3ERVA

Crystal structure of an putative c39-like peptidase from bacillus anthracis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
200
Chain Sequence
DEKVILSNVPFIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMNDGVRGNPNEGFVGNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKSIEELYKSVKAGQPVVIITNATFAPLDEDEFTTWETNNGDVSITYNEHCVVLIGYDQESVYIRDPLKDSLDVKVPREKFEQAWVQMGSQAISYVKRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative C39-like peptidase
publication title Crystal structure of an putative C39-like peptidase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 67
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13529 Peptidase_C39_2 Peptidase_C39 like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ervA00
1CS8A 3PBHA 1X9YA 3NHEA 1AYUA 2ATOA 2IPPB 1PIPA 2OZ2A 1BY8A 3QJ3A 1THEA 3KSEA 3OF9A 4HWYA 1ME4A 3E1ZB 4OELA 1TL9A 2IBIA 5EGWA 2VHSA 5J94A 2AIMA 4QRVA 4YYRA 2YJ9A 1YK8A 1NPZA 3BC3A 3LXSA 1Y4HA 4YV8A 2YJCA 1IWDA 5CVOB 1BGOA 4FK5A 4X6JA 3LFYA 4QH6A 1CV8A 2YJ2A 2FRAA 3S3RA 4I05A 1AU3A 1NB5A 2HHNA 3HWNA 1NLJA 3ZUAA 2HH5A 3OVZA 1BP4A 2FUDA 2DCBA 1PADA 1F2BA 1ATKA 3C9EA 1MIRA 3V6CA 1KHPA 3U8EA 2GHUA 2PADA 3H89A 2JQGR 3IHPA 3WXGA 3H7DA 1KFXL 1MS6A 2ARYA 4DMYA 4PP2E 1MDWA 2F1GA 4WA6A 4YYUA 1NL6A 2HXZA 3WXEA 5JH3A 6PADA 4Q8HA 1M6DA 1YT7A 3KFQA 2FQ9A 1BQIA 1U9XA 1PPOA 3DF0A 2DZZA 1ICFA 2VHFA 1VJVA 3ERVA 2DZYA 1DF0A 4AXLA 3P5VA 4PP1A 1AU4A 5JA7A 1AU2A 4W5CA 3N4CA 3HD3A 5FPWA 1NB3A 3HHAA 3RVWA 4YYSA 2BDLA 2E00A 5EF4A 3IV2A 4G54A 1JQPA 1AU0A 2WBFX 2BDZA 7PCKA 3K24A 3KX1A 2R9MA 2P0RA 1CJLA 1GMYA 1EWMA 2OP3A 3V6EA 2R9FA 2GFOA 3H6SA 2DC8A 2DC6A 1EWLA 4DMXA 1AYWA 4BPVA 1PE6A 4X6IA 4YYQA 2P86A 1PPDA 1DEUA 2DJGB 3BPMA 2AS8A 1STFE 5A24A 1VSNA 2R9CA 2FTDA 4QBBA 3KKUA 2XU5A 2H7JA 3OISA 2E03A 1O0EA 3F75A 3H8CA 1EWPA 2ACTA 2NQIA 2G8JA 2XU1A 1ITOA 4QRXA 3IUTA 2R6NA 1CPJA 1TLOA 2E02A 3I06A 2G6DA 2AVWA 2HD5A 4XR7A 4CDDB 3S3QA 1AECA 3OVXA 3IOQA 1MEGA 3KWZA 3M99A 1F2AA 4CDEB 2NQGA 2AUXA 2G7YA 4X6HA 4PI3A 4PADA 1U5IA 1XKGA 5PADA 4BSQA 4CDFB 1CSBB 5K16A 1YVBA 4I07A 1MEMA 3B79A 1PBHA 4FIPA 9PAPA 3WXFA 4YVAA 1PPNA 2FRQA 4KLBA 1CTEA 1U9VA 4AXMA 2CIOA 3AI8A 1F29A 1ZIVA 3RVVA 3BOWA 1TU6A 2DC7A 3N3GA 1A6RA 3MHHA 8PCHA 1EWOA 4Q8GA 4W4UA 3PW3A 2R9NA 1ME3A 1CQDA 3P5XA 4BS6A 3O0UA 4FJCA 3MTNA 1GCBA 2DJFB 5CVMA 4QRGA 1AYVA 3USVA 1SP4B 2DC9A 1U9WA 4BS5A 4OEMA 3O1GA 4N79A 3RVXA 1KFUL 4I04A 1POPA 2XU3A 2PBHA 4P6GA 2DCCA 2YJBA 2JQFR 3MORA 1PCIA 1F2CA 1GLOA 3K8UA 1YK7A 3N3KA 2NQAA 2AYOA 4BQVA 2DCDA 3BCNA 3IMAA 2DCAA 3BPFA 1QMYA 1PPPA 3CBJA 3OF8A 3HHIA 1AIMA 2O6XA 1HUCB 1PXVA 2G8EA 2OULA 2PNSA 1Q6KA 2B1MA 3PNRA 1CVZA 3KWBX 3D6SA 3GCBA 1GECE 2R9OA 2AUZA 2B1NA 2Y5BA 3P5WA 4MZOA 1QOLA 2FYEA 2F7DA 5CVNB 5CHVA 4P6EA 1KXRA 3IEJA 1QDQA 1S4VA 3QT4A 2PREA 1CB5A 5CHTA 1NQCA 2Y6EA 4W5BA 3CH3X 3KW9A 4XUIA 2NQDB 3CBKA 4MZSA 4ZUXU 2YJ8A 4CZWA 3MHSA 1QXPA 1K3BB 2FT2A 2E01A 1FH0A 3F5VA 5F02A 1YALA 3P5UA 3K9MA 4N8WA 3H8BA 3I3TA 2AU1A 4RY2A 1MHWA 1U9QX 1EF7A 4N4ZA 1SNKA 3QSDA 2CB5A 2P7UA 2AYNA 4YYWA 3CH2X 4YYVA 4K7CA 2XU4A 4MSXA 3TNXA 2FO5A 4CDCB 3BWKA 1ZCMA 2C0YA 1Y08A 3PDFA 1KHQA
chains in the Genus database with same CATH superfamily
4A5UA 1CS8A 3PBHA 1X9YA 3NHEA 1AYUA 2ATOA 2IPPB 1PIPA 2OZ2A 1BY8A 3QJ3A 1THEA 3KSEA 4IUMA 3OF9A 4HWYA 1ME4A 3E1ZB 4OELA 1TL9A 2IBIA 5EGWA 5EZSA 2VHSA 5J94A 2AIMA 4QRVA 4YYRA 2YJ9A 1YK8A 2BTWB 3PRMA 1NPZA 3BC3A 3RNVA 3LXSA 1Y4HA 4YV8A 4IP3A 2YJCA 2DOSA 1IWDA 5CVOB 4BOPA 1BGOA 4FK5A 4X6JA 3LFYA 4QH6A 1CV8A 2YJ2A 3PSEA 2AGAA 2FRAA 2HWKA 3S3RA 4I05A 1AU3A 1NB5A 4RF0A 2HHNA 2BTWA 3HWNA 1NLJA 3W31A 3ZUAA 5EZQA 2HH5A 3OVZA 1BP4A 3PT2A 2FUDA 2DCBA 1PADA 1F2BA 1ATKA 3C9EA 3E9SA 1MIRA 3V6CA 1KHPA 3U8EA 2GHUA 2PADA 3H89A 4MM3B 2JQGR 3IHPA 3WXGA 4R3DA 3H7DA 1KFXL 1MS6A 2ARYA 4DMYA 3BY4A 4PP2E 1MDWA 2F1GA 4WA6A 4YYUA 1NL6A 2HXZA 3WXEA 5JH3A 6PADA 4Q8HA 1M6DA 1YT7A 4MI7A 3KFQA 2FQ9A 1BQIA 1U9XA 1PPOA 3DF0A 2DZZA 1DKIA 1ICFA 2VHFA 1VJVA 3ERVA 3TMPA 2DZYA 1DF0A 4AXLA 3P5VA 4PP1A 1AU4A 5JA7A 1AU2A 4W5CA 3N4CA 3HD3A 3O65A 5FPWA 1NB3A 2BU3A 3HHAA 3RVWA 4YYSA 1PVJA 2BDLA 2E00A 5EF4A 3IV2A 4G54A 1JQPA 4BOQA 1AU0A 2WBFX 2BDZA 7PCKA 3W30A 3K24A 3KX1A 2R9MA 2P0RA 1CJLA 1GMYA 1EWMA 2OP3A 3V6EA 4P16A 4OVZA 2R9FA 2GFOA 3H6SA 2DC8A 2DC6A 1EWLA 4DMXA 1AYWA 4BPVA 1PE6A 4X6IA 4YYQA 2P86A 1PPDA 4M0WA 4D8EA 1DEUA 2DJGB 3BBAA 3BPMA 2AS8A 1STFE 5A24A 1VSNA 2R9CA 2FTDA 4QBBA 3KKUA 2XU5A 2H7JA 3OISA 2E03A 1O0EA 3F75A 3H8CA 1EWPA 2ACTA 2NQIA 2G8JA 2XU1A 3PRPA 1ITOA 4QRXA 3IUTA 2R6NA 4BOUA 1CPJA 3ZNHA 1TLOA 2E02A 3I06A 2G6DA 2AVWA 4RF1A 4RNAA 2HD5A 4XR7A 4OW0A 4CDDB 3S3QA 1AECA 3OVXA 3IOQA 1MEGA 3KWZA 3M99A 1F2AA 3B21A 4CDEB 2NQGA 2AUXA 2G7YA 4X6HA 4PI3A 4PADA 1U5IA 1XKGA 5PADA 3C0RA 4BSQA 4CDFB 1CSBB 5K16A 1YVBA 4I07A 1MEMA 3TRKA 3B79A 1PBHA 4FIPA 9PAPA 3WXFA 4YVAA 1PPNA 3PHXA 5JZEA 2FRQA 4KLBA 1CTEA 4ZTBA 1U9VA 4AXMA 2CIOA 3AI8A 1F29A 1ZIVA 3RVVA 3BOWA 1TU6A 2DC7A 3N3GA 1A6RA 3PHUA 3MHHA 8PCHA 1EWOA 4D8IA 4Q8GA 4W4UA 3PW3A 2R9NA 1ME3A 1CQDA 3P5XA 4BS6A 4D8BA 3MP2A 3O0UA 3OQCA 4FJCA 3MTNA 2J7QC 4HXDB 1GCBA 2JRIA 2DJFB 3PHWA 5CVMA 3MJ5A 5KO3A 4QRGA 4BOZA 1AYVA 3USVA 1SP4B 2DC9A 1U9WA 4BS5A 4OEMA 3O1GA 4N79A 4XZXA 2UZJA 3RVXA 3IFUA 1KFUL 4I04A 4BOSA 1POPA 2XU3A 2PBHA 4P6GA 2DCCA 2YJBA 2JQFR 3MORA 1PCIA 1F2CA 1GLOA 3K8UA 1YK7A 3N3KA 2NQAA 4PT5A 2AYOA 4BQVA 2DCDA 3BCNA 3IMAA 2DCAA 3BPFA 1QMYA 1PPPA 4GUAA 3CBJA 3OF8A 3HHIA 1AIMA 2O6XA 1HUCB 1PXVA 2G8EA 3BB7A 2OULA 2PNSA 1Q6KA 2B1MA 3PNRA 4WURA 2JTCA 1CVZA 3KWBX 3D6SA 2FE8A 3GCBA 4REZA 1GECE 2R9OA 2AUZA 2B1NA 2Y5BA 3P5WA 4MZOA 1QOLA 2FYEA 2F7DA 5CVNB 5CHVA 4P6EA 3MTVA 1KXRA 3IEJA 1QDQA 1S4VA 3QT4A 2PREA 1CB5A 5CHTA 1NQCA 2Y6EA 4W5BA 3CH3X 3KW9A 4XUIA 2NQDB 3CBKA 2Z84A 4MZSA 4ZUXU 2YJ8A 4CZWA 3MHSA 1QXPA 1K3BB 1YZBA 2FT2A 2E01A 1FH0A 3F5VA 5F02A 1YALA 3P5UA 3K9MA 4N8WA 3H8BA 3I3TA 2AU1A 4RY2A 1MHWA 1U9QX 1EF7A 4N4ZA 1SNKA 3QSDA 2CB5A 2P7UA 2AYNA 4YYWA 3CH2X 4YYVA 2J7QA 4K7CA 2XU4A 1UKFA 4MSXA 3TNXA 4OVZB 2FO5A 4CDCB 3BWKA 1ZCMA 2C0YA 4RKXA 1Y08A 3PDFA 5E6JA 1KHQA
chains in the Genus database with same CATH topology
1CS8A 3PBHA 1X9YA 3NHEA 1AYUA 2ATOA 2IPPB 1PIPA 2OZ2A 1BY8A 3QJ3A 1THEA 3KSEA 3OF9A 4HWYA 1ME4A 3E1ZB 4OELA 1TL9A 2IBIA 5EGWA 3LTWA 2VHSA 5J94A 2AIMA 4QRVA 4YYRA 2YJ9A 1YK8A 1NPZA 3BC3A 3LXSA 1Y4HA 4YV8A 2YJCA 1IWDA 5CVOB 1BGOA 4FK5A 4X6JA 3LFYA 4QH6A 1CV8A 2YJ2A 2FRAA 3S3RA 4I05A 1AU3A 1NB5A 2HHNA 3HWNA 1NLJA 3ZUAA 2HH5A 3OVZA 1BP4A 2FUDA 2DCBA 1PADA 1F2BA 1ATKA 3C9EA 1MIRA 3V6CA 1KHPA 3U8EA 2GHUA 2PADA 3H89A 2JQGR 3IHPA 3WXGA 3H7DA 1KFXL 1MS6A 2ARYA 4DMYA 4PP2E 1MDWA 2F1GA 4WA6A 4YYUA 1NL6A 2VFBA 2HXZA 3WXEA 5JH3A 6PADA 4Q8HA 1M6DA 1YT7A 3KFQA 2FQ9A 1BQIA 1U9XA 1PPOA 3DF0A 2DZZA 1ICFA 2VHFA 1VJVA 3ERVA 2DZYA 1DF0A 4AXLA 3P5VA 4PP1A 1AU4A 5JA7A 1AU2A 4W5CA 3N4CA 3HD3A 5FPWA 1NB3A 3HHAA 3RVWA 4YYSA 2BDLA 2E00A 5EF4A 3IV2A 4G54A 1JQPA 1AU0A 2WBFX 2BDZA 7PCKA 3K24A 3KX1A 2R9MA 2P0RA 1CJLA 1GMYA 1EWMA 1W6FA 2OP3A 3V6EA 2R9FA 2GFOA 3H6SA 2DC8A 2DC6A 1EWLA 4DMXA 1AYWA 4BPVA 1PE6A 4X6IA 4YYQA 2P86A 1PPDA 1DEUA 2DJGB 3BPMA 2AS8A 1STFE 5A24A 1VSNA 2R9CA 2FTDA 4QBBA 3KKUA 2XU5A 2H7JA 3OISA 2E03A 1O0EA 3F75A 3H8CA 1EWPA 4C5PA 2ACTA 2NQIA 2G8JA 2XU1A 1ITOA 4QRXA 3IUTA 2R6NA 1CPJA 1TLOA 2E02A 3I06A 2G6DA 2AVWA 4GUZA 2HD5A 4XR7A 4CDDB 3S3QA 1AECA 3OVXA 3IOQA 1MEGA 3KWZA 3M99A 1F2AA 4CDEB 2NQGA 2AUXA 2G7YA 4X6HA 4B55A 4PI3A 4PADA 1U5IA 1XKGA 5PADA 4BSQA 4CDFB 1CSBB 5K16A 1YVBA 4I07A 1MEMA 3B79A 1PBHA 3D9WA 4FIPA 9PAPA 3WXFA 4YVAA 1PPNA 2FRQA 4KLBA 1CTEA 1U9VA 4AXMA 2CIOA 3AI8A 1F29A 1ZIVA 3RVVA 3BOWA 1TU6A 2DC7A 3N3GA 1A6RA 3MHHA 8PCHA 1EWOA 4Q8GA 4W4UA 3PW3A 2R9NA 1ME3A 1CQDA 3P5XA 4BS6A 3O0UA 4FJCA 3MTNA 1GX3A 1GCBA 2DJFB 5CVMA 4QRGA 2BSZA 1AYVA 3USVA 1SP4B 2DC9A 1U9WA 4BS5A 4OEMA 3O1GA 4N79A 3RVXA 1KFUL 4I04A 1POPA 2XU3A 2PBHA 4P6GA 2DCCA 2YJBA 2JQFR 3MORA 1PCIA 1F2CA 1GLOA 3K8UA 1YK7A 3N3KA 2NQAA 2AYOA 4BQVA 2DCDA 3BCNA 3IMAA 2DCAA 3BPFA 1QMYA 1PPPA 3CBJA 3OF8A 3HHIA 1AIMA 2O6XA 1HUCB 1PXVA 2G8EA 2OULA 2PNSA 1Q6KA 2B1MA 1W4TA 3PNRA 1CVZA 3KWBX 3D6SA 3GCBA 1GECE 2R9OA 2AUZA 2B1NA 2Y5BA 3P5WA 4MZOA 1QOLA 2FYEA 2F7DA 5CVNB 5CHVA 4NV7A 4P6EA 1KXRA 3IEJA 1QDQA 1S4VA 3QT4A 2PREA 1CB5A 5CHTA 1NQCA 2Y6EA 4W5BA 3CH3X 3KW9A 4XUIA 2NQDB 3CBKA 4MZSA 4ZUXU 2YJ8A 4CZWA 3MHSA 1QXPA 1K3BB 2FT2A 2E01A 1FH0A 3F5VA 5F02A 1YALA 3P5UA 3K9MA 4N8WA 3H8BA 3I3TA 2AU1A 2VFCA 4BGFA 4RY2A 1MHWA 1U9QX 1EF7A 4N4ZA 1SNKA 3QSDA 2CB5A 2P7UA 2AYNA 4YYWA 1W5RA 3CH2X 4YYVA 4NV8A 1E2TA 4K7CA 2XU4A 4MSXA 3TNXA 2FO5A 4CDCB 3BWKA 1ZCMA 2C0YA 1Y08A 3PDFA 1KHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CS8 A;  3PBH A;  1X9Y A;  3NHE A;  1AYU A;  2ATO A;  2IPP B;  1PIP A;  2OZ2 A;  1BY8 A;  3QJ3 A;  1THE A;  3KSE A;  3OF9 A;  4HWY A;  1ME4 A;  3E1Z B;  4OEL A;  1TL9 A;  2IBI A;  5EGW A;  2VHS A;  5J94 A;  2AIM A;  4QRV A;  4YYR A;  2YJ9 A;  1YK8 A;  1NPZ A;  3BC3 A;  3LXS A;  1Y4H A;  4YV8 A;  2YJC A;  1IWD A;  5CVO B;  1BGO A;  4FK5 A;  4X6J A;  3LFY A;  4QH6 A;  1CV8 A;  2YJ2 A;  2FRA A;  3S3R A;  4I05 A;  1AU3 A;  1NB5 A;  2HHN A;  3HWN A;  1NLJ A;  3ZUA A;  2HH5 A;  3OVZ A;  1BP4 A;  2FUD A;  2DCB A;  1PAD A;  1F2B A;  1ATK A;  3C9E A;  1MIR A;  3V6C A;  1KHP A;  3U8E A;  2GHU A;  2PAD A;  3H89 A;  2JQG R;  3IHP A;  3WXG A;  3H7D A;  1KFX L;  1MS6 A;  2ARY A;  4DMY A;  4PP2 E;  1MDW A;  2F1G A;  4WA6 A;  4YYU A;  1NL6 A;  2HXZ A;  3WXE A;  5JH3 A;  6PAD A;  4Q8H A;  1M6D A;  1YT7 A;  3KFQ A;  2FQ9 A;  1BQI A;  1U9X A;  1PPO A;  3DF0 A;  2DZZ A;  1ICF A;  2VHF A;  1VJV A;  3ERV A;  2DZY A;  1DF0 A;  4AXL A;  3P5V A;  4PP1 A;  1AU4 A;  5JA7 A;  1AU2 A;  4W5C A;  3N4C A;  3HD3 A;  5FPW A;  1NB3 A;  3HHA A;  3RVW A;  4YYS A;  2BDL A;  2E00 A;  5EF4 A;  3IV2 A;  4G54 A;  1JQP A;  1AU0 A;  2WBF X;  2BDZ A;  7PCK A;  3K24 A;  3KX1 A;  2R9M A;  2P0R A;  1CJL A;  1GMY A;  1EWM A;  2OP3 A;  3V6E A;  2R9F A;  2GFO A;  3H6S A;  2DC8 A;  2DC6 A;  1EWL A;  4DMX A;  1AYW A;  4BPV A;  1PE6 A;  4X6I A;  4YYQ A;  2P86 A;  1PPD A;  1DEU A;  2DJG B;  3BPM A;  2AS8 A;  1STF E;  5A24 A;  1VSN A;  2R9C A;  2FTD A;  4QBB A;  3KKU A;  2XU5 A;  2H7J A;  3OIS A;  2E03 A;  1O0E A;  3F75 A;  3H8C A;  1EWP A;  2ACT A;  2NQI A;  2G8J A;  2XU1 A;  1ITO A;  4QRX A;  3IUT A;  2R6N A;  1CPJ A;  1TLO A;  2E02 A;  3I06 A;  2G6D A;  2AVW A;  2HD5 A;  4XR7 A;  4CDD B;  3S3Q A;  1AEC A;  3OVX A;  3IOQ A;  1MEG A;  3KWZ A;  3M99 A;  1F2A A;  4CDE B;  2NQG A;  2AUX A;  2G7Y A;  4X6H A;  4PI3 A;  4PAD A;  1U5I A;  1XKG A;  5PAD A;  4BSQ A;  4CDF B;  1CSB B;  5K16 A;  1YVB A;  4I07 A;  1MEM A;  3B79 A;  1PBH A;  4FIP A;  9PAP A;  3WXF A;  4YVA A;  1PPN A;  2FRQ A;  4KLB A;  1CTE A;  1U9V A;  4AXM A;  2CIO A;  3AI8 A;  1F29 A;  1ZIV A;  3RVV A;  3BOW A;  1TU6 A;  2DC7 A;  3N3G A;  1A6R A;  3MHH A;  8PCH A;  1EWO A;  4Q8G A;  4W4U A;  3PW3 A;  2R9N A;  1ME3 A;  1CQD A;  3P5X A;  4BS6 A;  3O0U A;  4FJC A;  3MTN A;  1GCB A;  2DJF B;  5CVM A;  4QRG A;  1AYV A;  3USV A;  1SP4 B;  2DC9 A;  1U9W A;  4BS5 A;  4OEM A;  3O1G A;  4N79 A;  3RVX A;  1KFU L;  4I04 A;  1POP A;  2XU3 A;  2PBH A;  4P6G A;  2DCC A;  2YJB A;  2JQF R;  3MOR A;  1PCI A;  1F2C A;  1GLO A;  3K8U A;  1YK7 A;  3N3K A;  2NQA A;  2AYO A;  4BQV A;  2DCD A;  3BCN A;  3IMA A;  2DCA A;  3BPF A;  1QMY A;  1PPP A;  3CBJ A;  3OF8 A;  3HHI A;  1AIM A;  2O6X A;  1HUC B;  1PXV A;  2G8E A;  2OUL A;  2PNS A;  1Q6K A;  2B1M A;  3PNR A;  1CVZ A;  3KWB X;  3D6S A;  3GCB A;  1GEC E;  2R9O A;  2AUZ A;  2B1N A;  2Y5B A;  3P5W A;  4MZO A;  1QOL A;  2FYE A;  2F7D A;  5CVN B;  5CHV A;  4P6E A;  1KXR A;  3IEJ A;  1QDQ A;  1S4V A;  3QT4 A;  2PRE A;  1CB5 A;  5CHT A;  1NQC A;  2Y6E A;  4W5B A;  3CH3 X;  3KW9 A;  4XUI A;  2NQD B;  3CBK A;  4MZS A;  4ZUX U;  2YJ8 A;  4CZW A;  3MHS A;  1QXP A;  1K3B B;  2FT2 A;  2E01 A;  1FH0 A;  3F5V A;  5F02 A;  1YAL A;  3P5U A;  3K9M A;  4N8W A;  3H8B A;  3I3T A;  2AU1 A;  4RY2 A;  1MHW A;  1U9Q X;  1EF7 A;  4N4Z A;  1SNK A;  3QSD A;  2CB5 A;  2P7U A;  2AYN A;  4YYW A;  3CH2 X;  4YYV A;  4K7C A;  2XU4 A;  4MSX A;  3TNX A;  2FO5 A;  4CDC B;  3BWK A;  1ZCM A;  2C0Y A;  1Y08 A;  3PDF A;  1KHQ A; 
#chains in the Genus database with same CATH topology
 4A5U A;  1CS8 A;  3PBH A;  1X9Y A;  3NHE A;  1AYU A;  2ATO A;  2IPP B;  1PIP A;  2OZ2 A;  1BY8 A;  3QJ3 A;  1THE A;  3KSE A;  4IUM A;  3OF9 A;  4HWY A;  1ME4 A;  3E1Z B;  4OEL A;  1TL9 A;  2IBI A;  5EGW A;  5EZS A;  2VHS A;  5J94 A;  2AIM A;  4QRV A;  4YYR A;  2YJ9 A;  1YK8 A;  2BTW B;  3PRM A;  1NPZ A;  3BC3 A;  3RNV A;  3LXS A;  1Y4H A;  4YV8 A;  4IP3 A;  2YJC A;  2DOS A;  1IWD A;  5CVO B;  4BOP A;  1BGO A;  4FK5 A;  4X6J A;  3LFY A;  4QH6 A;  1CV8 A;  2YJ2 A;  3PSE A;  2AGA A;  2FRA A;  2HWK A;  3S3R A;  4I05 A;  1AU3 A;  1NB5 A;  4RF0 A;  2HHN A;  2BTW A;  3HWN A;  1NLJ A;  3W31 A;  3ZUA A;  5EZQ A;  2HH5 A;  3OVZ A;  1BP4 A;  3PT2 A;  2FUD A;  2DCB A;  1PAD A;  1F2B A;  1ATK A;  3C9E A;  3E9S A;  1MIR A;  3V6C A;  1KHP A;  3U8E A;  2GHU A;  2PAD A;  3H89 A;  4MM3 B;  2JQG R;  3IHP A;  3WXG A;  4R3D A;  3H7D A;  1KFX L;  1MS6 A;  2ARY A;  4DMY A;  3BY4 A;  4PP2 E;  1MDW A;  2F1G A;  4WA6 A;  4YYU A;  1NL6 A;  2HXZ A;  3WXE A;  5JH3 A;  6PAD A;  4Q8H A;  1M6D A;  1YT7 A;  4MI7 A;  3KFQ A;  2FQ9 A;  1BQI A;  1U9X A;  1PPO A;  3DF0 A;  2DZZ A;  1DKI A;  1ICF A;  2VHF A;  1VJV A;  3ERV A;  3TMP A;  2DZY A;  1DF0 A;  4AXL A;  3P5V A;  4PP1 A;  1AU4 A;  5JA7 A;  1AU2 A;  4W5C A;  3N4C A;  3HD3 A;  3O65 A;  5FPW A;  1NB3 A;  2BU3 A;  3HHA A;  3RVW A;  4YYS A;  1PVJ A;  2BDL A;  2E00 A;  5EF4 A;  3IV2 A;  4G54 A;  1JQP A;  4BOQ A;  1AU0 A;  2WBF X;  2BDZ A;  7PCK A;  3W30 A;  3K24 A;  3KX1 A;  2R9M A;  2P0R A;  1CJL A;  1GMY A;  1EWM A;  2OP3 A;  3V6E A;  4P16 A;  4OVZ A;  2R9F A;  2GFO A;  3H6S A;  2DC8 A;  2DC6 A;  1EWL A;  4DMX A;  1AYW A;  4BPV A;  1PE6 A;  4X6I A;  4YYQ A;  2P86 A;  1PPD A;  4M0W A;  4D8E A;  1DEU A;  2DJG B;  3BBA A;  3BPM A;  2AS8 A;  1STF E;  5A24 A;  1VSN A;  2R9C A;  2FTD A;  4QBB A;  3KKU A;  2XU5 A;  2H7J A;  3OIS A;  2E03 A;  1O0E A;  3F75 A;  3H8C A;  1EWP A;  2ACT A;  2NQI A;  2G8J A;  2XU1 A;  3PRP A;  1ITO A;  4QRX A;  3IUT A;  2R6N A;  4BOU A;  1CPJ A;  3ZNH A;  1TLO A;  2E02 A;  3I06 A;  2G6D A;  2AVW A;  4RF1 A;  4RNA A;  2HD5 A;  4XR7 A;  4OW0 A;  4CDD B;  3S3Q A;  1AEC A;  3OVX A;  3IOQ A;  1MEG A;  3KWZ A;  3M99 A;  1F2A A;  3B21 A;  4CDE B;  2NQG A;  2AUX A;  2G7Y A;  4X6H A;  4PI3 A;  4PAD A;  1U5I A;  1XKG A;  5PAD A;  3C0R A;  4BSQ A;  4CDF B;  1CSB B;  5K16 A;  1YVB A;  4I07 A;  1MEM A;  3TRK A;  3B79 A;  1PBH A;  4FIP A;  9PAP A;  3WXF A;  4YVA A;  1PPN A;  3PHX A;  5JZE A;  2FRQ A;  4KLB A;  1CTE A;  4ZTB A;  1U9V A;  4AXM A;  2CIO A;  3AI8 A;  1F29 A;  1ZIV A;  3RVV A;  3BOW A;  1TU6 A;  2DC7 A;  3N3G A;  1A6R A;  3PHU A;  3MHH A;  8PCH A;  1EWO A;  4D8I A;  4Q8G A;  4W4U A;  3PW3 A;  2R9N A;  1ME3 A;  1CQD A;  3P5X A;  4BS6 A;  4D8B A;  3MP2 A;  3O0U A;  3OQC A;  4FJC A;  3MTN A;  2J7Q C;  4HXD B;  1GCB A;  2JRI A;  2DJF B;  3PHW A;  5CVM A;  3MJ5 A;  5KO3 A;  4QRG A;  4BOZ A;  1AYV A;  3USV A;  1SP4 B;  2DC9 A;  1U9W A;  4BS5 A;  4OEM A;  3O1G A;  4N79 A;  4XZX A;  2UZJ A;  3RVX A;  3IFU A;  1KFU L;  4I04 A;  4BOS A;  1POP A;  2XU3 A;  2PBH A;  4P6G A;  2DCC A;  2YJB A;  2JQF R;  3MOR A;  1PCI A;  1F2C A;  1GLO A;  3K8U A;  1YK7 A;  3N3K A;  2NQA A;  4PT5 A;  2AYO A;  4BQV A;  2DCD A;  3BCN A;  3IMA A;  2DCA A;  3BPF A;  1QMY A;  1PPP A;  4GUA A;  3CBJ A;  3OF8 A;  3HHI A;  1AIM A;  2O6X A;  1HUC B;  1PXV A;  2G8E A;  3BB7 A;  2OUL A;  2PNS A;  1Q6K A;  2B1M A;  3PNR A;  4WUR A;  2JTC A;  1CVZ A;  3KWB X;  3D6S A;  2FE8 A;  3GCB A;  4REZ A;  1GEC E;  2R9O A;  2AUZ A;  2B1N A;  2Y5B A;  3P5W A;  4MZO A;  1QOL A;  2FYE A;  2F7D A;  5CVN B;  5CHV A;  4P6E A;  3MTV A;  1KXR A;  3IEJ A;  1QDQ A;  1S4V A;  3QT4 A;  2PRE A;  1CB5 A;  5CHT A;  1NQC A;  2Y6E A;  4W5B A;  3CH3 X;  3KW9 A;  4XUI A;  2NQD B;  3CBK A;  2Z84 A;  4MZS A;  4ZUX U;  2YJ8 A;  4CZW A;  3MHS A;  1QXP A;  1K3B B;  1YZB A;  2FT2 A;  2E01 A;  1FH0 A;  3F5V A;  5F02 A;  1YAL A;  3P5U A;  3K9M A;  4N8W A;  3H8B A;  3I3T A;  2AU1 A;  4RY2 A;  1MHW A;  1U9Q X;  1EF7 A;  4N4Z A;  1SNK A;  3QSD A;  2CB5 A;  2P7U A;  2AYN A;  4YYW A;  3CH2 X;  4YYV A;  2J7Q A;  4K7C A;  2XU4 A;  1UKF A;  4MSX A;  3TNX A;  4OVZ B;  2FO5 A;  4CDC B;  3BWK A;  1ZCM A;  2C0Y A;  4RKX A;  1Y08 A;  3PDF A;  5E6J A;  1KHQ A; 
#chains in the Genus database with same CATH homology
 1CS8 A;  3PBH A;  1X9Y A;  3NHE A;  1AYU A;  2ATO A;  2IPP B;  1PIP A;  2OZ2 A;  1BY8 A;  3QJ3 A;  1THE A;  3KSE A;  3OF9 A;  4HWY A;  1ME4 A;  3E1Z B;  4OEL A;  1TL9 A;  2IBI A;  5EGW A;  3LTW A;  2VHS A;  5J94 A;  2AIM A;  4QRV A;  4YYR A;  2YJ9 A;  1YK8 A;  1NPZ A;  3BC3 A;  3LXS A;  1Y4H A;  4YV8 A;  2YJC A;  1IWD A;  5CVO B;  1BGO A;  4FK5 A;  4X6J A;  3LFY A;  4QH6 A;  1CV8 A;  2YJ2 A;  2FRA A;  3S3R A;  4I05 A;  1AU3 A;  1NB5 A;  2HHN A;  3HWN A;  1NLJ A;  3ZUA A;  2HH5 A;  3OVZ A;  1BP4 A;  2FUD A;  2DCB A;  1PAD A;  1F2B A;  1ATK A;  3C9E A;  1MIR A;  3V6C A;  1KHP A;  3U8E A;  2GHU A;  2PAD A;  3H89 A;  2JQG R;  3IHP A;  3WXG A;  3H7D A;  1KFX L;  1MS6 A;  2ARY A;  4DMY A;  4PP2 E;  1MDW A;  2F1G A;  4WA6 A;  4YYU A;  1NL6 A;  2VFB A;  2HXZ A;  3WXE A;  5JH3 A;  6PAD A;  4Q8H A;  1M6D A;  1YT7 A;  3KFQ A;  2FQ9 A;  1BQI A;  1U9X A;  1PPO A;  3DF0 A;  2DZZ A;  1ICF A;  2VHF A;  1VJV A;  3ERV A;  2DZY A;  1DF0 A;  4AXL A;  3P5V A;  4PP1 A;  1AU4 A;  5JA7 A;  1AU2 A;  4W5C A;  3N4C A;  3HD3 A;  5FPW A;  1NB3 A;  3HHA A;  3RVW A;  4YYS A;  2BDL A;  2E00 A;  5EF4 A;  3IV2 A;  4G54 A;  1JQP A;  1AU0 A;  2WBF X;  2BDZ A;  7PCK A;  3K24 A;  3KX1 A;  2R9M A;  2P0R A;  1CJL A;  1GMY A;  1EWM A;  1W6F A;  2OP3 A;  3V6E A;  2R9F A;  2GFO A;  3H6S A;  2DC8 A;  2DC6 A;  1EWL A;  4DMX A;  1AYW A;  4BPV A;  1PE6 A;  4X6I A;  4YYQ A;  2P86 A;  1PPD A;  1DEU A;  2DJG B;  3BPM A;  2AS8 A;  1STF E;  5A24 A;  1VSN A;  2R9C A;  2FTD A;  4QBB A;  3KKU A;  2XU5 A;  2H7J A;  3OIS A;  2E03 A;  1O0E A;  3F75 A;  3H8C A;  1EWP A;  4C5P A;  2ACT A;  2NQI A;  2G8J A;  2XU1 A;  1ITO A;  4QRX A;  3IUT A;  2R6N A;  1CPJ A;  1TLO A;  2E02 A;  3I06 A;  2G6D A;  2AVW A;  4GUZ A;  2HD5 A;  4XR7 A;  4CDD B;  3S3Q A;  1AEC A;  3OVX A;  3IOQ A;  1MEG A;  3KWZ A;  3M99 A;  1F2A A;  4CDE B;  2NQG A;  2AUX A;  2G7Y A;  4X6H A;  4B55 A;  4PI3 A;  4PAD A;  1U5I A;  1XKG A;  5PAD A;  4BSQ A;  4CDF B;  1CSB B;  5K16 A;  1YVB A;  4I07 A;  1MEM A;  3B79 A;  1PBH A;  3D9W A;  4FIP A;  9PAP A;  3WXF A;  4YVA A;  1PPN A;  2FRQ A;  4KLB A;  1CTE A;  1U9V A;  4AXM A;  2CIO A;  3AI8 A;  1F29 A;  1ZIV A;  3RVV A;  3BOW A;  1TU6 A;  2DC7 A;  3N3G A;  1A6R A;  3MHH A;  8PCH A;  1EWO A;  4Q8G A;  4W4U A;  3PW3 A;  2R9N A;  1ME3 A;  1CQD A;  3P5X A;  4BS6 A;  3O0U A;  4FJC A;  3MTN A;  1GX3 A;  1GCB A;  2DJF B;  5CVM A;  4QRG A;  2BSZ A;  1AYV A;  3USV A;  1SP4 B;  2DC9 A;  1U9W A;  4BS5 A;  4OEM A;  3O1G A;  4N79 A;  3RVX A;  1KFU L;  4I04 A;  1POP A;  2XU3 A;  2PBH A;  4P6G A;  2DCC A;  2YJB A;  2JQF R;  3MOR A;  1PCI A;  1F2C A;  1GLO A;  3K8U A;  1YK7 A;  3N3K A;  2NQA A;  2AYO A;  4BQV A;  2DCD A;  3BCN A;  3IMA A;  2DCA A;  3BPF A;  1QMY A;  1PPP A;  3CBJ A;  3OF8 A;  3HHI A;  1AIM A;  2O6X A;  1HUC B;  1PXV A;  2G8E A;  2OUL A;  2PNS A;  1Q6K A;  2B1M A;  1W4T A;  3PNR A;  1CVZ A;  3KWB X;  3D6S A;  3GCB A;  1GEC E;  2R9O A;  2AUZ A;  2B1N A;  2Y5B A;  3P5W A;  4MZO A;  1QOL A;  2FYE A;  2F7D A;  5CVN B;  5CHV A;  4NV7 A;  4P6E A;  1KXR A;  3IEJ A;  1QDQ A;  1S4V A;  3QT4 A;  2PRE A;  1CB5 A;  5CHT A;  1NQC A;  2Y6E A;  4W5B A;  3CH3 X;  3KW9 A;  4XUI A;  2NQD B;  3CBK A;  4MZS A;  4ZUX U;  2YJ8 A;  4CZW A;  3MHS A;  1QXP A;  1K3B B;  2FT2 A;  2E01 A;  1FH0 A;  3F5V A;  5F02 A;  1YAL A;  3P5U A;  3K9M A;  4N8W A;  3H8B A;  3I3T A;  2AU1 A;  2VFC A;  4BGF A;  4RY2 A;  1MHW A;  1U9Q X;  1EF7 A;  4N4Z A;  1SNK A;  3QSD A;  2CB5 A;  2P7U A;  2AYN A;  4YYW A;  1W5R A;  3CH2 X;  4YYV A;  4NV8 A;  1E2T A;  4K7C A;  2XU4 A;  4MSX A;  3TNX A;  2FO5 A;  4CDC B;  3BWK A;  1ZCM A;  2C0Y A;  1Y08 A;  3PDF A;  1KHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...