1UKFA

Crystal structure of pseudomonas avirulence protein avrpphb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
SLSDFSVASRDVNHNNICAGLSTEWLVMSSDGDAESRMDHLDYNGEGQSRGSERHQVYNDALRAALSNDDEAPFFTASTAVIEDAGFSLRREPKTVHASGGSAQLGQTVAHDVAQSGRKHLLSLRFANVQGHAIACSCEGSQFKLFDPNLGEFQSSRSAAPQLIKGLIDHYNSLNYDVACVNEFRVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Avirulence protein AVRPPH3
publication title The crystal structure of Pseudomonas avirulence protein AvrPphB: a papain-like fold with a distinct substrate-binding site.
pubmed doi rcsb
source organism Pseudomonas syringae pv. phaseolicola
total genus 68
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.20 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1ukfA00
1UKFA
chains in the Genus database with same CATH superfamily
3BY4A 1KHPA 1U9VA 1PXVA 2FUDA 5J94A 2B1NA 1MDWA 3BPMA 4CZWA 2FRAA 1PPDA 2G6DA 5CVNB 2AYOA 1F29A 2NQIA 3O1GA 3S3QA 7PCKA 4W5BA 3V6EA 1STFE 1BY8A 2FYEA 1BGOA 1MEMA 4BQVA 4BS6A 1YALA 1NB5A 3USVA 1GECE 2AYNA 3MTVA 4D8BA 3OQCA 2B1MA 1BP4A 2Z84A 3CH3X 2IBIA 2FE8A 1KFXL 1AU3A 3IFUA 4FJCA 5EZSA 1ME3A 2DCAA 2YJ9A 3KWBX 2J7QC 5JA7A 1TL9A 4PP1A 2G8JA 2Y5BA 3H8CA 3K8UA 3KW9A 5CHTA 5F02A 2BDZA 1MHWA 3OF9A 2ATOA 2CIOA 3CH2X 3PNRA 3HD3A 3P5WA 1EWMA 1F2AA 1YK7A 4OEMA 4REZA 1K3BB 4K7CA 4QBBA 3MORA 1PPOA 3BBAA 3KFQA 1KHQA 4DMXA 2E02A 3LXSA 1U9WA 1PCIA 1AYUA 4CDEB 2E01A 3E9SA 3P5XA 3B21A 1GCBA 2P0RA 3KSEA 4QH6A 2FT2A 4OELA 3C9EA 1PVJA 1Q6KA 1EWPA 3IHPA 4BOPA 3MHHA 3P5UA 2JTCA 4BOQA 4HWYA 1MEGA 1PE6A 1EWLA 3M99A 4X6HA 3H8BA 2FRQA 3I3TA 2DJFB 2DCBA 2HWKA 3H7DA 2BDLA 1AYWA 4RF0A 3F5VA 1YVBA 4XUIA 1CTEA 3QJ3A 1CPJA 4YYVA 4QRGA 3IV2A 3PHUA 2Y6EA 4PT5A 3K24A 1NB3A 1Y4HA 4I05A 1VJVA 2JQGR 3IEJA 3CBJA 1CQDA 4AXLA 4YV8A 3K9MA 4I04A 3QT4A 2YJ2A 3N3GA 3OVZA 2AUXA 4YYWA 3H6SA 3U8EA 2GHUA 3BWKA 4RNAA 3MP2A 4QRXA 3PRMA 2H7JA 4R3DA 4CDDB 1PPNA 2OULA 1MS6A 4RKXA 1XKGA 1IWDA 3PRPA 2XU4A 4YYUA 1BQIA 3AI8A 5JH3A 4MZSA 1NL6A 4BSQA 2IPPB 1QXPA 3TMPA 4P6GA 5CVOB 2PBHA 3DF0A 3PHWA 1SNKA 1ZCMA 1U5IA 4PP2E 3IOQA 2HHNA 3LFYA 2CB5A 2G8EA 2NQGA 3PBHA 4OW0A 2HXZA 2G7YA 2XU5A 4YYRA 3PW3A 2C0YA 4FK5A 4YYQA 1VSNA 3MJ5A 4A5UA 2R6NA 4X6IA 1CSBB 2DC6A 3HHAA 2DZYA 3HWNA 4MI7A 1YZBA 3PDFA 1S4VA 3KKUA 1AU2A 3PSEA 1ME4A 2BTWB 4KLBA 2DJGB 3GCBA 2FQ9A 4IUMA 1U9QX 4PI3A 4W5CA 1TLOA 1TU6A 4BS5A 2DZZA 1AU4A 1POPA 2FO5A 1ATKA 2XU3A 4BOUA 4IP3A 6PADA 5E6JA 1CJLA 1UKFA 4N4ZA 4RY2A 1PADA 3W31A 4YVAA 2YJBA 2R9MA 5CVMA 1CB5A 4Q8GA 1CVZA 1F2CA 3KX1A 4OVZA 3PHXA 4OVZB 3ZUAA 1JQPA 2P86A 2ARYA 2GFOA 2DC8A 3W30A 1KXRA 3RVXA 3ERVA 1DEUA 5EF4A 3C0RA 2DCDA 5KO3A 4P16A 5EGWA 4ZUXU 3S3RA 4XZXA 5FPWA 1F2BA 5A24A 3IMAA 2FTDA 2J7QA 2HD5A 5EZQA 2PNSA 2E00A 2R9OA 2PADA 3RVWA 1PBHA 1DKIA 2NQAA 3D6SA 3QSDA 2VHFA 4FIPA 1ZIVA 3CBKA 1PPPA 1THEA 2AU1A 2AGAA 3IUTA 3BB7A 8PCHA 3TNXA 3V6CA 2E03A 2O6XA 2DC9A 2DC7A 3RVVA 4I07A 4M0WA 4QRVA 5PADA 4XR7A 1PIPA 2AS8A 3N3KA 2XU1A 4D8EA 4PADA 4MSXA 3B79A 3BOWA 3N4CA 1FH0A 3WXFA 3BPFA 2AIMA 3OF8A 9PAPA 2HH5A 1QMYA 5CHVA 1AU0A 4Q8HA 2UZJA 3PT2A 2JQFR 1YT7A 3OVXA 1QOLA 4MZOA 3BC3A 3OISA 3WXEA 3O65A 1X9YA 1YK8A 4X6JA 3MTNA 4WURA 4N8WA 4RF1A 4HXDB 3HHIA 2YJCA 2DCCA 2F7DA 4BOSA 3TRKA 2R9NA 2AUZA 1AIMA 4W4UA 3P5VA 4GUAA 5K16A 2PREA 2AVWA 1AYVA 1EF7A 2BTWA 3ZNHA 1GMYA 3KWZA 1NPZA 1CS8A 2P7UA 1ICFA 2YJ8A 3RNVA 1KFUL 1MIRA 4D8IA 4ZTBA 1ITOA 1HUCB 3I06A 1U9XA 2ACTA 1CV8A 2WBFX 1SP4B 1Y08A 4YYSA 4G54A 2JRIA 1DF0A 3MHSA 4AXMA 2F1GA 4N79A 3BCNA 4DMYA 4BPVA 4MM3B 3WXGA 2VHSA 2R9FA 3F75A 4WA6A 2R9CA 4P6EA 3O0UA 2BU3A 2NQDB 2DOSA 2OZ2A 4BOZA 1M6DA 1A6RA 3E1ZB 3NHEA 1NQCA 1QDQA 1GLOA 1EWOA 1NLJA 3H89A 2OP3A 1O0EA 1AECA 4CDFB 5JZEA 4CDCB
chains in the Genus database with same CATH topology
2JTCA 3BY4A 4BOQA 3MJ5A 4A5UA 4MI7A 2HWKA 1YZBA 2UZJA 3PT2A 4RF0A 3PSEA 2BTWB 3O65A 4IUMA 4WURA 4RF1A 3PHUA 4HXDB 4PT5A 4BOSA 3TRKA 3MTVA 4D8BA 4BOUA 3OQCA 4GUAA 2Z84A 4IP3A 5E6JA 1UKFA 2FE8A 3W31A 2BTWA 3ZNHA 3IFUA 5EZSA 4OVZA 2J7QC 3PHXA 4OVZB 3RNVA 4D8IA 4RNAA 3MP2A 3PRMA 4ZTBA 3W30A 3C0RA 5KO3A 4R3DA 4P16A 4XZXA 4RKXA 4REZA 2J7QA 3PRPA 2JRIA 5EZQA 3BBAA 4MM3B 3TMPA 1DKIA 3PHWA 3E9SA 2AGAA 2BU3A 2DOSA 3BB7A 3B21A 4BOZA 4OW0A 1PVJA 4BOPA 4M0WA 5JZEA 4D8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKF A; 
#chains in the Genus database with same CATH topology
 3BY4 A;  1KHP A;  1U9V A;  1PXV A;  2FUD A;  5J94 A;  2B1N A;  1MDW A;  3BPM A;  4CZW A;  2FRA A;  1PPD A;  2G6D A;  5CVN B;  2AYO A;  1F29 A;  2NQI A;  3O1G A;  3S3Q A;  7PCK A;  4W5B A;  3V6E A;  1STF E;  1BY8 A;  2FYE A;  1BGO A;  1MEM A;  4BQV A;  4BS6 A;  1YAL A;  1NB5 A;  3USV A;  1GEC E;  2AYN A;  3MTV A;  4D8B A;  3OQC A;  2B1M A;  1BP4 A;  2Z84 A;  3CH3 X;  2IBI A;  2FE8 A;  1KFX L;  1AU3 A;  3IFU A;  4FJC A;  5EZS A;  1ME3 A;  2DCA A;  2YJ9 A;  3KWB X;  2J7Q C;  5JA7 A;  1TL9 A;  4PP1 A;  2G8J A;  2Y5B A;  3H8C A;  3K8U A;  3KW9 A;  5CHT A;  5F02 A;  2BDZ A;  1MHW A;  3OF9 A;  2ATO A;  2CIO A;  3CH2 X;  3PNR A;  3HD3 A;  3P5W A;  1EWM A;  1F2A A;  1YK7 A;  4OEM A;  4REZ A;  1K3B B;  4K7C A;  4QBB A;  3MOR A;  1PPO A;  3BBA A;  3KFQ A;  1KHQ A;  4DMX A;  2E02 A;  3LXS A;  1U9W A;  1PCI A;  1AYU A;  4CDE B;  2E01 A;  3E9S A;  3P5X A;  3B21 A;  1GCB A;  2P0R A;  3KSE A;  4QH6 A;  2FT2 A;  4OEL A;  3C9E A;  1PVJ A;  1Q6K A;  1EWP A;  3IHP A;  4BOP A;  3MHH A;  3P5U A;  2JTC A;  4BOQ A;  4HWY A;  1MEG A;  1PE6 A;  1EWL A;  3M99 A;  4X6H A;  3H8B A;  2FRQ A;  3I3T A;  2DJF B;  2DCB A;  2HWK A;  3H7D A;  2BDL A;  1AYW A;  4RF0 A;  3F5V A;  1YVB A;  4XUI A;  1CTE A;  3QJ3 A;  1CPJ A;  4YYV A;  4QRG A;  3IV2 A;  3PHU A;  2Y6E A;  4PT5 A;  3K24 A;  1NB3 A;  1Y4H A;  4I05 A;  1VJV A;  2JQG R;  3IEJ A;  3CBJ A;  1CQD A;  4AXL A;  4YV8 A;  3K9M A;  4I04 A;  3QT4 A;  2YJ2 A;  3N3G A;  3OVZ A;  2AUX A;  4YYW A;  3H6S A;  3U8E A;  2GHU A;  3BWK A;  4RNA A;  3MP2 A;  4QRX A;  3PRM A;  2H7J A;  4R3D A;  4CDD B;  1PPN A;  2OUL A;  1MS6 A;  4RKX A;  1XKG A;  1IWD A;  3PRP A;  2XU4 A;  4YYU A;  1BQI A;  3AI8 A;  5JH3 A;  4MZS A;  1NL6 A;  4BSQ A;  2IPP B;  1QXP A;  3TMP A;  4P6G A;  5CVO B;  2PBH A;  3DF0 A;  3PHW A;  1SNK A;  1ZCM A;  1U5I A;  4PP2 E;  3IOQ A;  2HHN A;  3LFY A;  2CB5 A;  2G8E A;  2NQG A;  3PBH A;  4OW0 A;  2HXZ A;  2G7Y A;  2XU5 A;  4YYR A;  3PW3 A;  2C0Y A;  4FK5 A;  4YYQ A;  1VSN A;  3MJ5 A;  4A5U A;  2R6N A;  4X6I A;  1CSB B;  2DC6 A;  3HHA A;  2DZY A;  3HWN A;  4MI7 A;  1YZB A;  3PDF A;  1S4V A;  3KKU A;  1AU2 A;  3PSE A;  1ME4 A;  2BTW B;  4KLB A;  2DJG B;  3GCB A;  2FQ9 A;  4IUM A;  1U9Q X;  4PI3 A;  4W5C A;  1TLO A;  1TU6 A;  4BS5 A;  2DZZ A;  1AU4 A;  1POP A;  2FO5 A;  1ATK A;  2XU3 A;  4BOU A;  4IP3 A;  6PAD A;  5E6J A;  1CJL A;  1UKF A;  4N4Z A;  4RY2 A;  1PAD A;  3W31 A;  4YVA A;  2YJB A;  2R9M A;  5CVM A;  1CB5 A;  4Q8G A;  1CVZ A;  1F2C A;  3KX1 A;  4OVZ A;  3PHX A;  4OVZ B;  3ZUA A;  1JQP A;  2P86 A;  2ARY A;  2GFO A;  2DC8 A;  3W30 A;  1KXR A;  3RVX A;  3ERV A;  1DEU A;  5EF4 A;  3C0R A;  2DCD A;  5KO3 A;  4P16 A;  5EGW A;  4ZUX U;  3S3R A;  4XZX A;  5FPW A;  1F2B A;  5A24 A;  3IMA A;  2FTD A;  2J7Q A;  2HD5 A;  5EZQ A;  2PNS A;  2E00 A;  2R9O A;  2PAD A;  3RVW A;  1PBH A;  1DKI A;  2NQA A;  3D6S A;  3QSD A;  2VHF A;  4FIP A;  1ZIV A;  3CBK A;  1PPP A;  1THE A;  2AU1 A;  2AGA A;  3IUT A;  3BB7 A;  8PCH A;  3TNX A;  3V6C A;  2E03 A;  2O6X A;  2DC9 A;  2DC7 A;  3RVV A;  4I07 A;  4M0W A;  4QRV A;  5PAD A;  4XR7 A;  1PIP A;  2AS8 A;  3N3K A;  2XU1 A;  4D8E A;  4PAD A;  4MSX A;  3B79 A;  3BOW A;  3N4C A;  1FH0 A;  3WXF A;  3BPF A;  2AIM A;  3OF8 A;  9PAP A;  2HH5 A;  1QMY A;  5CHV A;  1AU0 A;  4Q8H A;  2UZJ A;  3PT2 A;  2JQF R;  1YT7 A;  3OVX A;  1QOL A;  4MZO A;  3BC3 A;  3OIS A;  3WXE A;  3O65 A;  1X9Y A;  1YK8 A;  4X6J A;  3MTN A;  4WUR A;  4N8W A;  4RF1 A;  4HXD B;  3HHI A;  2YJC A;  2DCC A;  2F7D A;  4BOS A;  3TRK A;  2R9N A;  2AUZ A;  1AIM A;  4W4U A;  3P5V A;  4GUA A;  5K16 A;  2PRE A;  2AVW A;  1AYV A;  1EF7 A;  2BTW A;  3ZNH A;  1GMY A;  3KWZ A;  1NPZ A;  1CS8 A;  2P7U A;  1ICF A;  2YJ8 A;  3RNV A;  1KFU L;  1MIR A;  4D8I A;  4ZTB A;  1ITO A;  1HUC B;  3I06 A;  1U9X A;  2ACT A;  1CV8 A;  2WBF X;  1SP4 B;  1Y08 A;  4YYS A;  4G54 A;  2JRI A;  1DF0 A;  3MHS A;  4AXM A;  2F1G A;  4N79 A;  3BCN A;  4DMY A;  4BPV A;  4MM3 B;  3WXG A;  2VHS A;  2R9F A;  3F75 A;  4WA6 A;  2R9C A;  4P6E A;  3O0U A;  2BU3 A;  2NQD B;  2DOS A;  2OZ2 A;  4BOZ A;  1M6D A;  1A6R A;  3E1Z B;  3NHE A;  1NQC A;  1QDQ A;  1GLO A;  1EWO A;  1NLJ A;  3H89 A;  2OP3 A;  1O0E A;  1AEC A;  4CDF B;  5JZE A;  4CDC B; 
#chains in the Genus database with same CATH homology
 2JTC A;  3BY4 A;  4BOQ A;  3MJ5 A;  4A5U A;  4MI7 A;  2HWK A;  1YZB A;  2UZJ A;  3PT2 A;  4RF0 A;  3PSE A;  2BTW B;  3O65 A;  4IUM A;  4WUR A;  4RF1 A;  3PHU A;  4HXD B;  4PT5 A;  4BOS A;  3TRK A;  3MTV A;  4D8B A;  4BOU A;  3OQC A;  4GUA A;  2Z84 A;  4IP3 A;  5E6J A;  1UKF A;  2FE8 A;  3W31 A;  2BTW A;  3ZNH A;  3IFU A;  5EZS A;  4OVZ A;  2J7Q C;  3PHX A;  4OVZ B;  3RNV A;  4D8I A;  4RNA A;  3MP2 A;  3PRM A;  4ZTB A;  3W30 A;  3C0R A;  5KO3 A;  4R3D A;  4P16 A;  4XZX A;  4RKX A;  4REZ A;  2J7Q A;  3PRP A;  2JRI A;  5EZQ A;  3BBA A;  4MM3 B;  3TMP A;  1DKI A;  3PHW A;  3E9S A;  2AGA A;  2BU3 A;  2DOS A;  3BB7 A;  3B21 A;  4BOZ A;  4OW0 A;  1PVJ A;  4BOP A;  4M0W A;  5JZE A;  4D8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...