2DC7A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca042 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN B
total genus 74
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc7A00
2CB5A 1X9YA 4OELA 2PADA 2YJCA 3IV2A 3P5UA 1O0EA 1PXVA 4N79A 1ITOA 2DCCA 4Q8HA 3PW3A 3MORA 1QMYA 4CDDB 2HHNA 2DZZA 2FT2A 2FYEA 1STFE 3S3RA 4CDEB 1U9XA 2VHFA 2HD5A 2F7DA 2DC7A 5A24A 2DCBA 1YT7A 2XU3A 4G54A 4WA6A 2YJ8A 3BOWA 2DJFB 1HUCB 1TLOA 3LFYA 2R6NA 3KX1A 4BQVA 9PAPA 4N8WA 2AYOA 1Q6KA 6PADA 3S3QA 1CB5A 3K8UA 1FH0A 2PNSA 1K3BB 2CIOA 4QRVA 2HH5A 2R9MA 3PBHA 2P0RA 1YK8A 4FK5A 4QBBA 4W5BA 5F02A 1CQDA 2R9FA 3E1ZB 4YYUA 2AUZA 3RVVA 2B1NA 4P6EA 1PBHA 1TU6A 2PBHA 2JQFR 3N3GA 3OF9A 3ERVA 5CHTA 1AU3A 3BWKA 2FO5A 1CVZA 4CDCB 1CSBB 2GHUA 2BDLA 2ATOA 1PADA 3HD3A 3OISA 3N4CA 4DMYA 2XU4A 3PNRA 5JA7A 4BSQA 4QRXA 3BCNA 4YVAA 1U9WA 1Y08A 3HHIA 3M99A 5CHVA 3LXSA 2DC8A 2DC6A 2E02A 2WBFX 4OEMA 4CDFB 2E00A 1MEGA 3HHAA 2AYNA 4QH6A 4YYRA 1PPOA 1CTEA 4N4ZA 2PREA 1S4VA 3GCBA 3USVA 2OULA 3RVXA 1PPNA 4YYSA 2XU1A 2ACTA 3WXFA 2NQDB 3CH3X 1SP4B 1SNKA 2C0YA 1CV8A 2AVWA 5FPWA 2DCDA 2FUDA 1NPZA 3WXEA 3I06A 2DC9A 1NB3A 4P6GA 1EF7A 3H7DA 4ZUXU 2R9OA 3IHPA 4KLBA 4X6IA 1EWMA 3WXGA 3ZUAA 1F2CA 3BPMA 2P86A 2G7YA 1KHPA 1YALA 3OVZA 2R9CA 1ZIVA 2F1GA 1NQCA 1BGOA 2P7UA 2IPPB 1AIMA 1AYUA 1MS6A 3N3KA 3KW9A 1DEUA 3K24A 3TNXA 2G8EA 3P5XA 3OVXA 3HWNA 4BPVA 1PE6A 2FRQA 3U8EA 1GECE 8PCHA 2R9NA 1MDWA 1BY8A 1YVBA 3H8CA 1KFUL 4FJCA 3IEJA 1A6RA 2Y5BA 4I05A 3IUTA 1PIPA 3D6SA 1AECA 4MSXA 1EWPA 1KXRA 3CBKA 4PI3A 2NQGA 2GFOA 4K7CA 4AXMA 3PDFA 1GCBA 2DCAA 4RY2A 4X6HA 3KKUA 3O0UA 4Q8GA 3H8BA 1THEA 2XU5A 3F5VA 3KWBX 1EWOA 2YJ9A 2YJBA 3KFQA 4YYVA 4HWYA 2IBIA 2DZYA 5J94A 3F75A 3QJ3A 2B1MA 4X6JA 1IWDA 2E01A 1GMYA 3QT4A 5K16A 3IOQA 2HXZA 1M6DA 5EF4A 4BS6A 1GLOA 1VSNA 1Y4HA 4BS5A 3BPFA 1F2BA 2O6XA 2G8JA 1KFXL 1NB5A 3V6EA 1QXPA 1MEMA 5PADA 2AUXA 2JQGR 3NHEA 4XR7A 1BP4A 2H7JA 1KHQA 3KWZA 1PPPA 1AU4A 1AYVA 4W4UA 2VHSA 1CPJA 3IMAA 3B79A 5EGWA 3OF8A 1ATKA 3CH2X 3AI8A 3QSDA 1EWLA 3MHSA 1QDQA 4MZOA 1MIRA 1PCIA 4I04A 2ARYA 3O1GA 1POPA 2AS8A 1U9QX 1QOLA 3I3TA 1TL9A 1ME4A 2E03A 2OP3A 3KSEA 4XUIA 1AU2A 1F29A 1DF0A 3P5WA 2AIMA 2FTDA 1CJLA 1U9VA 1AYWA 4PP2E 5CVOB 2OZ2A 4PP1A 1U5IA 1CS8A 2AU1A 4YYWA 7PCKA 1ZCMA 1NLJA 3CBJA 3V6CA 1NL6A 4YYQA 5JH3A 2NQAA 3DF0A 3H89A 1ICFA 1JQPA 1YK7A 2NQIA 4YV8A 2G6DA 1ME3A 2FRAA 5CVMA 5CVNB 3MTNA 2BDZA 3RVWA 1MHWA 1VJVA 2FQ9A 4W5CA 3K9MA 1BQIA 3C9EA 4DMXA 2YJ2A 4PADA 1PPDA 4I07A 4AXLA 3P5VA 1F2AA 4FIPA 2Y6EA 4MZSA 1XKGA 2DJGB 3MHHA 1AU0A 3BC3A 4CZWA 4QRGA 3H6SA
chains in the Genus database with same CATH superfamily
2CB5A 1X9YA 4OELA 2PADA 2YJCA 3MTVA 3IV2A 3P5UA 1O0EA 1PXVA 4N79A 1ITOA 2DCCA 4Q8HA 3PHWA 3MORA 1QMYA 3PW3A 4REZA 4CDDB 4WURA 3B21A 2HHNA 2DZZA 2FT2A 3TRKA 2FYEA 1STFE 3S3RA 4CDEB 1U9XA 2VHFA 2HD5A 2F7DA 3PHUA 5JZEA 5EZSA 2DC7A 4RNAA 3C0RA 5A24A 3PSEA 2DCBA 1YT7A 2XU3A 4G54A 4WA6A 2YJ8A 3BOWA 2DJFB 1HUCB 1TLOA 3LFYA 2R6NA 2UZJA 3KX1A 4BQVA 9PAPA 4N8WA 2AYOA 1Q6KA 6PADA 3S3QA 1CB5A 4D8BA 5EZQA 3K8UA 1FH0A 2PNSA 1K3BB 2CIOA 4QRVA 2HH5A 2R9MA 3PBHA 2P0RA 1YK8A 4FK5A 4QBBA 4W5BA 5F02A 3BBAA 1CQDA 2R9FA 3TMPA 3E1ZB 4ZTBA 4YYUA 2AUZA 3RVVA 2B1NA 4P6EA 1PBHA 1TU6A 3BY4A 2PBHA 2JQFR 3N3GA 1DKIA 3OF9A 3ERVA 5CHTA 1AU3A 3BWKA 2FO5A 1CVZA 3PT2A 4CDCB 1CSBB 2J7QC 2GHUA 2BDLA 4BOPA 2ATOA 1PADA 3HD3A 3OISA 3N4CA 4DMYA 2XU4A 3PNRA 5JA7A 2BTWA 3OQCA 4RF0A 4BSQA 3RNVA 4QRXA 3O65A 3BCNA 3IFUA 4YVAA 1U9WA 4IP3A 1Y08A 4IUMA 3HHIA 3M99A 5CHVA 3LXSA 2DC8A 2DC6A 2E02A 2WBFX 4OEMA 4CDFB 2E00A 1MEGA 3HHAA 4MM3B 2AYNA 4QH6A 4YYRA 1PPOA 1CTEA 4HXDB 4N4ZA 2FE8A 2PREA 1S4VA 3GCBA 4A5UA 3USVA 3PHXA 2OULA 3RVXA 1PPNA 4YYSA 3MJ5A 2XU1A 1YZBA 2ACTA 3WXFA 2NQDB 3CH3X 1SP4B 1PVJA 1SNKA 2C0YA 1CV8A 2AVWA 4M0WA 5FPWA 2DCDA 2FUDA 1NPZA 2JTCA 3WXEA 3I06A 2DC9A 3W30A 1NB3A 4P6GA 4BOSA 1EF7A 3H7DA 4ZUXU 2R9OA 3IHPA 4KLBA 4X6IA 1EWMA 3WXGA 3ZUAA 1F2CA 3BPMA 2P86A 2G7YA 1KHPA 2HWKA 1YALA 3OVZA 2DOSA 2R9CA 1ZIVA 2F1GA 1NQCA 4XZXA 1BGOA 2P7UA 2IPPB 1AIMA 1AYUA 1MS6A 3MP2A 3N3KA 3KW9A 1DEUA 3K24A 4BOZA 3TNXA 2G8EA 3P5XA 3OVXA 3HWNA 4BPVA 1PE6A 2FRQA 3U8EA 1GECE 8PCHA 2R9NA 1MDWA 1BY8A 1YVBA 3H8CA 1KFUL 4FJCA 3IEJA 1A6RA 2AGAA 2Y5BA 4I05A 3IUTA 1PIPA 4RF1A 3D6SA 5E6JA 1AECA 4MSXA 2Z84A 3BB7A 4GUAA 1EWPA 1KXRA 3CBKA 4PI3A 2NQGA 2GFOA 4K7CA 4AXMA 3PDFA 1GCBA 2DCAA 4RY2A 4X6HA 3KKUA 3O0UA 4Q8GA 3H8BA 1THEA 2XU5A 3F5VA 3KWBX 1EWOA 2YJ9A 2YJBA 3KFQA 4YYVA 4HWYA 2IBIA 2DZYA 5J94A 3F75A 4PT5A 3QJ3A 2B1MA 4X6JA 1IWDA 2E01A 1GMYA 4P16A 4OVZB 3QT4A 5K16A 3IOQA 2HXZA 1M6DA 5EF4A 4BS6A 1GLOA 1VSNA 1Y4HA 4BS5A 3BPFA 1F2BA 2JRIA 2O6XA 2G8JA 1KFXL 1UKFA 1NB5A 2J7QA 3V6EA 1QXPA 1MEMA 4OVZA 5PADA 4OW0A 2AUXA 2JQGR 3NHEA 4XR7A 1BP4A 2H7JA 1KHQA 3KWZA 1PPPA 1AU4A 1AYVA 4W4UA 2VHSA 1CPJA 3IMAA 3B79A 5EGWA 3OF8A 5KO3A 1ATKA 3PRMA 3CH2X 3AI8A 3QSDA 1EWLA 3MHSA 1QDQA 4MZOA 1MIRA 1PCIA 4I04A 2ARYA 3PRPA 3O1GA 1POPA 2AS8A 1U9QX 1QOLA 4D8EA 3I3TA 1TL9A 1ME4A 2E03A 2OP3A 3KSEA 4XUIA 2BTWB 1AU2A 1F29A 1DF0A 3P5WA 2AIMA 2FTDA 1CJLA 1U9VA 1AYWA 4PP2E 4BOQA 4RKXA 5CVOB 4MI7A 2BU3A 2OZ2A 4PP1A 1U5IA 1CS8A 2AU1A 4YYWA 7PCKA 1ZCMA 1NLJA 3CBJA 3V6CA 1NL6A 4YYQA 5JH3A 2NQAA 3DF0A 3H89A 3W31A 1ICFA 1JQPA 1YK7A 2NQIA 4YV8A 2G6DA 1ME3A 2FRAA 5CVMA 5CVNB 3MTNA 2BDZA 3RVWA 1MHWA 1VJVA 2FQ9A 4W5CA 3K9MA 1BQIA 3C9EA 4DMXA 2YJ2A 4PADA 1PPDA 4I07A 4AXLA 3P5VA 4D8IA 1F2AA 4FIPA 3E9SA 3ZNHA 2Y6EA 4MZSA 1XKGA 2DJGB 3MHHA 1AU0A 3BC3A 4R3DA 4BOUA 4CZWA 4QRGA 3H6SA
chains in the Genus database with same CATH topology
2CB5A 1X9YA 4OELA 2PADA 2YJCA 3IV2A 3P5UA 1O0EA 1PXVA 4N79A 1ITOA 2DCCA 4Q8HA 3PW3A 3MORA 1QMYA 4CDDB 2HHNA 2DZZA 2FT2A 2FYEA 1STFE 1W6FA 3S3RA 2VFCA 4CDEB 1U9XA 2VHFA 2HD5A 2F7DA 2DC7A 5A24A 2DCBA 1YT7A 2XU3A 4G54A 4WA6A 2YJ8A 3BOWA 2DJFB 1HUCB 1TLOA 3LFYA 2R6NA 3KX1A 4BQVA 9PAPA 4N8WA 2AYOA 1Q6KA 6PADA 3S3QA 1CB5A 3K8UA 4NV8A 1FH0A 2PNSA 1K3BB 2CIOA 4QRVA 2HH5A 2R9MA 3PBHA 2P0RA 1YK8A 4FK5A 4QBBA 4W5BA 5F02A 1CQDA 2R9FA 3E1ZB 4YYUA 2AUZA 3RVVA 2B1NA 4GUZA 4P6EA 1PBHA 1TU6A 2PBHA 2JQFR 3N3GA 3OF9A 3ERVA 5CHTA 1AU3A 1W4TA 3BWKA 2FO5A 1CVZA 4CDCB 1CSBB 2GHUA 2BDLA 2ATOA 1PADA 3HD3A 3OISA 3N4CA 4DMYA 2XU4A 3PNRA 5JA7A 4BSQA 4QRXA 3BCNA 4YVAA 1U9WA 1Y08A 3HHIA 3M99A 5CHVA 3LXSA 2BSZA 2DC8A 2DC6A 2E02A 2WBFX 4OEMA 4CDFB 2E00A 1MEGA 3HHAA 2AYNA 4QH6A 4YYRA 1PPOA 4C5PA 1CTEA 4N4ZA 2PREA 1S4VA 3GCBA 3USVA 2OULA 3RVXA 1PPNA 4YYSA 1E2TA 2XU1A 2ACTA 3WXFA 2NQDB 3LTWA 3CH3X 1SP4B 1SNKA 2C0YA 1CV8A 2AVWA 5FPWA 2DCDA 2FUDA 1NPZA 3WXEA 3I06A 2DC9A 1NB3A 4P6GA 1EF7A 3H7DA 4ZUXU 2R9OA 3IHPA 4KLBA 4X6IA 1EWMA 3WXGA 3ZUAA 1F2CA 3BPMA 2P86A 2G7YA 1KHPA 1YALA 3OVZA 2R9CA 1ZIVA 2F1GA 1NQCA 1BGOA 2P7UA 2IPPB 1AIMA 1AYUA 1MS6A 4NV7A 3N3KA 3KW9A 1DEUA 3K24A 3TNXA 2G8EA 3P5XA 3OVXA 3HWNA 4BPVA 1PE6A 2FRQA 3U8EA 1GECE 8PCHA 2R9NA 1MDWA 1BY8A 1YVBA 3H8CA 1KFUL 4FJCA 3IEJA 1A6RA 2Y5BA 4I05A 3IUTA 1PIPA 3D6SA 1AECA 4MSXA 4BGFA 1EWPA 1KXRA 3CBKA 4PI3A 2NQGA 2GFOA 4K7CA 4AXMA 3PDFA 1GCBA 2DCAA 4RY2A 4X6HA 3KKUA 3O0UA 4Q8GA 3H8BA 1THEA 2XU5A 3F5VA 3KWBX 1EWOA 2YJ9A 2YJBA 3KFQA 4YYVA 4HWYA 2IBIA 2DZYA 5J94A 3F75A 3QJ3A 2B1MA 4X6JA 1IWDA 2E01A 1GMYA 3QT4A 5K16A 3IOQA 2HXZA 1M6DA 5EF4A 4BS6A 1GLOA 1VSNA 1Y4HA 4BS5A 3BPFA 1F2BA 2O6XA 2G8JA 1KFXL 1NB5A 3V6EA 1QXPA 1MEMA 5PADA 2AUXA 2JQGR 3NHEA 4XR7A 1BP4A 2H7JA 1KHQA 3KWZA 1PPPA 1AU4A 2VFBA 1AYVA 4W4UA 2VHSA 1CPJA 3IMAA 3B79A 5EGWA 3OF8A 1ATKA 3CH2X 3AI8A 3QSDA 1EWLA 3MHSA 1QDQA 4MZOA 1MIRA 1PCIA 4I04A 2ARYA 3O1GA 1POPA 2AS8A 1U9QX 1QOLA 3I3TA 1TL9A 1ME4A 2E03A 2OP3A 3KSEA 4XUIA 1AU2A 1F29A 1DF0A 3P5WA 2AIMA 2FTDA 1CJLA 1U9VA 1AYWA 4PP2E 5CVOB 2OZ2A 4PP1A 1U5IA 1CS8A 2AU1A 4YYWA 7PCKA 1ZCMA 1NLJA 3CBJA 3V6CA 1NL6A 4YYQA 5JH3A 2NQAA 3DF0A 3H89A 1ICFA 1JQPA 1YK7A 2NQIA 4YV8A 2G6DA 1ME3A 2FRAA 1W5RA 5CVMA 5CVNB 3MTNA 2BDZA 3RVWA 1MHWA 1VJVA 1GX3A 2FQ9A 4W5CA 3K9MA 1BQIA 3C9EA 4DMXA 2YJ2A 4PADA 1PPDA 4I07A 4AXLA 3P5VA 1F2AA 4FIPA 2Y6EA 4MZSA 1XKGA 2DJGB 3MHHA 4B55A 1AU0A 3BC3A 4CZWA 3D9WA 4QRGA 3H6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CB5 A;  1X9Y A;  4OEL A;  2PAD A;  2YJC A;  3IV2 A;  3P5U A;  1O0E A;  1PXV A;  4N79 A;  1ITO A;  2DCC A;  4Q8H A;  3PW3 A;  3MOR A;  1QMY A;  4CDD B;  2HHN A;  2DZZ A;  2FT2 A;  2FYE A;  1STF E;  3S3R A;  4CDE B;  1U9X A;  2VHF A;  2HD5 A;  2F7D A;  2DC7 A;  5A24 A;  2DCB A;  1YT7 A;  2XU3 A;  4G54 A;  4WA6 A;  2YJ8 A;  3BOW A;  2DJF B;  1HUC B;  1TLO A;  3LFY A;  2R6N A;  3KX1 A;  4BQV A;  9PAP A;  4N8W A;  2AYO A;  1Q6K A;  6PAD A;  3S3Q A;  1CB5 A;  3K8U A;  1FH0 A;  2PNS A;  1K3B B;  2CIO A;  4QRV A;  2HH5 A;  2R9M A;  3PBH A;  2P0R A;  1YK8 A;  4FK5 A;  4QBB A;  4W5B A;  5F02 A;  1CQD A;  2R9F A;  3E1Z B;  4YYU A;  2AUZ A;  3RVV A;  2B1N A;  4P6E A;  1PBH A;  1TU6 A;  2PBH A;  2JQF R;  3N3G A;  3OF9 A;  3ERV A;  5CHT A;  1AU3 A;  3BWK A;  2FO5 A;  1CVZ A;  4CDC B;  1CSB B;  2GHU A;  2BDL A;  2ATO A;  1PAD A;  3HD3 A;  3OIS A;  3N4C A;  4DMY A;  2XU4 A;  3PNR A;  5JA7 A;  4BSQ A;  4QRX A;  3BCN A;  4YVA A;  1U9W A;  1Y08 A;  3HHI A;  3M99 A;  5CHV A;  3LXS A;  2DC8 A;  2DC6 A;  2E02 A;  2WBF X;  4OEM A;  4CDF B;  2E00 A;  1MEG A;  3HHA A;  2AYN A;  4QH6 A;  4YYR A;  1PPO A;  1CTE A;  4N4Z A;  2PRE A;  1S4V A;  3GCB A;  3USV A;  2OUL A;  3RVX A;  1PPN A;  4YYS A;  2XU1 A;  2ACT A;  3WXF A;  2NQD B;  3CH3 X;  1SP4 B;  1SNK A;  2C0Y A;  1CV8 A;  2AVW A;  5FPW A;  2DCD A;  2FUD A;  1NPZ A;  3WXE A;  3I06 A;  2DC9 A;  1NB3 A;  4P6G A;  1EF7 A;  3H7D A;  4ZUX U;  2R9O A;  3IHP A;  4KLB A;  4X6I A;  1EWM A;  3WXG A;  3ZUA A;  1F2C A;  3BPM A;  2P86 A;  2G7Y A;  1KHP A;  1YAL A;  3OVZ A;  2R9C A;  1ZIV A;  2F1G A;  1NQC A;  1BGO A;  2P7U A;  2IPP B;  1AIM A;  1AYU A;  1MS6 A;  3N3K A;  3KW9 A;  1DEU A;  3K24 A;  3TNX A;  2G8E A;  3P5X A;  3OVX A;  3HWN A;  4BPV A;  1PE6 A;  2FRQ A;  3U8E A;  1GEC E;  8PCH A;  2R9N A;  1MDW A;  1BY8 A;  1YVB A;  3H8C A;  1KFU L;  4FJC A;  3IEJ A;  1A6R A;  2Y5B A;  4I05 A;  3IUT A;  1PIP A;  3D6S A;  1AEC A;  4MSX A;  1EWP A;  1KXR A;  3CBK A;  4PI3 A;  2NQG A;  2GFO A;  4K7C A;  4AXM A;  3PDF A;  1GCB A;  2DCA A;  4RY2 A;  4X6H A;  3KKU A;  3O0U A;  4Q8G A;  3H8B A;  1THE A;  2XU5 A;  3F5V A;  3KWB X;  1EWO A;  2YJ9 A;  2YJB A;  3KFQ A;  4YYV A;  4HWY A;  2IBI A;  2DZY A;  5J94 A;  3F75 A;  3QJ3 A;  2B1M A;  4X6J A;  1IWD A;  2E01 A;  1GMY A;  3QT4 A;  5K16 A;  3IOQ A;  2HXZ A;  1M6D A;  5EF4 A;  4BS6 A;  1GLO A;  1VSN A;  1Y4H A;  4BS5 A;  3BPF A;  1F2B A;  2O6X A;  2G8J A;  1KFX L;  1NB5 A;  3V6E A;  1QXP A;  1MEM A;  5PAD A;  2AUX A;  2JQG R;  3NHE A;  4XR7 A;  1BP4 A;  2H7J A;  1KHQ A;  3KWZ A;  1PPP A;  1AU4 A;  1AYV A;  4W4U A;  2VHS A;  1CPJ A;  3IMA A;  3B79 A;  5EGW A;  3OF8 A;  1ATK A;  3CH2 X;  3AI8 A;  3QSD A;  1EWL A;  3MHS A;  1QDQ A;  4MZO A;  1MIR A;  1PCI A;  4I04 A;  2ARY A;  3O1G A;  1POP A;  2AS8 A;  1U9Q X;  1QOL A;  3I3T A;  1TL9 A;  1ME4 A;  2E03 A;  2OP3 A;  3KSE A;  4XUI A;  1AU2 A;  1F29 A;  1DF0 A;  3P5W A;  2AIM A;  2FTD A;  1CJL A;  1U9V A;  1AYW A;  4PP2 E;  5CVO B;  2OZ2 A;  4PP1 A;  1U5I A;  1CS8 A;  2AU1 A;  4YYW A;  7PCK A;  1ZCM A;  1NLJ A;  3CBJ A;  3V6C A;  1NL6 A;  4YYQ A;  5JH3 A;  2NQA A;  3DF0 A;  3H89 A;  1ICF A;  1JQP A;  1YK7 A;  2NQI A;  4YV8 A;  2G6D A;  1ME3 A;  2FRA A;  5CVM A;  5CVN B;  3MTN A;  2BDZ A;  3RVW A;  1MHW A;  1VJV A;  2FQ9 A;  4W5C A;  3K9M A;  1BQI A;  3C9E A;  4DMX A;  2YJ2 A;  4PAD A;  1PPD A;  4I07 A;  4AXL A;  3P5V A;  1F2A A;  4FIP A;  2Y6E A;  4MZS A;  1XKG A;  2DJG B;  3MHH A;  1AU0 A;  3BC3 A;  4CZW A;  4QRG A;  3H6S A; 
#chains in the Genus database with same CATH topology
 2CB5 A;  1X9Y A;  4OEL A;  2PAD A;  2YJC A;  3MTV A;  3IV2 A;  3P5U A;  1O0E A;  1PXV A;  4N79 A;  1ITO A;  2DCC A;  4Q8H A;  3PHW A;  3MOR A;  1QMY A;  3PW3 A;  4REZ A;  4CDD B;  4WUR A;  3B21 A;  2HHN A;  2DZZ A;  2FT2 A;  3TRK A;  2FYE A;  1STF E;  3S3R A;  4CDE B;  1U9X A;  2VHF A;  2HD5 A;  2F7D A;  3PHU A;  5JZE A;  5EZS A;  2DC7 A;  4RNA A;  3C0R A;  5A24 A;  3PSE A;  2DCB A;  1YT7 A;  2XU3 A;  4G54 A;  4WA6 A;  2YJ8 A;  3BOW A;  2DJF B;  1HUC B;  1TLO A;  3LFY A;  2R6N A;  2UZJ A;  3KX1 A;  4BQV A;  9PAP A;  4N8W A;  2AYO A;  1Q6K A;  6PAD A;  3S3Q A;  1CB5 A;  4D8B A;  5EZQ A;  3K8U A;  1FH0 A;  2PNS A;  1K3B B;  2CIO A;  4QRV A;  2HH5 A;  2R9M A;  3PBH A;  2P0R A;  1YK8 A;  4FK5 A;  4QBB A;  4W5B A;  5F02 A;  3BBA A;  1CQD A;  2R9F A;  3TMP A;  3E1Z B;  4ZTB A;  4YYU A;  2AUZ A;  3RVV A;  2B1N A;  4P6E A;  1PBH A;  1TU6 A;  3BY4 A;  2PBH A;  2JQF R;  3N3G A;  1DKI A;  3OF9 A;  3ERV A;  5CHT A;  1AU3 A;  3BWK A;  2FO5 A;  1CVZ A;  3PT2 A;  4CDC B;  1CSB B;  2J7Q C;  2GHU A;  2BDL A;  4BOP A;  2ATO A;  1PAD A;  3HD3 A;  3OIS A;  3N4C A;  4DMY A;  2XU4 A;  3PNR A;  5JA7 A;  2BTW A;  3OQC A;  4RF0 A;  4BSQ A;  3RNV A;  4QRX A;  3O65 A;  3BCN A;  3IFU A;  4YVA A;  1U9W A;  4IP3 A;  1Y08 A;  4IUM A;  3HHI A;  3M99 A;  5CHV A;  3LXS A;  2DC8 A;  2DC6 A;  2E02 A;  2WBF X;  4OEM A;  4CDF B;  2E00 A;  1MEG A;  3HHA A;  4MM3 B;  2AYN A;  4QH6 A;  4YYR A;  1PPO A;  1CTE A;  4HXD B;  4N4Z A;  2FE8 A;  2PRE A;  1S4V A;  3GCB A;  4A5U A;  3USV A;  3PHX A;  2OUL A;  3RVX A;  1PPN A;  4YYS A;  3MJ5 A;  2XU1 A;  1YZB A;  2ACT A;  3WXF A;  2NQD B;  3CH3 X;  1SP4 B;  1PVJ A;  1SNK A;  2C0Y A;  1CV8 A;  2AVW A;  4M0W A;  5FPW A;  2DCD A;  2FUD A;  1NPZ A;  2JTC A;  3WXE A;  3I06 A;  2DC9 A;  3W30 A;  1NB3 A;  4P6G A;  4BOS A;  1EF7 A;  3H7D A;  4ZUX U;  2R9O A;  3IHP A;  4KLB A;  4X6I A;  1EWM A;  3WXG A;  3ZUA A;  1F2C A;  3BPM A;  2P86 A;  2G7Y A;  1KHP A;  2HWK A;  1YAL A;  3OVZ A;  2DOS A;  2R9C A;  1ZIV A;  2F1G A;  1NQC A;  4XZX A;  1BGO A;  2P7U A;  2IPP B;  1AIM A;  1AYU A;  1MS6 A;  3MP2 A;  3N3K A;  3KW9 A;  1DEU A;  3K24 A;  4BOZ A;  3TNX A;  2G8E A;  3P5X A;  3OVX A;  3HWN A;  4BPV A;  1PE6 A;  2FRQ A;  3U8E A;  1GEC E;  8PCH A;  2R9N A;  1MDW A;  1BY8 A;  1YVB A;  3H8C A;  1KFU L;  4FJC A;  3IEJ A;  1A6R A;  2AGA A;  2Y5B A;  4I05 A;  3IUT A;  1PIP A;  4RF1 A;  3D6S A;  5E6J A;  1AEC A;  4MSX A;  2Z84 A;  3BB7 A;  4GUA A;  1EWP A;  1KXR A;  3CBK A;  4PI3 A;  2NQG A;  2GFO A;  4K7C A;  4AXM A;  3PDF A;  1GCB A;  2DCA A;  4RY2 A;  4X6H A;  3KKU A;  3O0U A;  4Q8G A;  3H8B A;  1THE A;  2XU5 A;  3F5V A;  3KWB X;  1EWO A;  2YJ9 A;  2YJB A;  3KFQ A;  4YYV A;  4HWY A;  2IBI A;  2DZY A;  5J94 A;  3F75 A;  4PT5 A;  3QJ3 A;  2B1M A;  4X6J A;  1IWD A;  2E01 A;  1GMY A;  4P16 A;  4OVZ B;  3QT4 A;  5K16 A;  3IOQ A;  2HXZ A;  1M6D A;  5EF4 A;  4BS6 A;  1GLO A;  1VSN A;  1Y4H A;  4BS5 A;  3BPF A;  1F2B A;  2JRI A;  2O6X A;  2G8J A;  1KFX L;  1UKF A;  1NB5 A;  2J7Q A;  3V6E A;  1QXP A;  1MEM A;  4OVZ A;  5PAD A;  4OW0 A;  2AUX A;  2JQG R;  3NHE A;  4XR7 A;  1BP4 A;  2H7J A;  1KHQ A;  3KWZ A;  1PPP A;  1AU4 A;  1AYV A;  4W4U A;  2VHS A;  1CPJ A;  3IMA A;  3B79 A;  5EGW A;  3OF8 A;  5KO3 A;  1ATK A;  3PRM A;  3CH2 X;  3AI8 A;  3QSD A;  1EWL A;  3MHS A;  1QDQ A;  4MZO A;  1MIR A;  1PCI A;  4I04 A;  2ARY A;  3PRP A;  3O1G A;  1POP A;  2AS8 A;  1U9Q X;  1QOL A;  4D8E A;  3I3T A;  1TL9 A;  1ME4 A;  2E03 A;  2OP3 A;  3KSE A;  4XUI A;  2BTW B;  1AU2 A;  1F29 A;  1DF0 A;  3P5W A;  2AIM A;  2FTD A;  1CJL A;  1U9V A;  1AYW A;  4PP2 E;  4BOQ A;  4RKX A;  5CVO B;  4MI7 A;  2BU3 A;  2OZ2 A;  4PP1 A;  1U5I A;  1CS8 A;  2AU1 A;  4YYW A;  7PCK A;  1ZCM A;  1NLJ A;  3CBJ A;  3V6C A;  1NL6 A;  4YYQ A;  5JH3 A;  2NQA A;  3DF0 A;  3H89 A;  3W31 A;  1ICF A;  1JQP A;  1YK7 A;  2NQI A;  4YV8 A;  2G6D A;  1ME3 A;  2FRA A;  5CVM A;  5CVN B;  3MTN A;  2BDZ A;  3RVW A;  1MHW A;  1VJV A;  2FQ9 A;  4W5C A;  3K9M A;  1BQI A;  3C9E A;  4DMX A;  2YJ2 A;  4PAD A;  1PPD A;  4I07 A;  4AXL A;  3P5V A;  4D8I A;  1F2A A;  4FIP A;  3E9S A;  3ZNH A;  2Y6E A;  4MZS A;  1XKG A;  2DJG B;  3MHH A;  1AU0 A;  3BC3 A;  4R3D A;  4BOU A;  4CZW A;  4QRG A;  3H6S A; 
#chains in the Genus database with same CATH homology
 2CB5 A;  1X9Y A;  4OEL A;  2PAD A;  2YJC A;  3IV2 A;  3P5U A;  1O0E A;  1PXV A;  4N79 A;  1ITO A;  2DCC A;  4Q8H A;  3PW3 A;  3MOR A;  1QMY A;  4CDD B;  2HHN A;  2DZZ A;  2FT2 A;  2FYE A;  1STF E;  1W6F A;  3S3R A;  2VFC A;  4CDE B;  1U9X A;  2VHF A;  2HD5 A;  2F7D A;  2DC7 A;  5A24 A;  2DCB A;  1YT7 A;  2XU3 A;  4G54 A;  4WA6 A;  2YJ8 A;  3BOW A;  2DJF B;  1HUC B;  1TLO A;  3LFY A;  2R6N A;  3KX1 A;  4BQV A;  9PAP A;  4N8W A;  2AYO A;  1Q6K A;  6PAD A;  3S3Q A;  1CB5 A;  3K8U A;  4NV8 A;  1FH0 A;  2PNS A;  1K3B B;  2CIO A;  4QRV A;  2HH5 A;  2R9M A;  3PBH A;  2P0R A;  1YK8 A;  4FK5 A;  4QBB A;  4W5B A;  5F02 A;  1CQD A;  2R9F A;  3E1Z B;  4YYU A;  2AUZ A;  3RVV A;  2B1N A;  4GUZ A;  4P6E A;  1PBH A;  1TU6 A;  2PBH A;  2JQF R;  3N3G A;  3OF9 A;  3ERV A;  5CHT A;  1AU3 A;  1W4T A;  3BWK A;  2FO5 A;  1CVZ A;  4CDC B;  1CSB B;  2GHU A;  2BDL A;  2ATO A;  1PAD A;  3HD3 A;  3OIS A;  3N4C A;  4DMY A;  2XU4 A;  3PNR A;  5JA7 A;  4BSQ A;  4QRX A;  3BCN A;  4YVA A;  1U9W A;  1Y08 A;  3HHI A;  3M99 A;  5CHV A;  3LXS A;  2BSZ A;  2DC8 A;  2DC6 A;  2E02 A;  2WBF X;  4OEM A;  4CDF B;  2E00 A;  1MEG A;  3HHA A;  2AYN A;  4QH6 A;  4YYR A;  1PPO A;  4C5P A;  1CTE A;  4N4Z A;  2PRE A;  1S4V A;  3GCB A;  3USV A;  2OUL A;  3RVX A;  1PPN A;  4YYS A;  1E2T A;  2XU1 A;  2ACT A;  3WXF A;  2NQD B;  3LTW A;  3CH3 X;  1SP4 B;  1SNK A;  2C0Y A;  1CV8 A;  2AVW A;  5FPW A;  2DCD A;  2FUD A;  1NPZ A;  3WXE A;  3I06 A;  2DC9 A;  1NB3 A;  4P6G A;  1EF7 A;  3H7D A;  4ZUX U;  2R9O A;  3IHP A;  4KLB A;  4X6I A;  1EWM A;  3WXG A;  3ZUA A;  1F2C A;  3BPM A;  2P86 A;  2G7Y A;  1KHP A;  1YAL A;  3OVZ A;  2R9C A;  1ZIV A;  2F1G A;  1NQC A;  1BGO A;  2P7U A;  2IPP B;  1AIM A;  1AYU A;  1MS6 A;  4NV7 A;  3N3K A;  3KW9 A;  1DEU A;  3K24 A;  3TNX A;  2G8E A;  3P5X A;  3OVX A;  3HWN A;  4BPV A;  1PE6 A;  2FRQ A;  3U8E A;  1GEC E;  8PCH A;  2R9N A;  1MDW A;  1BY8 A;  1YVB A;  3H8C A;  1KFU L;  4FJC A;  3IEJ A;  1A6R A;  2Y5B A;  4I05 A;  3IUT A;  1PIP A;  3D6S A;  1AEC A;  4MSX A;  4BGF A;  1EWP A;  1KXR A;  3CBK A;  4PI3 A;  2NQG A;  2GFO A;  4K7C A;  4AXM A;  3PDF A;  1GCB A;  2DCA A;  4RY2 A;  4X6H A;  3KKU A;  3O0U A;  4Q8G A;  3H8B A;  1THE A;  2XU5 A;  3F5V A;  3KWB X;  1EWO A;  2YJ9 A;  2YJB A;  3KFQ A;  4YYV A;  4HWY A;  2IBI A;  2DZY A;  5J94 A;  3F75 A;  3QJ3 A;  2B1M A;  4X6J A;  1IWD A;  2E01 A;  1GMY A;  3QT4 A;  5K16 A;  3IOQ A;  2HXZ A;  1M6D A;  5EF4 A;  4BS6 A;  1GLO A;  1VSN A;  1Y4H A;  4BS5 A;  3BPF A;  1F2B A;  2O6X A;  2G8J A;  1KFX L;  1NB5 A;  3V6E A;  1QXP A;  1MEM A;  5PAD A;  2AUX A;  2JQG R;  3NHE A;  4XR7 A;  1BP4 A;  2H7J A;  1KHQ A;  3KWZ A;  1PPP A;  1AU4 A;  2VFB A;  1AYV A;  4W4U A;  2VHS A;  1CPJ A;  3IMA A;  3B79 A;  5EGW A;  3OF8 A;  1ATK A;  3CH2 X;  3AI8 A;  3QSD A;  1EWL A;  3MHS A;  1QDQ A;  4MZO A;  1MIR A;  1PCI A;  4I04 A;  2ARY A;  3O1G A;  1POP A;  2AS8 A;  1U9Q X;  1QOL A;  3I3T A;  1TL9 A;  1ME4 A;  2E03 A;  2OP3 A;  3KSE A;  4XUI A;  1AU2 A;  1F29 A;  1DF0 A;  3P5W A;  2AIM A;  2FTD A;  1CJL A;  1U9V A;  1AYW A;  4PP2 E;  5CVO B;  2OZ2 A;  4PP1 A;  1U5I A;  1CS8 A;  2AU1 A;  4YYW A;  7PCK A;  1ZCM A;  1NLJ A;  3CBJ A;  3V6C A;  1NL6 A;  4YYQ A;  5JH3 A;  2NQA A;  3DF0 A;  3H89 A;  1ICF A;  1JQP A;  1YK7 A;  2NQI A;  4YV8 A;  2G6D A;  1ME3 A;  2FRA A;  1W5R A;  5CVM A;  5CVN B;  3MTN A;  2BDZ A;  3RVW A;  1MHW A;  1VJV A;  1GX3 A;  2FQ9 A;  4W5C A;  3K9M A;  1BQI A;  3C9E A;  4DMX A;  2YJ2 A;  4PAD A;  1PPD A;  4I07 A;  4AXL A;  3P5V A;  1F2A A;  4FIP A;  2Y6E A;  4MZS A;  1XKG A;  2DJG B;  3MHH A;  4B55 A;  1AU0 A;  3BC3 A;  4CZW A;  3D9W A;  4QRG A;  3H6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...