1UKFA

Crystal structure of pseudomonas avirulence protein avrpphb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
SLSDFSVASRDVNHNNICAGLSTEWLVMSSDGDAESRMDHLDYNGEGQSRGSERHQVYNDALRAALSNDDEAPFFTASTAVIEDAGFSLRREPKTVHASGGSAQLGQTVAHDVAQSGRKHLLSLRFANVQGHAIACSCEGSQFKLFDPNLGEFQSSRSAAPQLIKGLIDHYNSLNYDVACVNEFRVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Pseudomonas avirulence protein AvrPphB: a papain-like fold with a distinct substrate-binding site.
pubmed doi rcsb
source organism Pseudomonas syringae pv. phaseolicola
molecule tags Hydrolase
molecule keywords Avirulence protein AVRPPH3
total genus 68
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2003-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.20 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1ukfA00
1UKFA
chains in the Genus database with same CATH superfamily
1TL9A 1PPPA 3O0UA 1SNKA 3DF0A 3QJ3A 3P5UA 4PT5A 3IUTA 1BP4A 4MSXA 3CH2X 2VHFA 1U9XA 4IUMA 2IBIA 1U9QX 3OQCA 2R9OA 4BQVA 1MHWA 4YYVA 1TLOA 1K3BB 1MEMA 4BOPA 4OW0A 3F5VA 3OF9A 3MHSA 4OELA 1ICFA 2PNSA 3WXFA 3OVXA 3KX1A 2OZ2A 3E1ZB 3RNVA 3PHXA 2DC6A 5EF4A 2BU3A 1S4VA 1QOLA 4X6HA 2P7UA 3C9EA 1Y08A 3ZUAA 2DC7A 1ZCMA 1UKFA 3I3TA 2DZYA 4FK5A 1U5IA 1GCBA 3W31A 1NB5A 1SP4B 5KO3A 3PNRA 1QXPA 1DEUA 1PBHA 2AYOA 2G8JA 5JZEA 2AS8A 3PHUA 7PCKA 2ACTA 2FT2A 3PW3A 2O6XA 4I05A 1PIPA 4P6GA 3KWZA 4RF1A 2JQFR 1YVBA 4N8WA 1PPNA 4BPVA 3PRPA 1ZIVA 5J94A 2F7DA 3PDFA 4D8BA 3BWKA 3PRMA 2XU3A 3IOQA 1XKGA 4A5UA 4W4UA 1Q6KA 4XZXA 2DOSA 4AXLA 1ME3A 1GLOA 2P0RA 3IFUA 3O65A 2JQGR 4ZUXU 4K7CA 4PI3A 2DC9A 1CTEA 3N3KA 1YT7A 4R3DA 2CB5A 4ZTBA 5EZSA 2AGAA 3I06A 1GECE 3PT2A 4PP2E 3BCNA 1KFXL 1CB5A 2G6DA 3MORA 3NHEA 2VHSA 2R9MA 3CBKA 2DJGB 1QDQA 3B21A 1BQIA 3TMPA 1EWMA 2HH5A 4YYWA 4X6IA 8PCHA 1YZBA 4QRVA 4MZSA 1AYUA 2R6NA 2CIOA 4QBBA 1ITOA 2HHNA 1NPZA 1M6DA 2UZJA 3RVXA 3W30A 3PBHA 5CVOB 3ERVA 2FRAA 3V6EA 4PP1A 1F29A 3C0RA 4MM3B 2R9CA 4P16A 1PADA 4YYSA 1U9VA 1O0EA 3N4CA 4DMXA 3E9SA 2NQAA 5EZQA 2HXZA 5CHVA 5F02A 1F2AA 9PAPA 1PVJA 4Q8HA 4BOSA 2DZZA 2E02A 4WURA 2NQGA 3BC3A 4DMYA 3MP2A 2HWKA 3H6SA 3QT4A 1KHPA 1CV8A 3H8BA 1FH0A 2B1MA 1GMYA 3K8UA 3H7DA 2BTWA 4REZA 2H7JA 4YV8A 1EWLA 2Y5BA 4OVZB 2FQ9A 3P5VA 1AYVA 4QRXA 1JQPA 4I04A 2Y6EA 3AI8A 3OVZA 5CVNB 2XU1A 1MEGA 2YJ2A 1AYWA 1THEA 4CDFB 2PADA 2G8EA 5CHTA 3PSEA 1U9WA 5EGWA 3BBAA 4BOQA 1X9YA 4N79A 1CS8A 3RVWA 3BB7A 1YALA 3K24A 1CSBB 3K9MA 2AIMA 4KLBA 2F1GA 2DC8A 2FRQA 4M0WA 2ARYA 3O1GA 2AVWA 3P5XA 3B79A 3GCBA 3HD3A 5JA7A 2BDZA 4OEMA 5FPWA 3KFQA 1MS6A 2P86A 3OISA 5CVMA 1KHQA 2XU5A 3KSEA 4HXDB 3MTVA 4BOUA 3WXEA 1AIMA 4BSQA 4RNAA 4Q8GA 5K16A 1POPA 2Z84A 4G54A 2GHUA 3CBJA 3S3QA 4FJCA 2XU4A 1F2BA 3USVA 2AUXA 1ATKA 4D8EA 2ATOA 1DF0A 1CVZA 1NB3A 1HUCB 3ZNHA 3HHAA 2AUZA 1AU4A 3TRKA 3MJ5A 4RF0A 4MZOA 2FUDA 3LXSA 2E00A 2JRIA 1QMYA 3F75A 1YK7A 4N4ZA 1MIRA 4BOZA 3KW9A 1YK8A 4MI7A 3BPMA 4W5CA 3IHPA 4W5BA 3D6SA 1NL6A 2J7QC 6PADA 3OF8A 2R9FA 1EWOA 1TU6A 4WA6A 1DKIA 2C0YA 3H89A 3S3RA 5JH3A 2OP3A 2HD5A 1EWPA 4X6JA 1CQDA 1AECA 1AU3A 3BOWA 4PADA 2DCBA 1CJLA 4CZWA 3WXGA 1EF7A 2BDLA 5E6JA 4CDEB 3N3GA 1PCIA 2E01A 4FIPA 4YVAA 4D8IA 1A6RA 3IEJA 5PADA 4YYRA 2PREA 3QSDA 3KKUA 2AYNA 4YYUA 4BS5A 1PXVA 2AU1A 1PPDA 5A24A 2PBHA 2JTCA 4AXMA 4QRGA 3KWBX 1PPOA 3IMAA 4RY2A 2B1NA 4P6EA 1KFUL 3U8EA 1MDWA 2NQDB 4CDDB 2YJ9A 1STFE 3LFYA 2OULA 4OVZA 2FYEA 2J7QA 1PE6A 3MHHA 2YJCA 1AU2A 2G7YA 3H8CA 2R9NA 3MTNA 4YYQA 1NLJA 2YJBA 4RKXA 4I07A 2NQIA 3CH3X 3IV2A 1AU0A 3PHWA 2DJFB 1BGOA 2DCCA 1VJVA 4QH6A 2IPPB 4HWYA 1Y4HA 4XUIA 2E03A 3V6CA 1BY8A 4IP3A 3RVVA 2DCAA 4XR7A 2GFOA 1ME4A 3TNXA 1VSNA 2FE8A 3BY4A 3M99A 2DCDA 3HWNA 1NQCA 1F2CA 3BPFA 2FTDA 4CDCB 3P5WA 4BS6A 2WBFX 2YJ8A 2BTWB 1IWDA 3HHIA 1CPJA 4GUAA 1KXRA 2FO5A
chains in the Genus database with same CATH topology
3MJ5A 4RF0A 4HXDB 2BTWA 4REZA 4OVZA 3MTVA 4XZXA 2UZJA 4IP3A 2DOSA 2J7QA 2JRIA 4BOUA 3BB7A 4OVZB 4PT5A 2JTCA 3IFUA 3B21A 3O65A 3PHXA 4RF1A 4RNAA 3RNVA 3W31A 3PRPA 4BOZA 1PVJA 5KO3A 4MI7A 3W30A 4RKXA 3TMPA 4BOSA 2FE8A 5JZEA 3BY4A 2Z84A 2BU3A 4BOQA 4R3DA 3PHUA 2J7QC 4IUMA 1YZBA 3PHWA 2AGAA 4M0WA 4WURA 3OQCA 5E6JA 5EZSA 4D8BA 3C0RA 4MM3B 3PT2A 3MP2A 4BOPA 4P16A 1DKIA 4D8EA 2HWKA 4OW0A 4D8IA 4ZTBA 2BTWB 3PSEA 3PRMA 4GUAA 3E9SA 5EZQA 3ZNHA 3BBAA 1UKFA 4A5UA 3TRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKF A; 
#chains in the Genus database with same CATH topology
 1TL9 A;  1PPP A;  3O0U A;  1SNK A;  3DF0 A;  3QJ3 A;  3P5U A;  4PT5 A;  3IUT A;  1BP4 A;  4MSX A;  3CH2 X;  2VHF A;  1U9X A;  4IUM A;  2IBI A;  1U9Q X;  3OQC A;  2R9O A;  4BQV A;  1MHW A;  4YYV A;  1TLO A;  1K3B B;  1MEM A;  4BOP A;  4OW0 A;  3F5V A;  3OF9 A;  3MHS A;  4OEL A;  1ICF A;  2PNS A;  3WXF A;  3OVX A;  3KX1 A;  2OZ2 A;  3E1Z B;  3RNV A;  3PHX A;  2DC6 A;  5EF4 A;  2BU3 A;  1S4V A;  1QOL A;  4X6H A;  2P7U A;  3C9E A;  1Y08 A;  3ZUA A;  2DC7 A;  1ZCM A;  1UKF A;  3I3T A;  2DZY A;  4FK5 A;  1U5I A;  1GCB A;  3W31 A;  1NB5 A;  1SP4 B;  5KO3 A;  3PNR A;  1QXP A;  1DEU A;  1PBH A;  2AYO A;  2G8J A;  5JZE A;  2AS8 A;  3PHU A;  7PCK A;  2ACT A;  2FT2 A;  3PW3 A;  2O6X A;  4I05 A;  1PIP A;  4P6G A;  3KWZ A;  4RF1 A;  2JQF R;  1YVB A;  4N8W A;  1PPN A;  4BPV A;  3PRP A;  1ZIV A;  5J94 A;  2F7D A;  3PDF A;  4D8B A;  3BWK A;  3PRM A;  2XU3 A;  3IOQ A;  1XKG A;  4A5U A;  4W4U A;  1Q6K A;  4XZX A;  2DOS A;  4AXL A;  1ME3 A;  1GLO A;  2P0R A;  3IFU A;  3O65 A;  2JQG R;  4ZUX U;  4K7C A;  4PI3 A;  2DC9 A;  1CTE A;  3N3K A;  1YT7 A;  4R3D A;  2CB5 A;  4ZTB A;  5EZS A;  2AGA A;  3I06 A;  1GEC E;  3PT2 A;  4PP2 E;  3BCN A;  1KFX L;  1CB5 A;  2G6D A;  3MOR A;  3NHE A;  2VHS A;  2R9M A;  3CBK A;  2DJG B;  1QDQ A;  3B21 A;  1BQI A;  3TMP A;  1EWM A;  2HH5 A;  4YYW A;  4X6I A;  8PCH A;  1YZB A;  4QRV A;  4MZS A;  1AYU A;  2R6N A;  2CIO A;  4QBB A;  1ITO A;  2HHN A;  1NPZ A;  1M6D A;  2UZJ A;  3RVX A;  3W30 A;  3PBH A;  5CVO B;  3ERV A;  2FRA A;  3V6E A;  4PP1 A;  1F29 A;  3C0R A;  4MM3 B;  2R9C A;  4P16 A;  1PAD A;  4YYS A;  1U9V A;  1O0E A;  3N4C A;  4DMX A;  3E9S A;  2NQA A;  5EZQ A;  2HXZ A;  5CHV A;  5F02 A;  1F2A A;  9PAP A;  1PVJ A;  4Q8H A;  4BOS A;  2DZZ A;  2E02 A;  4WUR A;  2NQG A;  3BC3 A;  4DMY A;  3MP2 A;  2HWK A;  3H6S A;  3QT4 A;  1KHP A;  1CV8 A;  3H8B A;  1FH0 A;  2B1M A;  1GMY A;  3K8U A;  3H7D A;  2BTW A;  4REZ A;  2H7J A;  4YV8 A;  1EWL A;  2Y5B A;  4OVZ B;  2FQ9 A;  3P5V A;  1AYV A;  4QRX A;  1JQP A;  4I04 A;  2Y6E A;  3AI8 A;  3OVZ A;  5CVN B;  2XU1 A;  1MEG A;  2YJ2 A;  1AYW A;  1THE A;  4CDF B;  2PAD A;  2G8E A;  5CHT A;  3PSE A;  1U9W A;  5EGW A;  3BBA A;  4BOQ A;  1X9Y A;  4N79 A;  1CS8 A;  3RVW A;  3BB7 A;  1YAL A;  3K24 A;  1CSB B;  3K9M A;  2AIM A;  4KLB A;  2F1G A;  2DC8 A;  2FRQ A;  4M0W A;  2ARY A;  3O1G A;  2AVW A;  3P5X A;  3B79 A;  3GCB A;  3HD3 A;  5JA7 A;  2BDZ A;  4OEM A;  5FPW A;  3KFQ A;  1MS6 A;  2P86 A;  3OIS A;  5CVM A;  1KHQ A;  2XU5 A;  3KSE A;  4HXD B;  3MTV A;  4BOU A;  3WXE A;  1AIM A;  4BSQ A;  4RNA A;  4Q8G A;  5K16 A;  1POP A;  2Z84 A;  4G54 A;  2GHU A;  3CBJ A;  3S3Q A;  4FJC A;  2XU4 A;  1F2B A;  3USV A;  2AUX A;  1ATK A;  4D8E A;  2ATO A;  1DF0 A;  1CVZ A;  1NB3 A;  1HUC B;  3ZNH A;  3HHA A;  2AUZ A;  1AU4 A;  3TRK A;  3MJ5 A;  4RF0 A;  4MZO A;  2FUD A;  3LXS A;  2E00 A;  2JRI A;  1QMY A;  3F75 A;  1YK7 A;  4N4Z A;  1MIR A;  4BOZ A;  3KW9 A;  1YK8 A;  4MI7 A;  3BPM A;  4W5C A;  3IHP A;  4W5B A;  3D6S A;  1NL6 A;  2J7Q C;  6PAD A;  3OF8 A;  2R9F A;  1EWO A;  1TU6 A;  4WA6 A;  1DKI A;  2C0Y A;  3H89 A;  3S3R A;  5JH3 A;  2OP3 A;  2HD5 A;  1EWP A;  4X6J A;  1CQD A;  1AEC A;  1AU3 A;  3BOW A;  4PAD A;  2DCB A;  1CJL A;  4CZW A;  3WXG A;  1EF7 A;  2BDL A;  5E6J A;  4CDE B;  3N3G A;  1PCI A;  2E01 A;  4FIP A;  4YVA A;  4D8I A;  1A6R A;  3IEJ A;  5PAD A;  4YYR A;  2PRE A;  3QSD A;  3KKU A;  2AYN A;  4YYU A;  4BS5 A;  1PXV A;  2AU1 A;  1PPD A;  5A24 A;  2PBH A;  2JTC A;  4AXM A;  4QRG A;  3KWB X;  1PPO A;  3IMA A;  4RY2 A;  2B1N A;  4P6E A;  1KFU L;  3U8E A;  1MDW A;  2NQD B;  4CDD B;  2YJ9 A;  1STF E;  3LFY A;  2OUL A;  4OVZ A;  2FYE A;  2J7Q A;  1PE6 A;  3MHH A;  2YJC A;  1AU2 A;  2G7Y A;  3H8C A;  2R9N A;  3MTN A;  4YYQ A;  1NLJ A;  2YJB A;  4RKX A;  4I07 A;  2NQI A;  3CH3 X;  3IV2 A;  1AU0 A;  3PHW A;  2DJF B;  1BGO A;  2DCC A;  1VJV A;  4QH6 A;  2IPP B;  4HWY A;  1Y4H A;  4XUI A;  2E03 A;  3V6C A;  1BY8 A;  4IP3 A;  3RVV A;  2DCA A;  4XR7 A;  2GFO A;  1ME4 A;  3TNX A;  1VSN A;  2FE8 A;  3BY4 A;  3M99 A;  2DCD A;  3HWN A;  1NQC A;  1F2C A;  3BPF A;  2FTD A;  4CDC B;  3P5W A;  4BS6 A;  2WBF X;  2YJ8 A;  2BTW B;  1IWD A;  3HHI A;  1CPJ A;  4GUA A;  1KXR A;  2FO5 A; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  4RF0 A;  4HXD B;  2BTW A;  4REZ A;  4OVZ A;  3MTV A;  4XZX A;  2UZJ A;  4IP3 A;  2DOS A;  2J7Q A;  2JRI A;  4BOU A;  3BB7 A;  4OVZ B;  4PT5 A;  2JTC A;  3IFU A;  3B21 A;  3O65 A;  3PHX A;  4RF1 A;  4RNA A;  3RNV A;  3W31 A;  3PRP A;  4BOZ A;  1PVJ A;  5KO3 A;  4MI7 A;  3W30 A;  4RKX A;  3TMP A;  4BOS A;  2FE8 A;  5JZE A;  3BY4 A;  2Z84 A;  2BU3 A;  4BOQ A;  4R3D A;  3PHU A;  2J7Q C;  4IUM A;  1YZB A;  3PHW A;  2AGA A;  4M0W A;  4WUR A;  3OQC A;  5E6J A;  5EZS A;  4D8B A;  3C0R A;  4MM3 B;  3PT2 A;  3MP2 A;  4BOP A;  4P16 A;  1DKI A;  4D8E A;  2HWK A;  4OW0 A;  4D8I A;  4ZTB A;  2BTW B;  3PSE A;  3PRM A;  4GUA A;  3E9S A;  5EZQ A;  3ZNH A;  3BBA A;  1UKF A;  4A5U A;  3TRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...