3ERVA

Crystal structure of an putative c39-like peptidase from bacillus anthracis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
200
Chain Sequence
DEKVILSNVPFIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMNDGVRGNPNEGFVGNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKSIEELYKSVKAGQPVVIITNATFAPLDEDEFTTWETNNGDVSITYNEHCVVLIGYDQESVYIRDPLKDSLDVKVPREKFEQAWVQMGSQAISYVKRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative C39-like peptidase
publication title Crystal structure of an putative C39-like peptidase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Structural genomics, unknown function
total genus 67
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13529 Peptidase_C39_2 Peptidase_C39 like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ervA00
2P0RA 1MDWA 5J94A 2DCDA 2OP3A 1YK8A 4BSQA 2OZ2A 3OF8A 3KX1A 3B79A 4YYUA 1VSNA 3P5XA 2NQGA 3CBKA 3IOQA 3CH2X 1ZCMA 4W5BA 4P6GA 3I06A 2Y5BA 1TLOA 5EF4A 3KWBX 3LFYA 5FPWA 1POPA 3M99A 2IPPB 1VJVA 1AYVA 4G54A 1A6RA 4XR7A 1GECE 3ZUAA 2DZZA 3IUTA 2DCBA 1U9XA 1DEUA 4X6IA 2B1MA 1F2CA 3IEJA 2CB5A 1KFXL 4BPVA 2FTDA 3HHIA 4DMXA 1BQIA 5JA7A 2E02A 3IV2A 4K7CA 2JQGR 2C0YA 1F29A 2NQIA 4FJCA 2BDZA 2DC6A 3CBJA 3NHEA 2NQDB 3N3GA 1X9YA 2WBFX 3WXFA 1YK7A 3KFQA 3I3TA 3PDFA 4I07A 2HXZA 4AXLA 1KHQA 4KLBA 1F2AA 3BOWA 1GCBA 1FH0A 2YJ2A 4CZWA 3O1GA 1M6DA 4X6JA 4PADA 1Q6KA 2DCAA 2AUZA 1MIRA 2FQ9A 1YALA 1ME3A 2P86A 2XU4A 3OF9A 1U9QX 1DF0A 2FRAA 1KHPA 1F2BA 1BY8A 2PADA 3BCNA 2R9OA 1PADA 3OVZA 6PADA 3F5VA 2AVWA 3RVWA 4BS5A 3WXGA 1O0EA 1AYUA 4ZUXU 9PAPA 1KXRA 2ACTA 5CVOB 1AU4A 2P7UA 4X6HA 3HWNA 1BGOA 1PPOA 4YYSA 4Q8GA 2AIMA 2R9FA 1KFUL 5EGWA 2FRQA 3H8BA 2BDLA 2XU3A 3BWKA 1CJLA 3AI8A 2HH5A 3IMAA 4YVAA 2R9NA 4Q8HA 2E03A 1EWOA 2FO5A 3F75A 3BPMA 4QBBA 1MHWA 3GCBA 1JQPA 1PIPA 3KW9A 2JQFR 1CV8A 2H7JA 1TL9A 1Y08A 2HD5A 4QH6A 4W5CA 4AXMA 3MTNA 3ERVA 1CQDA 3D6SA 1AU3A 2CIOA 3S3RA 1PE6A 1ICFA 4N4ZA 1AYWA 1HUCB 1XKGA 1AU0A 1PBHA 4I04A 1GMYA 2VHSA 2DC7A 1PPPA 3QT4A 2XU5A 5CVNB 2F1GA 2R9MA 1NB3A 1CSBB 1AIMA 4CDCB 1EWPA 2E01A 2PBHA 3K24A 2VHFA 1NPZA 2G8JA 1CB5A 1PPNA 3QJ3A 4FIPA 3P5UA 2DC9A 4DMYA 4OEMA 1EF7A 2DJGB 1ATKA 1CS8A 3MORA 2FYEA 4W4UA 4YYVA 1CVZA 2NQAA 2PREA 3O0UA 8PCHA 1U9VA 5F02A 4YYWA 4CDFB 2AYOA 1NB5A 1EWLA 1PPDA 5CHVA 3N3KA 2B1NA 4QRGA 3OVXA 2AYNA 1ZIVA 2AS8A 7PCKA 1YVBA 4OELA 1GLOA 1NL6A 1QDQA 2FT2A 2XU1A 3BC3A 3C9EA 2G8EA 3OISA 3IHPA 1S4VA 1U9WA 4PP1A 2R9CA 3N4CA 2E00A 2YJ9A 1U5IA 2PNSA 4N8WA 4PP2E 3V6EA 1MEGA 3U8EA 3P5WA 3DF0A 3USVA 4P6EA 3TNXA 4I05A 1AECA 3RVVA 1NQCA 3QSDA 2Y6EA 4HWYA 3MHSA 2G7YA 3RVXA 2DZYA 5CVMA 1AU2A 4QRXA 2G6DA 3H89A 4CDEB 5A24A 1SNKA 4MZOA 2YJCA 3V6CA 1YT7A 5PADA 1BP4A 2GHUA 3KWZA 1THEA 1QXPA 2AU1A 4BS6A 4YYRA 5CHTA 2YJ8A 3HD3A 1SP4B 3H7DA 3PW3A 2ATOA 2AUXA 1PXVA 4WA6A 3H8CA 2ARYA 2DC8A 4MSXA 3MHHA 2OULA 1STFE 1ME4A 4YYQA 3HHAA 1CPJA 1K3BB 3E1ZB 4FK5A 1TU6A 2YJBA 4CDDB 3WXEA 2DCCA 3PBHA 1CTEA 2GFOA 3H6SA 3KSEA 1Y4HA 4YV8A 1QOLA 1PCIA 2F7DA 4QRVA 5JH3A 1ITOA 2FUDA 3S3QA 4N79A 3BPFA 2DJFB 3K8UA 3P5VA 1NLJA 3LXSA 3PNRA 4PI3A 1MEMA 1IWDA 2O6XA 4BQVA 1QMYA 2R6NA 2HHNA 3KKUA 3K9MA 5K16A 3CH3X 4RY2A 4MZSA 4XUIA 1MS6A 1EWMA 2IBIA
chains in the Genus database with same CATH superfamily
2P0RA 1MDWA 5J94A 2DCDA 2OP3A 1YK8A 4BSQA 2OZ2A 3OF8A 3KX1A 3E9SA 3B79A 4IP3A 4R3DA 4YYUA 1VSNA 3P5XA 3MP2A 2NQGA 3CBKA 3IOQA 4D8IA 3CH2X 1ZCMA 4W5BA 3RNVA 4D8BA 4P6GA 3I06A 2Y5BA 1TLOA 5EF4A 3KWBX 3LFYA 5FPWA 1POPA 3M99A 2BU3A 2IPPB 1VJVA 1AYVA 4G54A 1A6RA 4XR7A 1GECE 3ZUAA 3MTVA 2DZZA 3IUTA 2DCBA 4WURA 1U9XA 1DEUA 4BOZA 4X6IA 2B1MA 1F2CA 3IEJA 1YZBA 2CB5A 1KFXL 4BPVA 2FTDA 3HHIA 4DMXA 5EZQA 1BQIA 1DKIA 5JA7A 2E02A 3IV2A 4K7CA 2JQGR 4D8EA 3C0RA 2C0YA 1F29A 2NQIA 3W30A 3BB7A 4FJCA 2UZJA 2BDZA 2DC6A 3BY4A 3CBJA 3NHEA 2NQDB 3N3GA 1X9YA 2WBFX 3PT2A 3WXFA 4P16A 1YK7A 3KFQA 3I3TA 3PDFA 4I07A 2HXZA 4AXLA 4REZA 3B21A 1KHQA 4KLBA 1F2AA 2Z84A 3BOWA 4A5UA 1GCBA 1FH0A 2YJ2A 4CZWA 3O1GA 1M6DA 4X6JA 4PADA 1Q6KA 2DCAA 2AUZA 1MIRA 4M0WA 2DOSA 2FQ9A 1YALA 1ME3A 2P86A 2XU4A 3OF9A 1U9QX 2AGAA 4OVZA 1DF0A 3TRKA 2FRAA 1KHPA 1F2BA 1BY8A 2PADA 5E6JA 4RNAA 3BCNA 2R9OA 1PADA 3OVZA 3PHWA 6PADA 3F5VA 2AVWA 3RVWA 4BS5A 3PHXA 3WXGA 1O0EA 1AYUA 4ZUXU 1PVJA 9PAPA 1KXRA 2ACTA 5CVOB 1AU4A 2P7UA 2BTWB 4X6HA 3HWNA 4RKXA 1BGOA 1PPOA 4YYSA 4Q8GA 5KO3A 2AIMA 2J7QA 2R9FA 1KFUL 5EGWA 2FRQA 3H8BA 2BDLA 2XU3A 3BWKA 2JTCA 1CJLA 3AI8A 2HH5A 3IMAA 4YVAA 2R9NA 4Q8HA 2E03A 1EWOA 2FO5A 3F75A 3BPMA 1MHWA 4QBBA 3GCBA 1JQPA 1PIPA 3KW9A 2JQFR 1CV8A 2H7JA 1TL9A 1Y08A 2HD5A 4QH6A 4W5CA 4AXMA 3MTNA 3ERVA 1CQDA 3D6SA 1AU3A 2CIOA 3S3RA 1PE6A 1ICFA 4N4ZA 1AYWA 1HUCB 1XKGA 1AU0A 1PBHA 4I04A 3IFUA 1GMYA 2VHSA 2DC7A 1PPPA 3QT4A 2XU5A 5CVNB 3PRMA 2F1GA 2R9MA 1NB3A 4BOUA 1CSBB 1AIMA 4CDCB 1EWPA 2E01A 2PBHA 3K24A 2VHFA 1NPZA 2G8JA 1CB5A 1PPNA 3QJ3A 3O65A 4FIPA 3P5UA 3PHUA 2DC9A 4DMYA 4OEMA 1EF7A 2DJGB 1ATKA 1CS8A 3MORA 2FYEA 4W4UA 4YYVA 4BOQA 1CVZA 2NQAA 2PREA 3O0UA 5JZEA 8PCHA 1U9VA 5F02A 4YYWA 4CDFB 2AYOA 1NB5A 1EWLA 1PPDA 5CHVA 3N3KA 2B1NA 4QRGA 3BBAA 3OVXA 2AYNA 1ZIVA 2AS8A 7PCKA 1YVBA 4BOPA 4OELA 1GLOA 1NL6A 1QDQA 2FT2A 2XU1A 3BC3A 3C9EA 2G8EA 3OISA 4BOSA 3IHPA 1S4VA 1U9WA 4PP1A 4HXDB 2R9CA 3TMPA 3PRPA 3N4CA 2E00A 2YJ9A 1U5IA 2PNSA 4N8WA 4PP2E 4IUMA 3V6EA 1MEGA 3U8EA 3P5WA 3DF0A 3USVA 4P6EA 3TNXA 4I05A 1AECA 3RVVA 2JRIA 1NQCA 3QSDA 2Y6EA 4HWYA 3MHSA 2G7YA 3RVXA 2DZYA 5CVMA 1AU2A 4QRXA 1UKFA 2J7QC 2G6DA 3H89A 4CDEB 4RF0A 4RF1A 5A24A 2HWKA 4OVZB 1SNKA 4MZOA 5EZSA 2YJCA 4MM3B 3V6CA 1YT7A 5PADA 1BP4A 2GHUA 3KWZA 4GUAA 1THEA 4OW0A 1QXPA 2AU1A 4BS6A 3OQCA 4YYRA 5CHTA 2YJ8A 3HD3A 3MJ5A 1SP4B 3H7DA 3PW3A 2ATOA 2AUXA 1PXVA 4WA6A 3PSEA 3ZNHA 3H8CA 2ARYA 2DC8A 4MSXA 3MHHA 2OULA 1STFE 1ME4A 4YYQA 3HHAA 1CPJA 2BTWA 1K3BB 3E1ZB 4FK5A 1TU6A 2YJBA 4CDDB 2FE8A 3WXEA 2DCCA 3PBHA 1CTEA 2GFOA 3H6SA 4ZTBA 3KSEA 1Y4HA 4YV8A 1QOLA 1PCIA 2F7DA 4QRVA 5JH3A 1ITOA 2FUDA 3S3QA 4N79A 3BPFA 2DJFB 3K8UA 3P5VA 1NLJA 4PT5A 3LXSA 3PNRA 4PI3A 1MEMA 1IWDA 2O6XA 4BQVA 1QMYA 2R6NA 4XZXA 2HHNA 3KKUA 4MI7A 3K9MA 3W31A 5K16A 3CH3X 4RY2A 4MZSA 4XUIA 1MS6A 1EWMA 2IBIA
chains in the Genus database with same CATH topology
2P0RA 1MDWA 5J94A 2DCDA 2OP3A 1YK8A 4BSQA 2OZ2A 3OF8A 3KX1A 2VFCA 3B79A 4YYUA 1VSNA 3P5XA 2NQGA 3CBKA 3IOQA 3CH2X 1ZCMA 4W5BA 4P6GA 3I06A 2Y5BA 1TLOA 5EF4A 1GX3A 3KWBX 3LFYA 5FPWA 1POPA 3M99A 2IPPB 1VJVA 1AYVA 4G54A 1A6RA 4XR7A 1W5RA 1GECE 3ZUAA 2DZZA 3IUTA 2DCBA 1U9XA 1DEUA 4X6IA 2B1MA 1F2CA 3IEJA 2CB5A 1KFXL 4BPVA 2FTDA 3HHIA 4DMXA 1BQIA 5JA7A 2E02A 3IV2A 4K7CA 2JQGR 2C0YA 1F29A 2NQIA 4FJCA 2VFBA 2BDZA 2DC6A 3CBJA 3NHEA 2NQDB 3N3GA 1X9YA 2WBFX 3WXFA 1YK7A 4NV8A 3KFQA 3I3TA 3PDFA 4I07A 2HXZA 4AXLA 1KHQA 4KLBA 1F2AA 4GUZA 3BOWA 1GCBA 1FH0A 2YJ2A 4CZWA 3O1GA 1M6DA 4X6JA 4PADA 1Q6KA 2DCAA 2AUZA 1MIRA 2FQ9A 1YALA 1ME3A 2P86A 2XU4A 3OF9A 1U9QX 1DF0A 2FRAA 1KHPA 1F2BA 1BY8A 2PADA 3BCNA 2R9OA 1PADA 3OVZA 6PADA 3F5VA 2AVWA 3RVWA 4BS5A 3WXGA 1W4TA 1O0EA 1AYUA 4ZUXU 4NV7A 1E2TA 9PAPA 1KXRA 2ACTA 5CVOB 1AU4A 2P7UA 4X6HA 3HWNA 1BGOA 1PPOA 4YYSA 4Q8GA 2AIMA 2R9FA 1KFUL 5EGWA 2FRQA 3H8BA 2BDLA 2XU3A 3BWKA 1CJLA 3AI8A 2HH5A 3IMAA 4YVAA 2R9NA 4Q8HA 2E03A 1EWOA 2FO5A 3F75A 3BPMA 1MHWA 4QBBA 3GCBA 1JQPA 1PIPA 3KW9A 2JQFR 1CV8A 2H7JA 1TL9A 1Y08A 2HD5A 4QH6A 4W5CA 4AXMA 3MTNA 3ERVA 1CQDA 3D6SA 1AU3A 2CIOA 3S3RA 1PE6A 1ICFA 4N4ZA 1AYWA 1HUCB 1XKGA 1AU0A 1PBHA 4I04A 1GMYA 2VHSA 2DC7A 1PPPA 3QT4A 2XU5A 5CVNB 2F1GA 2R9MA 1NB3A 1CSBB 1AIMA 4CDCB 1EWPA 2E01A 2PBHA 3K24A 2VHFA 1NPZA 2G8JA 1CB5A 1PPNA 3QJ3A 4FIPA 3P5UA 2DC9A 3D9WA 4DMYA 4OEMA 4BGFA 1EF7A 2DJGB 1ATKA 1CS8A 3MORA 2FYEA 4W4UA 4YYVA 1CVZA 2NQAA 2PREA 3O0UA 8PCHA 1U9VA 5F02A 4YYWA 4CDFB 2AYOA 1NB5A 1EWLA 1PPDA 5CHVA 3N3KA 2B1NA 4QRGA 3OVXA 2AYNA 1ZIVA 2AS8A 7PCKA 1YVBA 4OELA 1GLOA 1NL6A 1QDQA 2FT2A 2XU1A 3BC3A 3C9EA 2G8EA 3OISA 3IHPA 1S4VA 1U9WA 4PP1A 2R9CA 3N4CA 2E00A 1W6FA 2YJ9A 1U5IA 2PNSA 4N8WA 4PP2E 3V6EA 1MEGA 3U8EA 3P5WA 3DF0A 3USVA 4P6EA 3TNXA 4I05A 1AECA 3RVVA 1NQCA 3QSDA 2Y6EA 4HWYA 3MHSA 2G7YA 3RVXA 2DZYA 5CVMA 1AU2A 4QRXA 2G6DA 3H89A 4CDEB 5A24A 1SNKA 4MZOA 2YJCA 3V6CA 1YT7A 5PADA 1BP4A 2GHUA 3KWZA 1THEA 1QXPA 2AU1A 4BS6A 3LTWA 4YYRA 5CHTA 2YJ8A 2BSZA 3HD3A 1SP4B 4B55A 3H7DA 3PW3A 2ATOA 2AUXA 1PXVA 4WA6A 3H8CA 2ARYA 2DC8A 4MSXA 3MHHA 2OULA 1STFE 1ME4A 4YYQA 3HHAA 1CPJA 1K3BB 3E1ZB 4FK5A 1TU6A 2YJBA 4CDDB 3WXEA 2DCCA 3PBHA 1CTEA 2GFOA 3H6SA 3KSEA 1Y4HA 4YV8A 1QOLA 1PCIA 2F7DA 4QRVA 5JH3A 1ITOA 2FUDA 3S3QA 4N79A 3BPFA 2DJFB 3K8UA 3P5VA 1NLJA 3LXSA 3PNRA 4PI3A 1MEMA 1IWDA 2O6XA 4BQVA 1QMYA 4C5PA 2R6NA 2HHNA 3KKUA 3K9MA 5K16A 3CH3X 4RY2A 4MZSA 4XUIA 1MS6A 1EWMA 2IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0R A;  1MDW A;  5J94 A;  2DCD A;  2OP3 A;  1YK8 A;  4BSQ A;  2OZ2 A;  3OF8 A;  3KX1 A;  3B79 A;  4YYU A;  1VSN A;  3P5X A;  2NQG A;  3CBK A;  3IOQ A;  3CH2 X;  1ZCM A;  4W5B A;  4P6G A;  3I06 A;  2Y5B A;  1TLO A;  5EF4 A;  3KWB X;  3LFY A;  5FPW A;  1POP A;  3M99 A;  2IPP B;  1VJV A;  1AYV A;  4G54 A;  1A6R A;  4XR7 A;  1GEC E;  3ZUA A;  2DZZ A;  3IUT A;  2DCB A;  1U9X A;  1DEU A;  4X6I A;  2B1M A;  1F2C A;  3IEJ A;  2CB5 A;  1KFX L;  4BPV A;  2FTD A;  3HHI A;  4DMX A;  1BQI A;  5JA7 A;  2E02 A;  3IV2 A;  4K7C A;  2JQG R;  2C0Y A;  1F29 A;  2NQI A;  4FJC A;  2BDZ A;  2DC6 A;  3CBJ A;  3NHE A;  2NQD B;  3N3G A;  1X9Y A;  2WBF X;  3WXF A;  1YK7 A;  3KFQ A;  3I3T A;  3PDF A;  4I07 A;  2HXZ A;  4AXL A;  1KHQ A;  4KLB A;  1F2A A;  3BOW A;  1GCB A;  1FH0 A;  2YJ2 A;  4CZW A;  3O1G A;  1M6D A;  4X6J A;  4PAD A;  1Q6K A;  2DCA A;  2AUZ A;  1MIR A;  2FQ9 A;  1YAL A;  1ME3 A;  2P86 A;  2XU4 A;  3OF9 A;  1U9Q X;  1DF0 A;  2FRA A;  1KHP A;  1F2B A;  1BY8 A;  2PAD A;  3BCN A;  2R9O A;  1PAD A;  3OVZ A;  6PAD A;  3F5V A;  2AVW A;  3RVW A;  4BS5 A;  3WXG A;  1O0E A;  1AYU A;  4ZUX U;  9PAP A;  1KXR A;  2ACT A;  5CVO B;  1AU4 A;  2P7U A;  4X6H A;  3HWN A;  1BGO A;  1PPO A;  4YYS A;  4Q8G A;  2AIM A;  2R9F A;  1KFU L;  5EGW A;  2FRQ A;  3H8B A;  2BDL A;  2XU3 A;  3BWK A;  1CJL A;  3AI8 A;  2HH5 A;  3IMA A;  4YVA A;  2R9N A;  4Q8H A;  2E03 A;  1EWO A;  2FO5 A;  3F75 A;  3BPM A;  4QBB A;  1MHW A;  3GCB A;  1JQP A;  1PIP A;  3KW9 A;  2JQF R;  1CV8 A;  2H7J A;  1TL9 A;  1Y08 A;  2HD5 A;  4QH6 A;  4W5C A;  4AXM A;  3MTN A;  3ERV A;  1CQD A;  3D6S A;  1AU3 A;  2CIO A;  3S3R A;  1PE6 A;  1ICF A;  4N4Z A;  1AYW A;  1HUC B;  1XKG A;  1AU0 A;  1PBH A;  4I04 A;  1GMY A;  2VHS A;  2DC7 A;  1PPP A;  3QT4 A;  2XU5 A;  5CVN B;  2F1G A;  2R9M A;  1NB3 A;  1CSB B;  1AIM A;  4CDC B;  1EWP A;  2E01 A;  2PBH A;  3K24 A;  2VHF A;  1NPZ A;  2G8J A;  1CB5 A;  1PPN A;  3QJ3 A;  4FIP A;  3P5U A;  2DC9 A;  4DMY A;  4OEM A;  1EF7 A;  2DJG B;  1ATK A;  1CS8 A;  3MOR A;  2FYE A;  4W4U A;  4YYV A;  1CVZ A;  2NQA A;  2PRE A;  3O0U A;  8PCH A;  1U9V A;  5F02 A;  4YYW A;  4CDF B;  2AYO A;  1NB5 A;  1EWL A;  1PPD A;  5CHV A;  3N3K A;  2B1N A;  4QRG A;  3OVX A;  2AYN A;  1ZIV A;  2AS8 A;  7PCK A;  1YVB A;  4OEL A;  1GLO A;  1NL6 A;  1QDQ A;  2FT2 A;  2XU1 A;  3BC3 A;  3C9E A;  2G8E A;  3OIS A;  3IHP A;  1S4V A;  1U9W A;  4PP1 A;  2R9C A;  3N4C A;  2E00 A;  2YJ9 A;  1U5I A;  2PNS A;  4N8W A;  4PP2 E;  3V6E A;  1MEG A;  3U8E A;  3P5W A;  3DF0 A;  3USV A;  4P6E A;  3TNX A;  4I05 A;  1AEC A;  3RVV A;  1NQC A;  3QSD A;  2Y6E A;  4HWY A;  3MHS A;  2G7Y A;  3RVX A;  2DZY A;  5CVM A;  1AU2 A;  4QRX A;  2G6D A;  3H89 A;  4CDE B;  5A24 A;  1SNK A;  4MZO A;  2YJC A;  3V6C A;  1YT7 A;  5PAD A;  1BP4 A;  2GHU A;  3KWZ A;  1THE A;  1QXP A;  2AU1 A;  4BS6 A;  4YYR A;  5CHT A;  2YJ8 A;  3HD3 A;  1SP4 B;  3H7D A;  3PW3 A;  2ATO A;  2AUX A;  1PXV A;  4WA6 A;  3H8C A;  2ARY A;  2DC8 A;  4MSX A;  3MHH A;  2OUL A;  1STF E;  1ME4 A;  4YYQ A;  3HHA A;  1CPJ A;  1K3B B;  3E1Z B;  4FK5 A;  1TU6 A;  2YJB A;  4CDD B;  3WXE A;  2DCC A;  3PBH A;  1CTE A;  2GFO A;  3H6S A;  3KSE A;  1Y4H A;  4YV8 A;  1QOL A;  1PCI A;  2F7D A;  4QRV A;  5JH3 A;  1ITO A;  2FUD A;  3S3Q A;  4N79 A;  3BPF A;  2DJF B;  3K8U A;  3P5V A;  1NLJ A;  3LXS A;  3PNR A;  4PI3 A;  1MEM A;  1IWD A;  2O6X A;  4BQV A;  1QMY A;  2R6N A;  2HHN A;  3KKU A;  3K9M A;  5K16 A;  3CH3 X;  4RY2 A;  4MZS A;  4XUI A;  1MS6 A;  1EWM A;  2IBI A; 
#chains in the Genus database with same CATH topology
 2P0R A;  1MDW A;  5J94 A;  2DCD A;  2OP3 A;  1YK8 A;  4BSQ A;  2OZ2 A;  3OF8 A;  3KX1 A;  3E9S A;  3B79 A;  4IP3 A;  4R3D A;  4YYU A;  1VSN A;  3P5X A;  3MP2 A;  2NQG A;  3CBK A;  3IOQ A;  4D8I A;  3CH2 X;  1ZCM A;  4W5B A;  3RNV A;  4D8B A;  4P6G A;  3I06 A;  2Y5B A;  1TLO A;  5EF4 A;  3KWB X;  3LFY A;  5FPW A;  1POP A;  3M99 A;  2BU3 A;  2IPP B;  1VJV A;  1AYV A;  4G54 A;  1A6R A;  4XR7 A;  1GEC E;  3ZUA A;  3MTV A;  2DZZ A;  3IUT A;  2DCB A;  4WUR A;  1U9X A;  1DEU A;  4BOZ A;  4X6I A;  2B1M A;  1F2C A;  3IEJ A;  1YZB A;  2CB5 A;  1KFX L;  4BPV A;  2FTD A;  3HHI A;  4DMX A;  5EZQ A;  1BQI A;  1DKI A;  5JA7 A;  2E02 A;  3IV2 A;  4K7C A;  2JQG R;  4D8E A;  3C0R A;  2C0Y A;  1F29 A;  2NQI A;  3W30 A;  3BB7 A;  4FJC A;  2UZJ A;  2BDZ A;  2DC6 A;  3BY4 A;  3CBJ A;  3NHE A;  2NQD B;  3N3G A;  1X9Y A;  2WBF X;  3PT2 A;  3WXF A;  4P16 A;  1YK7 A;  3KFQ A;  3I3T A;  3PDF A;  4I07 A;  2HXZ A;  4AXL A;  4REZ A;  3B21 A;  1KHQ A;  4KLB A;  1F2A A;  2Z84 A;  3BOW A;  4A5U A;  1GCB A;  1FH0 A;  2YJ2 A;  4CZW A;  3O1G A;  1M6D A;  4X6J A;  4PAD A;  1Q6K A;  2DCA A;  2AUZ A;  1MIR A;  4M0W A;  2DOS A;  2FQ9 A;  1YAL A;  1ME3 A;  2P86 A;  2XU4 A;  3OF9 A;  1U9Q X;  2AGA A;  4OVZ A;  1DF0 A;  3TRK A;  2FRA A;  1KHP A;  1F2B A;  1BY8 A;  2PAD A;  5E6J A;  4RNA A;  3BCN A;  2R9O A;  1PAD A;  3OVZ A;  3PHW A;  6PAD A;  3F5V A;  2AVW A;  3RVW A;  4BS5 A;  3PHX A;  3WXG A;  1O0E A;  1AYU A;  4ZUX U;  1PVJ A;  9PAP A;  1KXR A;  2ACT A;  5CVO B;  1AU4 A;  2P7U A;  2BTW B;  4X6H A;  3HWN A;  4RKX A;  1BGO A;  1PPO A;  4YYS A;  4Q8G A;  5KO3 A;  2AIM A;  2J7Q A;  2R9F A;  1KFU L;  5EGW A;  2FRQ A;  3H8B A;  2BDL A;  2XU3 A;  3BWK A;  2JTC A;  1CJL A;  3AI8 A;  2HH5 A;  3IMA A;  4YVA A;  2R9N A;  4Q8H A;  2E03 A;  1EWO A;  2FO5 A;  3F75 A;  3BPM A;  1MHW A;  4QBB A;  3GCB A;  1JQP A;  1PIP A;  3KW9 A;  2JQF R;  1CV8 A;  2H7J A;  1TL9 A;  1Y08 A;  2HD5 A;  4QH6 A;  4W5C A;  4AXM A;  3MTN A;  3ERV A;  1CQD A;  3D6S A;  1AU3 A;  2CIO A;  3S3R A;  1PE6 A;  1ICF A;  4N4Z A;  1AYW A;  1HUC B;  1XKG A;  1AU0 A;  1PBH A;  4I04 A;  3IFU A;  1GMY A;  2VHS A;  2DC7 A;  1PPP A;  3QT4 A;  2XU5 A;  5CVN B;  3PRM A;  2F1G A;  2R9M A;  1NB3 A;  4BOU A;  1CSB B;  1AIM A;  4CDC B;  1EWP A;  2E01 A;  2PBH A;  3K24 A;  2VHF A;  1NPZ A;  2G8J A;  1CB5 A;  1PPN A;  3QJ3 A;  3O65 A;  4FIP A;  3P5U A;  3PHU A;  2DC9 A;  4DMY A;  4OEM A;  1EF7 A;  2DJG B;  1ATK A;  1CS8 A;  3MOR A;  2FYE A;  4W4U A;  4YYV A;  4BOQ A;  1CVZ A;  2NQA A;  2PRE A;  3O0U A;  5JZE A;  8PCH A;  1U9V A;  5F02 A;  4YYW A;  4CDF B;  2AYO A;  1NB5 A;  1EWL A;  1PPD A;  5CHV A;  3N3K A;  2B1N A;  4QRG A;  3BBA A;  3OVX A;  2AYN A;  1ZIV A;  2AS8 A;  7PCK A;  1YVB A;  4BOP A;  4OEL A;  1GLO A;  1NL6 A;  1QDQ A;  2FT2 A;  2XU1 A;  3BC3 A;  3C9E A;  2G8E A;  3OIS A;  4BOS A;  3IHP A;  1S4V A;  1U9W A;  4PP1 A;  4HXD B;  2R9C A;  3TMP A;  3PRP A;  3N4C A;  2E00 A;  2YJ9 A;  1U5I A;  2PNS A;  4N8W A;  4PP2 E;  4IUM A;  3V6E A;  1MEG A;  3U8E A;  3P5W A;  3DF0 A;  3USV A;  4P6E A;  3TNX A;  4I05 A;  1AEC A;  3RVV A;  2JRI A;  1NQC A;  3QSD A;  2Y6E A;  4HWY A;  3MHS A;  2G7Y A;  3RVX A;  2DZY A;  5CVM A;  1AU2 A;  4QRX A;  1UKF A;  2J7Q C;  2G6D A;  3H89 A;  4CDE B;  4RF0 A;  4RF1 A;  5A24 A;  2HWK A;  4OVZ B;  1SNK A;  4MZO A;  5EZS A;  2YJC A;  4MM3 B;  3V6C A;  1YT7 A;  5PAD A;  1BP4 A;  2GHU A;  3KWZ A;  4GUA A;  1THE A;  4OW0 A;  1QXP A;  2AU1 A;  4BS6 A;  3OQC A;  4YYR A;  5CHT A;  2YJ8 A;  3HD3 A;  3MJ5 A;  1SP4 B;  3H7D A;  3PW3 A;  2ATO A;  2AUX A;  1PXV A;  4WA6 A;  3PSE A;  3ZNH A;  3H8C A;  2ARY A;  2DC8 A;  4MSX A;  3MHH A;  2OUL A;  1STF E;  1ME4 A;  4YYQ A;  3HHA A;  1CPJ A;  2BTW A;  1K3B B;  3E1Z B;  4FK5 A;  1TU6 A;  2YJB A;  4CDD B;  2FE8 A;  3WXE A;  2DCC A;  3PBH A;  1CTE A;  2GFO A;  3H6S A;  4ZTB A;  3KSE A;  1Y4H A;  4YV8 A;  1QOL A;  1PCI A;  2F7D A;  4QRV A;  5JH3 A;  1ITO A;  2FUD A;  3S3Q A;  4N79 A;  3BPF A;  2DJF B;  3K8U A;  3P5V A;  1NLJ A;  4PT5 A;  3LXS A;  3PNR A;  4PI3 A;  1MEM A;  1IWD A;  2O6X A;  4BQV A;  1QMY A;  2R6N A;  4XZX A;  2HHN A;  3KKU A;  4MI7 A;  3K9M A;  3W31 A;  5K16 A;  3CH3 X;  4RY2 A;  4MZS A;  4XUI A;  1MS6 A;  1EWM A;  2IBI A; 
#chains in the Genus database with same CATH homology
 2P0R A;  1MDW A;  5J94 A;  2DCD A;  2OP3 A;  1YK8 A;  4BSQ A;  2OZ2 A;  3OF8 A;  3KX1 A;  2VFC A;  3B79 A;  4YYU A;  1VSN A;  3P5X A;  2NQG A;  3CBK A;  3IOQ A;  3CH2 X;  1ZCM A;  4W5B A;  4P6G A;  3I06 A;  2Y5B A;  1TLO A;  5EF4 A;  1GX3 A;  3KWB X;  3LFY A;  5FPW A;  1POP A;  3M99 A;  2IPP B;  1VJV A;  1AYV A;  4G54 A;  1A6R A;  4XR7 A;  1W5R A;  1GEC E;  3ZUA A;  2DZZ A;  3IUT A;  2DCB A;  1U9X A;  1DEU A;  4X6I A;  2B1M A;  1F2C A;  3IEJ A;  2CB5 A;  1KFX L;  4BPV A;  2FTD A;  3HHI A;  4DMX A;  1BQI A;  5JA7 A;  2E02 A;  3IV2 A;  4K7C A;  2JQG R;  2C0Y A;  1F29 A;  2NQI A;  4FJC A;  2VFB A;  2BDZ A;  2DC6 A;  3CBJ A;  3NHE A;  2NQD B;  3N3G A;  1X9Y A;  2WBF X;  3WXF A;  1YK7 A;  4NV8 A;  3KFQ A;  3I3T A;  3PDF A;  4I07 A;  2HXZ A;  4AXL A;  1KHQ A;  4KLB A;  1F2A A;  4GUZ A;  3BOW A;  1GCB A;  1FH0 A;  2YJ2 A;  4CZW A;  3O1G A;  1M6D A;  4X6J A;  4PAD A;  1Q6K A;  2DCA A;  2AUZ A;  1MIR A;  2FQ9 A;  1YAL A;  1ME3 A;  2P86 A;  2XU4 A;  3OF9 A;  1U9Q X;  1DF0 A;  2FRA A;  1KHP A;  1F2B A;  1BY8 A;  2PAD A;  3BCN A;  2R9O A;  1PAD A;  3OVZ A;  6PAD A;  3F5V A;  2AVW A;  3RVW A;  4BS5 A;  3WXG A;  1W4T A;  1O0E A;  1AYU A;  4ZUX U;  4NV7 A;  1E2T A;  9PAP A;  1KXR A;  2ACT A;  5CVO B;  1AU4 A;  2P7U A;  4X6H A;  3HWN A;  1BGO A;  1PPO A;  4YYS A;  4Q8G A;  2AIM A;  2R9F A;  1KFU L;  5EGW A;  2FRQ A;  3H8B A;  2BDL A;  2XU3 A;  3BWK A;  1CJL A;  3AI8 A;  2HH5 A;  3IMA A;  4YVA A;  2R9N A;  4Q8H A;  2E03 A;  1EWO A;  2FO5 A;  3F75 A;  3BPM A;  1MHW A;  4QBB A;  3GCB A;  1JQP A;  1PIP A;  3KW9 A;  2JQF R;  1CV8 A;  2H7J A;  1TL9 A;  1Y08 A;  2HD5 A;  4QH6 A;  4W5C A;  4AXM A;  3MTN A;  3ERV A;  1CQD A;  3D6S A;  1AU3 A;  2CIO A;  3S3R A;  1PE6 A;  1ICF A;  4N4Z A;  1AYW A;  1HUC B;  1XKG A;  1AU0 A;  1PBH A;  4I04 A;  1GMY A;  2VHS A;  2DC7 A;  1PPP A;  3QT4 A;  2XU5 A;  5CVN B;  2F1G A;  2R9M A;  1NB3 A;  1CSB B;  1AIM A;  4CDC B;  1EWP A;  2E01 A;  2PBH A;  3K24 A;  2VHF A;  1NPZ A;  2G8J A;  1CB5 A;  1PPN A;  3QJ3 A;  4FIP A;  3P5U A;  2DC9 A;  3D9W A;  4DMY A;  4OEM A;  4BGF A;  1EF7 A;  2DJG B;  1ATK A;  1CS8 A;  3MOR A;  2FYE A;  4W4U A;  4YYV A;  1CVZ A;  2NQA A;  2PRE A;  3O0U A;  8PCH A;  1U9V A;  5F02 A;  4YYW A;  4CDF B;  2AYO A;  1NB5 A;  1EWL A;  1PPD A;  5CHV A;  3N3K A;  2B1N A;  4QRG A;  3OVX A;  2AYN A;  1ZIV A;  2AS8 A;  7PCK A;  1YVB A;  4OEL A;  1GLO A;  1NL6 A;  1QDQ A;  2FT2 A;  2XU1 A;  3BC3 A;  3C9E A;  2G8E A;  3OIS A;  3IHP A;  1S4V A;  1U9W A;  4PP1 A;  2R9C A;  3N4C A;  2E00 A;  1W6F A;  2YJ9 A;  1U5I A;  2PNS A;  4N8W A;  4PP2 E;  3V6E A;  1MEG A;  3U8E A;  3P5W A;  3DF0 A;  3USV A;  4P6E A;  3TNX A;  4I05 A;  1AEC A;  3RVV A;  1NQC A;  3QSD A;  2Y6E A;  4HWY A;  3MHS A;  2G7Y A;  3RVX A;  2DZY A;  5CVM A;  1AU2 A;  4QRX A;  2G6D A;  3H89 A;  4CDE B;  5A24 A;  1SNK A;  4MZO A;  2YJC A;  3V6C A;  1YT7 A;  5PAD A;  1BP4 A;  2GHU A;  3KWZ A;  1THE A;  1QXP A;  2AU1 A;  4BS6 A;  3LTW A;  4YYR A;  5CHT A;  2YJ8 A;  2BSZ A;  3HD3 A;  1SP4 B;  4B55 A;  3H7D A;  3PW3 A;  2ATO A;  2AUX A;  1PXV A;  4WA6 A;  3H8C A;  2ARY A;  2DC8 A;  4MSX A;  3MHH A;  2OUL A;  1STF E;  1ME4 A;  4YYQ A;  3HHA A;  1CPJ A;  1K3B B;  3E1Z B;  4FK5 A;  1TU6 A;  2YJB A;  4CDD B;  3WXE A;  2DCC A;  3PBH A;  1CTE A;  2GFO A;  3H6S A;  3KSE A;  1Y4H A;  4YV8 A;  1QOL A;  1PCI A;  2F7D A;  4QRV A;  5JH3 A;  1ITO A;  2FUD A;  3S3Q A;  4N79 A;  3BPF A;  2DJF B;  3K8U A;  3P5V A;  1NLJ A;  3LXS A;  3PNR A;  4PI3 A;  1MEM A;  1IWD A;  2O6X A;  4BQV A;  1QMY A;  4C5P A;  2R6N A;  2HHN A;  3KKU A;  3K9M A;  5K16 A;  3CH3 X;  4RY2 A;  4MZS A;  4XUI A;  1MS6 A;  1EWM A;  2IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...