1UKFA

Crystal structure of pseudomonas avirulence protein avrpphb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
b'SLSDFSVASRDVNHNNICAGLSTEWLVMSSDGDAESRMDHLDYNGEGQSRGSERHQVYNDALRAALSNDDEAPFFTASTAVIEDAGFSLRREPKTVHASGGSAQLGQTVAHDVAQSGRKHLLSLRFANVQGHAIACSCEGSQFKLFDPNLGEFQSSRSAAPQLIKGLIDHYNSLNYDVACVNEFRVSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avirulence protein AVRPPH3
publication title The crystal structure of Pseudomonas avirulence protein AvrPphB: a papain-like fold with a distinct substrate-binding site.
pubmed doi rcsb
source organism Pseudomonas syringae pv. phaseolicola
molecule tags Hydrolase
total genus 68
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.20 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1ukfA00
1UKFA
chains in the Genus database with same CATH superfamily
3PHUA 1ZCMA 4WA6A 4CDFB 4HWYA 2AVWA 4N79A 1NQCA 1VSNA 3BPFA 1ITOA 2XU5A 3P5UA 2AYOA 1TU6A 3ERVA 1POPA 3B79A 2R9NA 5FPWA 6PADA 2B1MA 4YVAA 4PP1A 1BQIA 1PIPA 3HHIA 2BDZA 3ZUAA 1PXVA 3HHAA 3PRPA 1EWLA 4PI3A 4DMXA 1U9WA 3I06A 3WXFA 3QT4A 3RVVA 3IUTA 1M6DA 2ACTA 3O1GA 3F5VA 1TL9A 2CB5A 1PPPA 2AUZA 4M0WA 4OW0A 1BGOA 5EZQA 1UKFA 3PDFA 4K7CA 3MHHA 3QJ3A 4FK5A 2G7YA 4BSQA 1EWOA 3CBJA 3M99A 2FQ9A 4P6GA 2DCAA 3AI8A 4YYWA 1PBHA 1S4VA 2WBFX 3S3RA 3USVA 1AECA 4MM3B 4BQVA 1EF7A 1QDQA 5EF4A 2DOSA 4N4ZA 1F2BA 2FRQA 3KW9A 1EWMA 1KFUL 1F2AA 4PT5A 1PPOA 3DF0A 3IMAA 3O65A 3MTNA 2OP3A 2DCBA 1PVJA 3LFYA 4ZUXU 4YV8A 3P5WA 2XU3A 2B1NA 4X6JA 3MORA 4W4UA 1NB5A 4CZWA 1AYUA 1U9XA 2CIOA 1MEGA 1QOLA 3IHPA 1CTEA 2R9FA 2OZ2A 4MSXA 3TRKA 3OQCA 2O6XA 2DC8A 3PHWA 4QRVA 1CPJA 1U5IA 1YT7A 1CV8A 3MTVA 1ZIVA 4OEMA 1GLOA 3RVXA 2UZJA 2E01A 2G6DA 1MIRA 1NB3A 3BWKA 3P5VA 4PP2E 1QXPA 4XZXA 2E03A 1PADA 3KSEA 2ATOA 1U9VA 2YJBA 2FT2A 2G8JA 2PBHA 3OVXA 2VHSA 3N4CA 4BOSA 1GECE 1CSBB 3BPMA 1GMYA 1MHWA 5JZEA 5CVOB 2FO5A 3IOQA 2DJGB 3C9EA 4CDEB 1Q6KA 1KHQA 3IEJA 4XR7A 2XU4A 3PSEA 2BU3A 2R9OA 4YYQA 2DJFB 4XUIA 1A6RA 2Y6EA 3C0RA 3NHEA 1Y4HA 2JRIA 2ARYA 4AXMA 3V6EA 3OF9A 3P5XA 2NQDB 4OVZA 2HWKA 3H8BA 1NLJA 3MP2A 4MI7A 4BPVA 2IPPB 1AU0A 1DKIA 3S3QA 2DC9A 2P7UA 1F29A 3CH3X 2GFOA 1AU2A 3OISA 2BDLA 1VJVA 1YALA 8PCHA 3WXGA 4WURA 1TLOA 3PT2A 3E9SA 5A24A 1KFXL 5CVNB 2R6NA 2HH5A 3N3GA 4FIPA 3W30A 1CJLA 1GCBA 2FE8A 4KLBA 3F75A 1DF0A 1PCIA 4D8IA 3D6SA 2AS8A 3K9MA 4RF1A 2YJ2A 4BS5A 1X9YA 3V6CA 2Y5BA 4BS6A 1ME3A 3OVZA 1CQDA 1MEMA 3I3TA 3BB7A 2DZZA 4P6EA 4YYUA 9PAPA 2C0YA 2FYEA 1CVZA 1K3BB 2OULA 1AYWA 3W31A 4OVZB 1HUCB 3TMPA 3LXSA 2PREA 1AYVA 2HD5A 2DCCA 2PADA 3QSDA 3K8UA 2J7QA 3PBHA 2NQIA 2PNSA 1PPDA 2H7JA 4ZTBA 3U8EA 4FJCA 1U9QX 4YYVA 5KO3A 2FTDA 1ICFA 3H89A 3BC3A 3CBKA 1PPNA 4RKXA 1NPZA 4BOZA 4QH6A 3IV2A 2E02A 3TNXA 2G8EA 4QRXA 4MZSA 2FRAA 1BY8A 2FUDA 4I04A 4RNAA 2BTWB 5EZSA 3O0UA 2Z84A 2IBIA 2YJ8A 4YYSA 3H6SA 3KFQA 1SNKA 2AGAA 1AIMA 4BOPA 2J7QC 1F2CA 3KX1A 3MJ5A 4G54A 4GUAA 2YJ9A 1KXRA 2AU1A 1AU4A 4RY2A 2P0RA 1FH0A 5CVMA 2DZYA 4RF0A 4W5BA 5K16A 3HWNA 4X6IA 4PADA 1ME4A 3PNRA 1YVBA 1STFE 5E6JA 1MDWA 4I05A 1QMYA 3B21A 4CDDB 4MZOA 2YJCA 1MS6A 2NQGA 4YYRA 2HHNA 5EGWA 2DC7A 2GHUA 2HXZA 5JH3A 2AIMA 3H7DA 4I07A 4HXDB 1PE6A 5F02A 3PW3A 2DC6A 1KHPA 2NQAA 3KKUA 2JTCA 3PHXA 4Q8GA 3GCBA 4DMYA 3KWZA 4OELA 2P86A 2BTWA 3BOWA 3H8CA 1DEUA 5CHTA 1O0EA 3OF8A 4BOUA 5PADA 3BCNA 1EWPA 4CDCB 3RNVA 3N3KA 2F7DA 1BP4A 2AUXA 5JA7A 3CH2X 4P16A 2XU1A 3RVWA 4D8EA 4N8WA 4W5CA 3BBAA 1YZBA 1THEA 3KWBX 2E00A 2JQFR 1Y08A 5J94A 1NL6A 1XKGA 1CB5A 1YK8A 2JQGR 5CHVA 4AXLA 3HD3A 4Q8HA 4A5UA 7PCKA 1CS8A 3E1ZB 4D8BA 4X6HA 1JQPA 4IP3A 4QRGA 4QBBA 3BY4A 2DCDA 3MHSA 2R9CA 2AYNA 3ZNHA 1SP4B 3PRMA 3WXEA 1AU3A 3K24A 3IFUA 4IUMA 1YK7A 2F1GA 2R9MA 1ATKA 4REZA 1IWDA 4R3DA 2VHFA 4BOQA
chains in the Genus database with same CATH topology
3PHUA 3MTVA 3BB7A 2UZJA 4HXDB 4XZXA 3W31A 4OVZB 2JTCA 3PHXA 3TMPA 2J7QA 4BOSA 3PRPA 2BTWA 5JZEA 4ZTBA 4BOUA 5KO3A 3PSEA 4M0WA 2BU3A 4OW0A 5EZQA 3RNVA 1UKFA 3C0RA 4RKXA 4BOZA 4P16A 2JRIA 4D8EA 3BBAA 1YZBA 4OVZA 2HWKA 4MM3B 4RNAA 2BTWB 3MP2A 5EZSA 2Z84A 4MI7A 2DOSA 1DKIA 2AGAA 4BOPA 4A5UA 2J7QC 4D8BA 4PT5A 3MJ5A 4GUAA 4IP3A 3O65A 4WURA 3PT2A 3E9SA 3BY4A 1PVJA 3ZNHA 3W30A 3PRMA 4RF0A 2FE8A 3IFUA 4IUMA 5E6JA 4D8IA 4REZA 4RF1A 4R3DA 3TRKA 3OQCA 3B21A 4BOQA 3PHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKF A; 
#chains in the Genus database with same CATH topology
 3PHU A;  1ZCM A;  4WA6 A;  4CDF B;  4HWY A;  2AVW A;  4N79 A;  1NQC A;  1VSN A;  3BPF A;  1ITO A;  2XU5 A;  3P5U A;  2AYO A;  1TU6 A;  3ERV A;  1POP A;  3B79 A;  2R9N A;  5FPW A;  6PAD A;  2B1M A;  4YVA A;  4PP1 A;  1BQI A;  1PIP A;  3HHI A;  2BDZ A;  3ZUA A;  1PXV A;  3HHA A;  3PRP A;  1EWL A;  4PI3 A;  4DMX A;  1U9W A;  3I06 A;  3WXF A;  3QT4 A;  3RVV A;  3IUT A;  1M6D A;  2ACT A;  3O1G A;  3F5V A;  1TL9 A;  2CB5 A;  1PPP A;  2AUZ A;  4M0W A;  4OW0 A;  1BGO A;  5EZQ A;  1UKF A;  3PDF A;  4K7C A;  3MHH A;  3QJ3 A;  4FK5 A;  2G7Y A;  4BSQ A;  1EWO A;  3CBJ A;  3M99 A;  2FQ9 A;  4P6G A;  2DCA A;  3AI8 A;  4YYW A;  1PBH A;  1S4V A;  2WBF X;  3S3R A;  3USV A;  1AEC A;  4MM3 B;  4BQV A;  1EF7 A;  1QDQ A;  5EF4 A;  2DOS A;  4N4Z A;  1F2B A;  2FRQ A;  3KW9 A;  1EWM A;  1KFU L;  1F2A A;  4PT5 A;  1PPO A;  3DF0 A;  3IMA A;  3O65 A;  3MTN A;  2OP3 A;  2DCB A;  1PVJ A;  3LFY A;  4ZUX U;  4YV8 A;  3P5W A;  2XU3 A;  2B1N A;  4X6J A;  3MOR A;  4W4U A;  1NB5 A;  4CZW A;  1AYU A;  1U9X A;  2CIO A;  1MEG A;  1QOL A;  3IHP A;  1CTE A;  2R9F A;  2OZ2 A;  4MSX A;  3TRK A;  3OQC A;  2O6X A;  2DC8 A;  3PHW A;  4QRV A;  1CPJ A;  1U5I A;  1YT7 A;  1CV8 A;  3MTV A;  1ZIV A;  4OEM A;  1GLO A;  3RVX A;  2UZJ A;  2E01 A;  2G6D A;  1MIR A;  1NB3 A;  3BWK A;  3P5V A;  4PP2 E;  1QXP A;  4XZX A;  2E03 A;  1PAD A;  3KSE A;  2ATO A;  1U9V A;  2YJB A;  2FT2 A;  2G8J A;  2PBH A;  3OVX A;  2VHS A;  3N4C A;  4BOS A;  1GEC E;  1CSB B;  3BPM A;  1GMY A;  1MHW A;  5JZE A;  5CVO B;  2FO5 A;  3IOQ A;  2DJG B;  3C9E A;  4CDE B;  1Q6K A;  1KHQ A;  3IEJ A;  4XR7 A;  2XU4 A;  3PSE A;  2BU3 A;  2R9O A;  4YYQ A;  2DJF B;  4XUI A;  1A6R A;  2Y6E A;  3C0R A;  3NHE A;  1Y4H A;  2JRI A;  2ARY A;  4AXM A;  3V6E A;  3OF9 A;  3P5X A;  2NQD B;  4OVZ A;  2HWK A;  3H8B A;  1NLJ A;  3MP2 A;  4MI7 A;  4BPV A;  2IPP B;  1AU0 A;  1DKI A;  3S3Q A;  2DC9 A;  2P7U A;  1F29 A;  3CH3 X;  2GFO A;  1AU2 A;  3OIS A;  2BDL A;  1VJV A;  1YAL A;  8PCH A;  3WXG A;  4WUR A;  1TLO A;  3PT2 A;  3E9S A;  5A24 A;  1KFX L;  5CVN B;  2R6N A;  2HH5 A;  3N3G A;  4FIP A;  3W30 A;  1CJL A;  1GCB A;  2FE8 A;  4KLB A;  3F75 A;  1DF0 A;  1PCI A;  4D8I A;  3D6S A;  2AS8 A;  3K9M A;  4RF1 A;  2YJ2 A;  4BS5 A;  1X9Y A;  3V6C A;  2Y5B A;  4BS6 A;  1ME3 A;  3OVZ A;  1CQD A;  1MEM A;  3I3T A;  3BB7 A;  2DZZ A;  4P6E A;  4YYU A;  9PAP A;  2C0Y A;  2FYE A;  1CVZ A;  1K3B B;  2OUL A;  1AYW A;  3W31 A;  4OVZ B;  1HUC B;  3TMP A;  3LXS A;  2PRE A;  1AYV A;  2HD5 A;  2DCC A;  2PAD A;  3QSD A;  3K8U A;  2J7Q A;  3PBH A;  2NQI A;  2PNS A;  1PPD A;  2H7J A;  4ZTB A;  3U8E A;  4FJC A;  1U9Q X;  4YYV A;  5KO3 A;  2FTD A;  1ICF A;  3H89 A;  3BC3 A;  3CBK A;  1PPN A;  4RKX A;  1NPZ A;  4BOZ A;  4QH6 A;  3IV2 A;  2E02 A;  3TNX A;  2G8E A;  4QRX A;  4MZS A;  2FRA A;  1BY8 A;  2FUD A;  4I04 A;  4RNA A;  2BTW B;  5EZS A;  3O0U A;  2Z84 A;  2IBI A;  2YJ8 A;  4YYS A;  3H6S A;  3KFQ A;  1SNK A;  2AGA A;  1AIM A;  4BOP A;  2J7Q C;  1F2C A;  3KX1 A;  3MJ5 A;  4G54 A;  4GUA A;  2YJ9 A;  1KXR A;  2AU1 A;  1AU4 A;  4RY2 A;  2P0R A;  1FH0 A;  5CVM A;  2DZY A;  4RF0 A;  4W5B A;  5K16 A;  3HWN A;  4X6I A;  4PAD A;  1ME4 A;  3PNR A;  1YVB A;  1STF E;  5E6J A;  1MDW A;  4I05 A;  1QMY A;  3B21 A;  4CDD B;  4MZO A;  2YJC A;  1MS6 A;  2NQG A;  4YYR A;  2HHN A;  5EGW A;  2DC7 A;  2GHU A;  2HXZ A;  5JH3 A;  2AIM A;  3H7D A;  4I07 A;  4HXD B;  1PE6 A;  5F02 A;  3PW3 A;  2DC6 A;  1KHP A;  2NQA A;  3KKU A;  2JTC A;  3PHX A;  4Q8G A;  3GCB A;  4DMY A;  3KWZ A;  4OEL A;  2P86 A;  2BTW A;  3BOW A;  3H8C A;  1DEU A;  5CHT A;  1O0E A;  3OF8 A;  4BOU A;  5PAD A;  3BCN A;  1EWP A;  4CDC B;  3RNV A;  3N3K A;  2F7D A;  1BP4 A;  2AUX A;  5JA7 A;  3CH2 X;  4P16 A;  2XU1 A;  3RVW A;  4D8E A;  4N8W A;  4W5C A;  3BBA A;  1YZB A;  1THE A;  3KWB X;  2E00 A;  2JQF R;  1Y08 A;  5J94 A;  1NL6 A;  1XKG A;  1CB5 A;  1YK8 A;  2JQG R;  5CHV A;  4AXL A;  3HD3 A;  4Q8H A;  4A5U A;  7PCK A;  1CS8 A;  3E1Z B;  4D8B A;  4X6H A;  1JQP A;  4IP3 A;  4QRG A;  4QBB A;  3BY4 A;  2DCD A;  3MHS A;  2R9C A;  2AYN A;  3ZNH A;  1SP4 B;  3PRM A;  3WXE A;  1AU3 A;  3K24 A;  3IFU A;  4IUM A;  1YK7 A;  2F1G A;  2R9M A;  1ATK A;  4REZ A;  1IWD A;  4R3D A;  2VHF A;  4BOQ A; 
#chains in the Genus database with same CATH homology
 3PHU A;  3MTV A;  3BB7 A;  2UZJ A;  4HXD B;  4XZX A;  3W31 A;  4OVZ B;  2JTC A;  3PHX A;  3TMP A;  2J7Q A;  4BOS A;  3PRP A;  2BTW A;  5JZE A;  4ZTB A;  4BOU A;  5KO3 A;  3PSE A;  4M0W A;  2BU3 A;  4OW0 A;  5EZQ A;  3RNV A;  1UKF A;  3C0R A;  4RKX A;  4BOZ A;  4P16 A;  2JRI A;  4D8E A;  3BBA A;  1YZB A;  4OVZ A;  2HWK A;  4MM3 B;  4RNA A;  2BTW B;  3MP2 A;  5EZS A;  2Z84 A;  4MI7 A;  2DOS A;  1DKI A;  2AGA A;  4BOP A;  4A5U A;  2J7Q C;  4D8B A;  4PT5 A;  3MJ5 A;  4GUA A;  4IP3 A;  3O65 A;  4WUR A;  3PT2 A;  3E9S A;  3BY4 A;  1PVJ A;  3ZNH A;  3W30 A;  3PRM A;  4RF0 A;  2FE8 A;  3IFU A;  4IUM A;  5E6J A;  4D8I A;  4REZ A;  4RF1 A;  4R3D A;  3TRK A;  3OQC A;  3B21 A;  4BOQ A;  3PHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...