3ERVA

Crystal structure of an putative c39-like peptidase from bacillus anthracis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
200
Chain Sequence
DEKVILSNVPFIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMNDGVRGNPNEGFVGNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKSIEELYKSVKAGQPVVIITNATFAPLDEDEFTTWETNNGDVSITYNEHCVVLIGYDQESVYIRDPLKDSLDVKVPREKFEQAWVQMGSQAISYVKRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an putative C39-like peptidase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Structural genomics, unknown function
molecule keywords putative C39-like peptidase
total genus 67
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13529 Peptidase_C39_2 Peptidase_C39 like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ervA00
3IV2A 2AUZA 5CVOB 2DCBA 2E02A 2R6NA 1DF0A 3CBJA 3HHAA 1S4VA 1TU6A 3PDFA 2OP3A 1KFXL 2IPPB 3KWBX 1FH0A 3GCBA 3WXFA 2C0YA 3IHPA 2AVWA 3S3QA 2FQ9A 1AU3A 3PNRA 3HHIA 2G6DA 2CB5A 1U5IA 4DMYA 4BQVA 4YYRA 2DZZA 2BDLA 2Y6EA 4PP1A 2YJ9A 3BC3A 3V6EA 4MZSA 4X6HA 1ITOA 2NQIA 3BWKA 2F7DA 4N4ZA 3USVA 2IBIA 1KXRA 4HWYA 2AIMA 2B1MA 5CHVA 3KSEA 1PIPA 1GECE 2AYOA 1YK7A 3KW9A 2XU4A 3IMAA 5JH3A 1MIRA 3K8UA 4YYQA 4PADA 1KFUL 4P6EA 3P5UA 4G54A 1TLOA 2NQAA 3B79A 1KHQA 2R9MA 4QBBA 3H8CA 3KX1A 4CZWA 3M99A 4N79A 1DEUA 3ZUAA 2YJ8A 3I3TA 1GCBA 4AXLA 2Y5BA 4N8WA 1F2BA 2BDZA 2FRAA 1CV8A 1SNKA 2OULA 1CS8A 2P7UA 3MORA 2PADA 4XUIA 2FYEA 1EWPA 1GLOA 1PPOA 3OF9A 4WA6A 3RVXA 4FIPA 2DCCA 4BSQA 2DC6A 2FT2A 1EWOA 1GMYA 1QMYA 4YYVA 4YYUA 2R9NA 2NQDB 1MDWA 4Q8GA 5F02A 2AYNA 1TL9A 3IOQA 3F5VA 4PI3A 1PCIA 1O0EA 4X6IA 3PW3A 1PPPA 2ARYA 2R9FA 1NB5A 6PADA 1K3BB 4PP2E 7PCKA 3CBKA 3RVWA 2XU3A 1MEMA 4DMXA 1QDQA 2O6XA 2DJFB 1YALA 1NPZA 1CB5A 4FK5A 1AIMA 1CJLA 2CIOA 3BCNA 3LXSA 2DZYA 3D6SA 3IEJA 1Q6KA 4YV8A 3N3KA 3WXGA 3QT4A 5CVMA 4X6JA 2OZ2A 4W5BA 2HXZA 2WBFX 1ICFA 4BS6A 3OVZA 1ME3A 3OVXA 1PXVA 1ZCMA 3MHSA 4I05A 1U9WA 1CSBB 3O0UA 3OISA 2PBHA 3MHHA 4I04A 2ATOA 1U9VA 1MS6A 4BPVA 1CTEA 2B1NA 2FRQA 1AU0A 2XU1A 1QXPA 4AXMA 1XKGA 3MTNA 1PBHA 2VHFA 3E1ZB 3I06A 1ATKA 1AYUA 1YT7A 2YJBA 3V6CA 3BOWA 2XU5A 3HWNA 1QOLA 2DC7A 4YVAA 3RVVA 2AS8A 1EWLA 3HD3A 4QH6A 1AU2A 4CDDB 4I07A 1IWDA 4MSXA 2FTDA 1AECA 1SP4B 1PPNA 2PNSA 1NB3A 1U9QX 8PCHA 3K9MA 1ME4A 1BGOA 3WXEA 1NQCA 1PPDA 4OEMA 3KKUA 1ZIVA 1CPJA 1YVBA 4KLBA 3LFYA 3IUTA 3TNXA 5K16A 1A6RA 2DCDA 1M6DA 3BPMA 2G7YA 2DJGB 3C9EA 2DC8A 1HUCB 4CDFB 1F2AA 2H7JA 2HH5A 3QJ3A 2P86A 1CVZA 2FUDA 2F1GA 1MHWA 2GFOA 3U8EA 2E00A 1EF7A 4CDEB 1THEA 3H6SA 3P5XA 3AI8A 1CQDA 3P5VA 2P0RA 4QRVA 1PADA 1BP4A 4YYSA 1POPA 5J94A 2HD5A 3O1GA 1YK8A 1AYWA 1AYVA 5PADA 1VJVA 1MEGA 1F29A 3CH3X 3BPFA 4QRXA 2R9OA 3KFQA 2GHUA 1PE6A 3DF0A 4MZOA 1Y08A 1BQIA 1U9XA 4P6GA 2JQGR 2HHNA 4W4UA 4YYWA 5A24A 3F75A 1EWMA 3N4CA 2E03A 1STFE 5EF4A 1JQPA 3K24A 3H7DA 3H8BA 4BS5A 5FPWA 2PREA 4Q8HA 1NLJA 2VHSA 2NQGA 1BY8A 3CH2X 4XR7A 4FJCA 3H89A 4OELA 2AU1A 5CHTA 3NHEA 4ZUXU 9PAPA 3PBHA 4K7CA 2FO5A 2DCAA 4QRGA 1KHPA 3QSDA 1AU4A 5JA7A 5CVNB 2YJ2A 4W5CA 1X9YA 2G8EA 1F2CA 3ERVA 3N3GA 3P5WA 1Y4HA 2G8JA 1NL6A 2JQFR 5EGWA 2E01A 3S3RA 2ACTA 1VSNA 4CDCB 4RY2A 2R9CA 3OF8A 2YJCA 3KWZA 2DC9A 2AUXA
chains in the Genus database with same CATH superfamily
3IV2A 2AUZA 5CVOB 2DCBA 2E02A 2R6NA 1DKIA 1DF0A 3CBJA 3HHAA 1S4VA 1TU6A 4PT5A 5JZEA 3ZNHA 3PDFA 2OP3A 1KFXL 2AGAA 2IPPB 3KWBX 4GUAA 1FH0A 3GCBA 3WXFA 2C0YA 3IHPA 2AVWA 3BB7A 3S3QA 2FQ9A 1AU3A 3PNRA 3HHIA 5EZQA 2G6DA 2CB5A 1U5IA 4DMYA 4BQVA 4YYRA 2DZZA 2BDLA 2Y6EA 4BOQA 4PP1A 2YJ9A 3BC3A 3V6EA 4MZSA 4X6HA 1ITOA 2NQIA 3BWKA 3C0RA 3MP2A 2F7DA 4N4ZA 3USVA 2DOSA 2IBIA 1KXRA 4HWYA 3TRKA 3PSEA 2AIMA 2B1MA 5CHVA 3KSEA 1PIPA 1GECE 2AYOA 1YK7A 3KW9A 2XU4A 3IMAA 5JH3A 1MIRA 3K8UA 3E9SA 4YYQA 4PADA 1KFUL 4P6EA 3P5UA 4G54A 3RNVA 1TLOA 2NQAA 3B79A 1KHQA 2R9MA 4QBBA 3H8CA 3KX1A 4CZWA 4RKXA 3M99A 4N79A 1DEUA 2UZJA 3ZUAA 2YJ8A 3I3TA 2HWKA 1GCBA 4AXLA 2Y5BA 4N8WA 1F2BA 2BDZA 2FRAA 1CV8A 4MI7A 1SNKA 2OULA 4WURA 1CS8A 2P7UA 3MORA 2PADA 4XUIA 2J7QC 2FYEA 1EWPA 1GLOA 1PPOA 3OF9A 4WA6A 3RVXA 4FIPA 2DCCA 4BSQA 2DC6A 2FT2A 1EWOA 1GMYA 1QMYA 4YYVA 4YYUA 2R9NA 2NQDB 1MDWA 4Q8GA 5F02A 2AYNA 4R3DA 3B21A 1TL9A 3IOQA 3W30A 3F5VA 4PI3A 4IUMA 1PCIA 3MTVA 1O0EA 4X6IA 4OW0A 3PW3A 1PPPA 2ARYA 2R9FA 1NB5A 6PADA 1K3BB 4PP2E 7PCKA 3CBKA 3RVWA 2XU3A 1MEMA 4DMXA 1QDQA 2O6XA 2DJFB 1YALA 4BOUA 1NPZA 1CB5A 4FK5A 1AIMA 1CJLA 2CIOA 3BCNA 3LXSA 2DZYA 3D6SA 3IEJA 1Q6KA 4YV8A 3N3KA 4D8IA 3WXGA 3QT4A 5CVMA 4X6JA 2OZ2A 4W5BA 2HXZA 2WBFX 1ICFA 4BS6A 3OVZA 1ME3A 3OVXA 1PXVA 4HXDB 1ZCMA 4RF0A 3MHSA 4I05A 1U9WA 1CSBB 3O0UA 3OISA 3PHXA 2PBHA 3MHHA 4I04A 2ATOA 1U9VA 2BTWA 1MS6A 4BPVA 1CTEA 3PHUA 4M0WA 2BTWB 2B1NA 2FRQA 1AU0A 2XU1A 4D8BA 1QXPA 4D8EA 3IFUA 4AXMA 1XKGA 3MTNA 1PBHA 2VHFA 3E1ZB 3I06A 3TMPA 1ATKA 1AYUA 1YT7A 2YJBA 3V6CA 3BOWA 2XU5A 3HWNA 1QOLA 2DC7A 4YVAA 3RVVA 2AS8A 1EWLA 4OVZA 3HD3A 4QH6A 3OQCA 1AU2A 4CDDB 4I07A 1IWDA 4MSXA 2FTDA 1AECA 1SP4B 1PPNA 3W31A 2PNSA 1NB3A 2JTCA 1U9QX 8PCHA 3K9MA 1ME4A 1BGOA 3WXEA 1NQCA 1PPDA 4OEMA 3KKUA 2FE8A 4IP3A 3BBAA 3BY4A 2JRIA 1ZIVA 4BOPA 1CPJA 1YVBA 4KLBA 4MM3B 3LFYA 3O65A 3IUTA 3TNXA 1UKFA 5K16A 1A6RA 2DCDA 1M6DA 3BPMA 2G7YA 2DJGB 4RNAA 3C9EA 2DC8A 1HUCB 4CDFB 1F2AA 2H7JA 2HH5A 3QJ3A 2P86A 1CVZA 2FUDA 3PHWA 2F1GA 1MHWA 1YZBA 2GFOA 3U8EA 2E00A 1EF7A 4CDEB 4OVZB 1THEA 3H6SA 3P5XA 3AI8A 1CQDA 3P5VA 2P0RA 5KO3A 1PADA 4QRVA 4A5UA 1BP4A 4YYSA 1POPA 5J94A 4BOSA 3PRPA 2HD5A 3O1GA 1YK8A 1AYWA 1AYVA 5PADA 1VJVA 1MEGA 1F29A 3CH3X 3MJ5A 3BPFA 4QRXA 2R9OA 3KFQA 2GHUA 1PE6A 4RF1A 3DF0A 4MZOA 2BU3A 1Y08A 1BQIA 1U9XA 3PRMA 4P6GA 4REZA 2JQGR 2HHNA 4W4UA 4YYWA 5A24A 3F75A 1EWMA 3N4CA 2E03A 2J7QA 1STFE 5EF4A 1JQPA 3K24A 3PT2A 3H7DA 3H8BA 4BS5A 5FPWA 2PREA 4P16A 4Q8HA 4ZTBA 1NLJA 2VHSA 2Z84A 2NQGA 1BY8A 3CH2X 4XR7A 4FJCA 3H89A 4OELA 2AU1A 4BOZA 5E6JA 5CHTA 3NHEA 4ZUXU 4XZXA 9PAPA 3PBHA 4K7CA 2FO5A 2DCAA 4QRGA 1KHPA 3QSDA 1AU4A 5JA7A 5CVNB 2YJ2A 1PVJA 4W5CA 1X9YA 2G8EA 1F2CA 3ERVA 5EZSA 3N3GA 3P5WA 1Y4HA 2G8JA 1NL6A 2JQFR 5EGWA 2E01A 3S3RA 2ACTA 1VSNA 4CDCB 4RY2A 2R9CA 3OF8A 2YJCA 3KWZA 2DC9A 2AUXA
chains in the Genus database with same CATH topology
3IV2A 2AUZA 5CVOB 2DCBA 2E02A 2R6NA 1DF0A 3CBJA 3HHAA 1S4VA 1TU6A 3PDFA 2OP3A 1KFXL 2IPPB 3KWBX 1FH0A 3GCBA 3WXFA 2C0YA 3IHPA 2AVWA 3S3QA 2FQ9A 1AU3A 3PNRA 3HHIA 4GUZA 2G6DA 2CB5A 1U5IA 4DMYA 4BQVA 4YYRA 2DZZA 2BDLA 2Y6EA 4PP1A 2YJ9A 3BC3A 3V6EA 4MZSA 4X6HA 1ITOA 2NQIA 3BWKA 2F7DA 4N4ZA 3USVA 2IBIA 1KXRA 4HWYA 2AIMA 4B55A 2B1MA 5CHVA 3KSEA 1PIPA 1GECE 2AYOA 1YK7A 3KW9A 2XU4A 3IMAA 5JH3A 3D9WA 1MIRA 3K8UA 4YYQA 4PADA 1KFUL 4P6EA 3P5UA 4G54A 1TLOA 2NQAA 3B79A 1KHQA 2R9MA 4QBBA 3H8CA 3KX1A 4CZWA 3M99A 4N79A 1DEUA 3ZUAA 1W4TA 2YJ8A 3I3TA 1GCBA 4AXLA 2Y5BA 4N8WA 1F2BA 2BDZA 2FRAA 1CV8A 1SNKA 2OULA 1CS8A 2P7UA 3MORA 2PADA 4XUIA 2FYEA 1EWPA 1GLOA 1PPOA 3OF9A 4WA6A 3RVXA 4FIPA 2DCCA 4BSQA 2DC6A 2FT2A 1EWOA 1GMYA 1QMYA 4YYVA 4YYUA 2R9NA 2NQDB 1MDWA 4Q8GA 5F02A 2AYNA 4NV7A 1TL9A 3IOQA 3F5VA 4PI3A 1PCIA 1O0EA 4X6IA 3PW3A 1PPPA 2ARYA 2R9FA 1NB5A 6PADA 1K3BB 4PP2E 7PCKA 3CBKA 3RVWA 2XU3A 1MEMA 4DMXA 1QDQA 2O6XA 2DJFB 1YALA 1NPZA 1CB5A 4FK5A 1AIMA 1CJLA 2CIOA 3BCNA 3LXSA 2DZYA 3D6SA 3IEJA 1Q6KA 4YV8A 3N3KA 3WXGA 3QT4A 5CVMA 4X6JA 2OZ2A 4W5BA 2HXZA 2WBFX 1ICFA 4BS6A 3OVZA 1ME3A 3OVXA 1PXVA 1ZCMA 3MHSA 4I05A 1U9WA 1CSBB 3O0UA 3OISA 2PBHA 3MHHA 4I04A 2ATOA 1U9VA 1MS6A 4BPVA 1CTEA 4BGFA 2B1NA 3LTWA 2FRQA 1AU0A 2XU1A 1QXPA 4AXMA 1XKGA 3MTNA 1PBHA 2VHFA 3E1ZB 3I06A 1ATKA 1AYUA 1YT7A 2YJBA 3V6CA 3BOWA 2XU5A 3HWNA 1QOLA 2DC7A 4YVAA 3RVVA 2AS8A 1EWLA 3HD3A 4QH6A 1AU2A 4NV8A 4I07A 4CDDB 1IWDA 4MSXA 2FTDA 1AECA 1SP4B 1PPNA 2PNSA 1NB3A 1U9QX 8PCHA 3K9MA 1ME4A 1BGOA 3WXEA 1NQCA 1PPDA 4OEMA 3KKUA 1ZIVA 1CPJA 1YVBA 4KLBA 3LFYA 1W5RA 2VFBA 3IUTA 3TNXA 5K16A 1A6RA 2DCDA 1M6DA 3BPMA 2G7YA 2DJGB 3C9EA 2DC8A 1HUCB 4CDFB 2VFCA 1F2AA 2H7JA 2HH5A 3QJ3A 2P86A 1CVZA 2FUDA 2F1GA 1MHWA 2GFOA 3U8EA 2E00A 1EF7A 4CDEB 1THEA 3H6SA 3P5XA 3AI8A 1CQDA 4C5PA 3P5VA 2P0RA 4QRVA 1PADA 1GX3A 1BP4A 4YYSA 1POPA 5J94A 2HD5A 3O1GA 1YK8A 1AYWA 1AYVA 5PADA 1VJVA 1MEGA 1F29A 3CH3X 3BPFA 4QRXA 2R9OA 3KFQA 2GHUA 1PE6A 3DF0A 4MZOA 1Y08A 1BQIA 1U9XA 4P6GA 2JQGR 2HHNA 4W4UA 4YYWA 5A24A 3F75A 1EWMA 3N4CA 2E03A 1STFE 5EF4A 1JQPA 1E2TA 1W6FA 3K24A 3H7DA 3H8BA 4BS5A 5FPWA 2PREA 4Q8HA 1NLJA 2VHSA 2NQGA 1BY8A 3CH2X 4XR7A 4FJCA 2BSZA 3H89A 4OELA 2AU1A 5CHTA 3NHEA 4ZUXU 9PAPA 3PBHA 4K7CA 2FO5A 2DCAA 4QRGA 1KHPA 3QSDA 1AU4A 5JA7A 5CVNB 2YJ2A 4W5CA 1X9YA 2G8EA 1F2CA 3ERVA 3N3GA 3P5WA 1Y4HA 2G8JA 5EGWA 1NL6A 2JQFR 2E01A 3S3RA 2ACTA 1VSNA 4CDCB 4RY2A 2R9CA 3OF8A 2YJCA 3KWZA 2DC9A 2AUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV2 A;  2AUZ A;  5CVO B;  2DCB A;  2E02 A;  2R6N A;  1DF0 A;  3CBJ A;  3HHA A;  1S4V A;  1TU6 A;  3PDF A;  2OP3 A;  1KFX L;  2IPP B;  3KWB X;  1FH0 A;  3GCB A;  3WXF A;  2C0Y A;  3IHP A;  2AVW A;  3S3Q A;  2FQ9 A;  1AU3 A;  3PNR A;  3HHI A;  2G6D A;  2CB5 A;  1U5I A;  4DMY A;  4BQV A;  4YYR A;  2DZZ A;  2BDL A;  2Y6E A;  4PP1 A;  2YJ9 A;  3BC3 A;  3V6E A;  4MZS A;  4X6H A;  1ITO A;  2NQI A;  3BWK A;  2F7D A;  4N4Z A;  3USV A;  2IBI A;  1KXR A;  4HWY A;  2AIM A;  2B1M A;  5CHV A;  3KSE A;  1PIP A;  1GEC E;  2AYO A;  1YK7 A;  3KW9 A;  2XU4 A;  3IMA A;  5JH3 A;  1MIR A;  3K8U A;  4YYQ A;  4PAD A;  1KFU L;  4P6E A;  3P5U A;  4G54 A;  1TLO A;  2NQA A;  3B79 A;  1KHQ A;  2R9M A;  4QBB A;  3H8C A;  3KX1 A;  4CZW A;  3M99 A;  4N79 A;  1DEU A;  3ZUA A;  2YJ8 A;  3I3T A;  1GCB A;  4AXL A;  2Y5B A;  4N8W A;  1F2B A;  2BDZ A;  2FRA A;  1CV8 A;  1SNK A;  2OUL A;  1CS8 A;  2P7U A;  3MOR A;  2PAD A;  4XUI A;  2FYE A;  1EWP A;  1GLO A;  1PPO A;  3OF9 A;  4WA6 A;  3RVX A;  4FIP A;  2DCC A;  4BSQ A;  2DC6 A;  2FT2 A;  1EWO A;  1GMY A;  1QMY A;  4YYV A;  4YYU A;  2R9N A;  2NQD B;  1MDW A;  4Q8G A;  5F02 A;  2AYN A;  1TL9 A;  3IOQ A;  3F5V A;  4PI3 A;  1PCI A;  1O0E A;  4X6I A;  3PW3 A;  1PPP A;  2ARY A;  2R9F A;  1NB5 A;  6PAD A;  1K3B B;  4PP2 E;  7PCK A;  3CBK A;  3RVW A;  2XU3 A;  1MEM A;  4DMX A;  1QDQ A;  2O6X A;  2DJF B;  1YAL A;  1NPZ A;  1CB5 A;  4FK5 A;  1AIM A;  1CJL A;  2CIO A;  3BCN A;  3LXS A;  2DZY A;  3D6S A;  3IEJ A;  1Q6K A;  4YV8 A;  3N3K A;  3WXG A;  3QT4 A;  5CVM A;  4X6J A;  2OZ2 A;  4W5B A;  2HXZ A;  2WBF X;  1ICF A;  4BS6 A;  3OVZ A;  1ME3 A;  3OVX A;  1PXV A;  1ZCM A;  3MHS A;  4I05 A;  1U9W A;  1CSB B;  3O0U A;  3OIS A;  2PBH A;  3MHH A;  4I04 A;  2ATO A;  1U9V A;  1MS6 A;  4BPV A;  1CTE A;  2B1N A;  2FRQ A;  1AU0 A;  2XU1 A;  1QXP A;  4AXM A;  1XKG A;  3MTN A;  1PBH A;  2VHF A;  3E1Z B;  3I06 A;  1ATK A;  1AYU A;  1YT7 A;  2YJB A;  3V6C A;  3BOW A;  2XU5 A;  3HWN A;  1QOL A;  2DC7 A;  4YVA A;  3RVV A;  2AS8 A;  1EWL A;  3HD3 A;  4QH6 A;  1AU2 A;  4CDD B;  4I07 A;  1IWD A;  4MSX A;  2FTD A;  1AEC A;  1SP4 B;  1PPN A;  2PNS A;  1NB3 A;  1U9Q X;  8PCH A;  3K9M A;  1ME4 A;  1BGO A;  3WXE A;  1NQC A;  1PPD A;  4OEM A;  3KKU A;  1ZIV A;  1CPJ A;  1YVB A;  4KLB A;  3LFY A;  3IUT A;  3TNX A;  5K16 A;  1A6R A;  2DCD A;  1M6D A;  3BPM A;  2G7Y A;  2DJG B;  3C9E A;  2DC8 A;  1HUC B;  4CDF B;  1F2A A;  2H7J A;  2HH5 A;  3QJ3 A;  2P86 A;  1CVZ A;  2FUD A;  2F1G A;  1MHW A;  2GFO A;  3U8E A;  2E00 A;  1EF7 A;  4CDE B;  1THE A;  3H6S A;  3P5X A;  3AI8 A;  1CQD A;  3P5V A;  2P0R A;  4QRV A;  1PAD A;  1BP4 A;  4YYS A;  1POP A;  5J94 A;  2HD5 A;  3O1G A;  1YK8 A;  1AYW A;  1AYV A;  5PAD A;  1VJV A;  1MEG A;  1F29 A;  3CH3 X;  3BPF A;  4QRX A;  2R9O A;  3KFQ A;  2GHU A;  1PE6 A;  3DF0 A;  4MZO A;  1Y08 A;  1BQI A;  1U9X A;  4P6G A;  2JQG R;  2HHN A;  4W4U A;  4YYW A;  5A24 A;  3F75 A;  1EWM A;  3N4C A;  2E03 A;  1STF E;  5EF4 A;  1JQP A;  3K24 A;  3H7D A;  3H8B A;  4BS5 A;  5FPW A;  2PRE A;  4Q8H A;  1NLJ A;  2VHS A;  2NQG A;  1BY8 A;  3CH2 X;  4XR7 A;  4FJC A;  3H89 A;  4OEL A;  2AU1 A;  5CHT A;  3NHE A;  4ZUX U;  9PAP A;  3PBH A;  4K7C A;  2FO5 A;  2DCA A;  4QRG A;  1KHP A;  3QSD A;  1AU4 A;  5JA7 A;  5CVN B;  2YJ2 A;  4W5C A;  1X9Y A;  2G8E A;  1F2C A;  3ERV A;  3N3G A;  3P5W A;  1Y4H A;  2G8J A;  1NL6 A;  2JQF R;  5EGW A;  2E01 A;  3S3R A;  2ACT A;  1VSN A;  4CDC B;  4RY2 A;  2R9C A;  3OF8 A;  2YJC A;  3KWZ A;  2DC9 A;  2AUX A; 
#chains in the Genus database with same CATH topology
 3IV2 A;  2AUZ A;  5CVO B;  2DCB A;  2E02 A;  2R6N A;  1DKI A;  1DF0 A;  3CBJ A;  3HHA A;  1S4V A;  1TU6 A;  4PT5 A;  5JZE A;  3ZNH A;  3PDF A;  2OP3 A;  1KFX L;  2AGA A;  2IPP B;  3KWB X;  4GUA A;  1FH0 A;  3GCB A;  3WXF A;  2C0Y A;  3IHP A;  2AVW A;  3BB7 A;  3S3Q A;  2FQ9 A;  1AU3 A;  3PNR A;  3HHI A;  5EZQ A;  2G6D A;  2CB5 A;  1U5I A;  4DMY A;  4BQV A;  4YYR A;  2DZZ A;  2BDL A;  2Y6E A;  4BOQ A;  4PP1 A;  2YJ9 A;  3BC3 A;  3V6E A;  4MZS A;  4X6H A;  1ITO A;  2NQI A;  3BWK A;  3C0R A;  3MP2 A;  2F7D A;  4N4Z A;  3USV A;  2DOS A;  2IBI A;  1KXR A;  4HWY A;  3TRK A;  3PSE A;  2AIM A;  2B1M A;  5CHV A;  3KSE A;  1PIP A;  1GEC E;  2AYO A;  1YK7 A;  3KW9 A;  2XU4 A;  3IMA A;  5JH3 A;  1MIR A;  3K8U A;  3E9S A;  4YYQ A;  4PAD A;  1KFU L;  4P6E A;  3P5U A;  4G54 A;  3RNV A;  1TLO A;  2NQA A;  3B79 A;  1KHQ A;  2R9M A;  4QBB A;  3H8C A;  3KX1 A;  4CZW A;  4RKX A;  3M99 A;  4N79 A;  1DEU A;  2UZJ A;  3ZUA A;  2YJ8 A;  3I3T A;  2HWK A;  1GCB A;  4AXL A;  2Y5B A;  4N8W A;  1F2B A;  2BDZ A;  2FRA A;  1CV8 A;  4MI7 A;  1SNK A;  2OUL A;  4WUR A;  1CS8 A;  2P7U A;  3MOR A;  2PAD A;  4XUI A;  2J7Q C;  2FYE A;  1EWP A;  1GLO A;  1PPO A;  3OF9 A;  4WA6 A;  3RVX A;  4FIP A;  2DCC A;  4BSQ A;  2DC6 A;  2FT2 A;  1EWO A;  1GMY A;  1QMY A;  4YYV A;  4YYU A;  2R9N A;  2NQD B;  1MDW A;  4Q8G A;  5F02 A;  2AYN A;  4R3D A;  3B21 A;  1TL9 A;  3IOQ A;  3W30 A;  3F5V A;  4PI3 A;  4IUM A;  1PCI A;  3MTV A;  1O0E A;  4X6I A;  4OW0 A;  3PW3 A;  1PPP A;  2ARY A;  2R9F A;  1NB5 A;  6PAD A;  1K3B B;  4PP2 E;  7PCK A;  3CBK A;  3RVW A;  2XU3 A;  1MEM A;  4DMX A;  1QDQ A;  2O6X A;  2DJF B;  1YAL A;  4BOU A;  1NPZ A;  1CB5 A;  4FK5 A;  1AIM A;  1CJL A;  2CIO A;  3BCN A;  3LXS A;  2DZY A;  3D6S A;  3IEJ A;  1Q6K A;  4YV8 A;  3N3K A;  4D8I A;  3WXG A;  3QT4 A;  5CVM A;  4X6J A;  2OZ2 A;  4W5B A;  2HXZ A;  2WBF X;  1ICF A;  4BS6 A;  3OVZ A;  1ME3 A;  3OVX A;  1PXV A;  4HXD B;  1ZCM A;  4RF0 A;  3MHS A;  4I05 A;  1U9W A;  1CSB B;  3O0U A;  3OIS A;  3PHX A;  2PBH A;  3MHH A;  4I04 A;  2ATO A;  1U9V A;  2BTW A;  1MS6 A;  4BPV A;  1CTE A;  3PHU A;  4M0W A;  2BTW B;  2B1N A;  2FRQ A;  1AU0 A;  2XU1 A;  4D8B A;  1QXP A;  4D8E A;  3IFU A;  4AXM A;  1XKG A;  3MTN A;  1PBH A;  2VHF A;  3E1Z B;  3I06 A;  3TMP A;  1ATK A;  1AYU A;  1YT7 A;  2YJB A;  3V6C A;  3BOW A;  2XU5 A;  3HWN A;  1QOL A;  2DC7 A;  4YVA A;  3RVV A;  2AS8 A;  1EWL A;  4OVZ A;  3HD3 A;  4QH6 A;  3OQC A;  1AU2 A;  4CDD B;  4I07 A;  1IWD A;  4MSX A;  2FTD A;  1AEC A;  1SP4 B;  1PPN A;  3W31 A;  2PNS A;  1NB3 A;  2JTC A;  1U9Q X;  8PCH A;  3K9M A;  1ME4 A;  1BGO A;  3WXE A;  1NQC A;  1PPD A;  4OEM A;  3KKU A;  2FE8 A;  4IP3 A;  3BBA A;  3BY4 A;  2JRI A;  1ZIV A;  4BOP A;  1CPJ A;  1YVB A;  4KLB A;  4MM3 B;  3LFY A;  3O65 A;  3IUT A;  3TNX A;  1UKF A;  5K16 A;  1A6R A;  2DCD A;  1M6D A;  3BPM A;  2G7Y A;  2DJG B;  4RNA A;  3C9E A;  2DC8 A;  1HUC B;  4CDF B;  1F2A A;  2H7J A;  2HH5 A;  3QJ3 A;  2P86 A;  1CVZ A;  2FUD A;  3PHW A;  2F1G A;  1MHW A;  1YZB A;  2GFO A;  3U8E A;  2E00 A;  1EF7 A;  4CDE B;  4OVZ B;  1THE A;  3H6S A;  3P5X A;  3AI8 A;  1CQD A;  3P5V A;  2P0R A;  5KO3 A;  1PAD A;  4QRV A;  4A5U A;  1BP4 A;  4YYS A;  1POP A;  5J94 A;  4BOS A;  3PRP A;  2HD5 A;  3O1G A;  1YK8 A;  1AYW A;  1AYV A;  5PAD A;  1VJV A;  1MEG A;  1F29 A;  3CH3 X;  3MJ5 A;  3BPF A;  4QRX A;  2R9O A;  3KFQ A;  2GHU A;  1PE6 A;  4RF1 A;  3DF0 A;  4MZO A;  2BU3 A;  1Y08 A;  1BQI A;  1U9X A;  3PRM A;  4P6G A;  4REZ A;  2JQG R;  2HHN A;  4W4U A;  4YYW A;  5A24 A;  3F75 A;  1EWM A;  3N4C A;  2E03 A;  2J7Q A;  1STF E;  5EF4 A;  1JQP A;  3K24 A;  3PT2 A;  3H7D A;  3H8B A;  4BS5 A;  5FPW A;  2PRE A;  4P16 A;  4Q8H A;  4ZTB A;  1NLJ A;  2VHS A;  2Z84 A;  2NQG A;  1BY8 A;  3CH2 X;  4XR7 A;  4FJC A;  3H89 A;  4OEL A;  2AU1 A;  4BOZ A;  5E6J A;  5CHT A;  3NHE A;  4ZUX U;  4XZX A;  9PAP A;  3PBH A;  4K7C A;  2FO5 A;  2DCA A;  4QRG A;  1KHP A;  3QSD A;  1AU4 A;  5JA7 A;  5CVN B;  2YJ2 A;  1PVJ A;  4W5C A;  1X9Y A;  2G8E A;  1F2C A;  3ERV A;  5EZS A;  3N3G A;  3P5W A;  1Y4H A;  2G8J A;  1NL6 A;  2JQF R;  5EGW A;  2E01 A;  3S3R A;  2ACT A;  1VSN A;  4CDC B;  4RY2 A;  2R9C A;  3OF8 A;  2YJC A;  3KWZ A;  2DC9 A;  2AUX A; 
#chains in the Genus database with same CATH homology
 3IV2 A;  2AUZ A;  5CVO B;  2DCB A;  2E02 A;  2R6N A;  1DF0 A;  3CBJ A;  3HHA A;  1S4V A;  1TU6 A;  3PDF A;  2OP3 A;  1KFX L;  2IPP B;  3KWB X;  1FH0 A;  3GCB A;  3WXF A;  2C0Y A;  3IHP A;  2AVW A;  3S3Q A;  2FQ9 A;  1AU3 A;  3PNR A;  3HHI A;  4GUZ A;  2G6D A;  2CB5 A;  1U5I A;  4DMY A;  4BQV A;  4YYR A;  2DZZ A;  2BDL A;  2Y6E A;  4PP1 A;  2YJ9 A;  3BC3 A;  3V6E A;  4MZS A;  4X6H A;  1ITO A;  2NQI A;  3BWK A;  2F7D A;  4N4Z A;  3USV A;  2IBI A;  1KXR A;  4HWY A;  2AIM A;  4B55 A;  2B1M A;  5CHV A;  3KSE A;  1PIP A;  1GEC E;  2AYO A;  1YK7 A;  3KW9 A;  2XU4 A;  3IMA A;  5JH3 A;  3D9W A;  1MIR A;  3K8U A;  4YYQ A;  4PAD A;  1KFU L;  4P6E A;  3P5U A;  4G54 A;  1TLO A;  2NQA A;  3B79 A;  1KHQ A;  2R9M A;  4QBB A;  3H8C A;  3KX1 A;  4CZW A;  3M99 A;  4N79 A;  1DEU A;  3ZUA A;  1W4T A;  2YJ8 A;  3I3T A;  1GCB A;  4AXL A;  2Y5B A;  4N8W A;  1F2B A;  2BDZ A;  2FRA A;  1CV8 A;  1SNK A;  2OUL A;  1CS8 A;  2P7U A;  3MOR A;  2PAD A;  4XUI A;  2FYE A;  1EWP A;  1GLO A;  1PPO A;  3OF9 A;  4WA6 A;  3RVX A;  4FIP A;  2DCC A;  4BSQ A;  2DC6 A;  2FT2 A;  1EWO A;  1GMY A;  1QMY A;  4YYV A;  4YYU A;  2R9N A;  2NQD B;  1MDW A;  4Q8G A;  5F02 A;  2AYN A;  4NV7 A;  1TL9 A;  3IOQ A;  3F5V A;  4PI3 A;  1PCI A;  1O0E A;  4X6I A;  3PW3 A;  1PPP A;  2ARY A;  2R9F A;  1NB5 A;  6PAD A;  1K3B B;  4PP2 E;  7PCK A;  3CBK A;  3RVW A;  2XU3 A;  1MEM A;  4DMX A;  1QDQ A;  2O6X A;  2DJF B;  1YAL A;  1NPZ A;  1CB5 A;  4FK5 A;  1AIM A;  1CJL A;  2CIO A;  3BCN A;  3LXS A;  2DZY A;  3D6S A;  3IEJ A;  1Q6K A;  4YV8 A;  3N3K A;  3WXG A;  3QT4 A;  5CVM A;  4X6J A;  2OZ2 A;  4W5B A;  2HXZ A;  2WBF X;  1ICF A;  4BS6 A;  3OVZ A;  1ME3 A;  3OVX A;  1PXV A;  1ZCM A;  3MHS A;  4I05 A;  1U9W A;  1CSB B;  3O0U A;  3OIS A;  2PBH A;  3MHH A;  4I04 A;  2ATO A;  1U9V A;  1MS6 A;  4BPV A;  1CTE A;  4BGF A;  2B1N A;  3LTW A;  2FRQ A;  1AU0 A;  2XU1 A;  1QXP A;  4AXM A;  1XKG A;  3MTN A;  1PBH A;  2VHF A;  3E1Z B;  3I06 A;  1ATK A;  1AYU A;  1YT7 A;  2YJB A;  3V6C A;  3BOW A;  2XU5 A;  3HWN A;  1QOL A;  2DC7 A;  4YVA A;  3RVV A;  2AS8 A;  1EWL A;  3HD3 A;  4QH6 A;  1AU2 A;  4NV8 A;  4I07 A;  4CDD B;  1IWD A;  4MSX A;  2FTD A;  1AEC A;  1SP4 B;  1PPN A;  2PNS A;  1NB3 A;  1U9Q X;  8PCH A;  3K9M A;  1ME4 A;  1BGO A;  3WXE A;  1NQC A;  1PPD A;  4OEM A;  3KKU A;  1ZIV A;  1CPJ A;  1YVB A;  4KLB A;  3LFY A;  1W5R A;  2VFB A;  3IUT A;  3TNX A;  5K16 A;  1A6R A;  2DCD A;  1M6D A;  3BPM A;  2G7Y A;  2DJG B;  3C9E A;  2DC8 A;  1HUC B;  4CDF B;  2VFC A;  1F2A A;  2H7J A;  2HH5 A;  3QJ3 A;  2P86 A;  1CVZ A;  2FUD A;  2F1G A;  1MHW A;  2GFO A;  3U8E A;  2E00 A;  1EF7 A;  4CDE B;  1THE A;  3H6S A;  3P5X A;  3AI8 A;  1CQD A;  4C5P A;  3P5V A;  2P0R A;  4QRV A;  1PAD A;  1GX3 A;  1BP4 A;  4YYS A;  1POP A;  5J94 A;  2HD5 A;  3O1G A;  1YK8 A;  1AYW A;  1AYV A;  5PAD A;  1VJV A;  1MEG A;  1F29 A;  3CH3 X;  3BPF A;  4QRX A;  2R9O A;  3KFQ A;  2GHU A;  1PE6 A;  3DF0 A;  4MZO A;  1Y08 A;  1BQI A;  1U9X A;  4P6G A;  2JQG R;  2HHN A;  4W4U A;  4YYW A;  5A24 A;  3F75 A;  1EWM A;  3N4C A;  2E03 A;  1STF E;  5EF4 A;  1JQP A;  1E2T A;  1W6F A;  3K24 A;  3H7D A;  3H8B A;  4BS5 A;  5FPW A;  2PRE A;  4Q8H A;  1NLJ A;  2VHS A;  2NQG A;  1BY8 A;  3CH2 X;  4XR7 A;  4FJC A;  2BSZ A;  3H89 A;  4OEL A;  2AU1 A;  5CHT A;  3NHE A;  4ZUX U;  9PAP A;  3PBH A;  4K7C A;  2FO5 A;  2DCA A;  4QRG A;  1KHP A;  3QSD A;  1AU4 A;  5JA7 A;  5CVN B;  2YJ2 A;  4W5C A;  1X9Y A;  2G8E A;  1F2C A;  3ERV A;  3N3G A;  3P5W A;  1Y4H A;  2G8J A;  5EGW A;  1NL6 A;  2JQF R;  2E01 A;  3S3R A;  2ACT A;  1VSN A;  4CDC B;  4RY2 A;  2R9C A;  3OF8 A;  2YJC A;  3KWZ A;  2DC9 A;  2AUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...