYC K;  4Q4Z A;  3S16 C;  1Y1V K;  1TWF K;  2NVY K;  5M5X K;  1WCM C;  3S1R C;  3RZO K;  3GTK C;  5IYB C;  5M5Y K;  1TWA C;  3I4M K;  3HOZ C;  4G7Z A;  4KN4 A;  2JA7 K;  2WB1 D;  3PO3 C;  3K7A K;  3GTG C;  3PO2 C;  4LK1 A;  4YG2 A;  3S1N K;  2JA5 K;  4C3J K;  2E2I K;  4OIR A;  1HQM A;  4YFK A;  4LJZ A;  4QJV B;  3H0G C;  3GTJ C;  4G7H A;  2E2J C;  2YU9 K;  3HOV C;  4A3C K;  4A3G C;  3FKI K;  2WB1 L;  4X6A K;  2A68 A;  4C2M K;  5C4J C;  3HOY C;  3GTM C;  4JK1 A;  4XLN A;  2NVQ C;  2R7Z K;  4BXX K;  4QIW D;  3HKZ D;  3S15 C;  4KMU A;  1I6V A;  4A3J C;  1SFO C;  2JA8 K;  4NOI A;  3S1Q K;  5M3M K;  4C3H K;  4BY1 K;  3S1M C;  2B63 K;  5C3E C;  3S2H K;  4A3I K;  5IP7 C;  4BY7 K;  4BBS C;  5C4X C;  1I50 K;  1TWH K;  3HKZ L;  4QIW L;  5C44 C;  3RZD C;  3WOD A;  3H3V L;  3S17 K;  3HOU K;  3HOX K;  1I6H C;  1TWC K;  3M4O C;  3M3Y K;  4MEY A;  4A3D C;  3GTP C;  2R93 K;  3EQL A;  4MQ9 A;  1K83 C;  3S14 K;  5IP9 C;  3GTO K;  2PPB A;  4Y7N C;  2NVT K;  2VUM C;  4A93 K;  2Y0S L;  5FLM C;  4A3E C;  1Y1W K;  4A3M K;  4A3B K;  4AYB D;  3HOV K;  2PA8 D;  1YNN A;  4A3G K;  4Y52 C;  2O5I A;  4OIQ A;  3HOW C;  3S2D C;  4A3F C;  2NVX C;  3I4N K;  2JA6 C;  3GTM K;  2R92 C;  1R9T C;  4GZY A;  3GTL K;  2CW0 A;  3H3V D;  5IYC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...