2DC7A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca042 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
total genus 74
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc7A00
3USVA 3WXGA 2FUDA 1AU4A 4QRXA 1GMYA 1KFUL 2B1NA 1CV8A 3KW9A 2PREA 1JQPA 2E03A 4OELA 1FH0A 1CPJA 1PPNA 1F2CA 2AUZA 2AU1A 1ME3A 4YYQA 4CDCB 4G54A 1X9YA 1QDQA 4P6GA 3RVXA 1SNKA 3PW3A 4W5CA 2DC7A 2HXZA 4I05A 1YT7A 1Y08A 1CB5A 3K9MA 4K7CA 4YV8A 1NLJA 4N8WA 2VHSA 1U9XA 2DC6A 1SP4B 1F2BA 3WXFA 3CH3X 3P5VA 1PBHA 3S3RA 2B1MA 1MS6A 2DCDA 4PP2E 2JQGR 1KHQA 1KHPA 4XR7A 1TLOA 2AYOA 3BCNA 5A24A 1CQDA 2DC8A 3H6SA 1AYVA 4YYUA 3ERVA 1Q6KA 3IEJA 1AU3A 1PPPA 1CVZA 3P5XA 1KXRA 1POPA 3E1ZB 3QJ3A 4I07A 1THEA 5J94A 1EF7A 1EWMA 1PPOA 2E02A 3N4CA 3IV2A 4X6HA 2OULA 4FJCA 3KKUA 1CJLA 1VSNA 2G6DA 3P5UA 5CVNB 3D6SA 5EF4A 1ME4A 3CBJA 2FO5A 3PBHA 4N4ZA 2GHUA 1AECA 3O0UA 1QOLA 3M99A 1NL6A 1GCBA 2HHNA 3KFQA 1MDWA 4PP1A 1PE6A 1M6DA 4CDDB 2FTDA 4CDEB 1CS8A 2ATOA 2P86A 3IMAA 1ITOA 2IPPB 1NB5A 1IWDA 4CDFB 3BWKA 2JQFR 2R9OA 3P5WA 2DJGB 1ATKA 2DJFB 1AU0A 4XUIA 3MTNA 3H7DA 2PADA 2DCCA 3OF9A 5CVMA 2IBIA 3AI8A 1NB3A 4AXMA 2HD5A 4X6JA 1AU2A 3OVZA 3ZUAA 3H89A 4W5BA 2DZYA 4PI3A 3KWBX 1Y4HA 1PPDA 4PADA 5PADA 4HWYA 2XU1A 4YYVA 4YYWA 4AXLA 1NQCA 2G7YA 3I3TA 2E01A 1U5IA 1U9VA 4BPVA 3OF8A 3H8CA 1QMYA 3HWNA 4N79A 1TU6A 4WA6A 4BS6A 3RVWA 3IUTA 5CVOB 4BQVA 3PDFA 4Q8HA 3F5VA 2BDZA 4I04A 1EWLA 2YJBA 1GLOA 2Y6EA 1ICFA 1BGOA 1CTEA 3IOQA 2ARYA 1MEGA 1PIPA 2CB5A 3U8EA 1A6RA 2XU5A 2BDLA 1O0EA 4KLBA 1KFXL 4P6EA 4BSQA 1BQIA 3BPMA 1S4VA 3HHAA 3I06A 2F1GA 3H8BA 1XKGA 2WBFX 2FRAA 4DMXA 3GCBA 5F02A 2E00A 4QRVA 9PAPA 2NQIA 2NQDB 1ZIVA 1PADA 3OISA 3S3QA 1DEUA 3BPFA 5JH3A 5JA7A 4DMYA 2R9NA 3F75A 3QT4A 4QH6A 3IHPA 2OP3A 8PCHA 7PCKA 2H7JA 3N3GA 4FIPA 3KWZA 1MEMA 4MZOA 2R9FA 1DF0A 2DCAA 3LXSA 4W4UA 2R9MA 4RY2A 3K24A 1YK7A 2YJ9A 4X6IA 3BC3A 2VHFA 3KX1A 3V6EA 1AYUA 2G8JA 3MHHA 3WXEA 2FQ9A 2R6NA 1AIMA 1QXPA 1YVBA 1U9WA 1U9QX 1EWPA 2PNSA 2DCBA 4MZSA 6PADA 2FYEA 1F29A 2YJ8A 4ZUXU 4MSXA 4YYSA 1HUCB 3O1GA 3MORA 2NQAA 1TL9A 3OVXA 1PXVA 1YALA 2O6XA 2FRQA 3HHIA 1F2AA 3N3KA 5CHTA 1STFE 3RVVA 5CHVA 1CSBB 2P7UA 1BP4A 1BY8A 2HH5A 3NHEA 1NPZA 2DC9A 2AVWA 3DF0A 2Y5BA 3KSEA 2P0RA 1AYWA 4OEMA 1YK8A 3TNXA 4FK5A 3C9EA 3MHSA 4BS5A 2AYNA 2CIOA 3K8UA 1GECE 2NQGA 2FT2A 1VJVA 2XU3A 2C0YA 3V6CA 1ZCMA 4CZWA 2YJCA 2OZ2A 2ACTA 4YYRA 1K3BB 2AUXA 4QBBA 5K16A 2G8EA 2AIMA 3CBKA 2F7DA 3BOWA 5EGWA 1MIRA 3B79A 3LFYA 5FPWA 3HD3A 4YVAA 2AS8A 2GFOA 2YJ2A 2R9CA 3QSDA 1EWOA 4Q8GA 3CH2X 2XU4A 2PBHA 2DZZA 3PNRA 1PCIA 1MHWA 4QRGA
chains in the Genus database with same CATH superfamily
2HWKA 3USVA 3WXGA 2FUDA 1AU4A 4QRXA 1GMYA 1KFUL 2B1NA 1CV8A 3KW9A 2PREA 1JQPA 2E03A 4OELA 1FH0A 1CPJA 1PPNA 1F2CA 2AUZA 2AU1A 1ME3A 4YYQA 4CDCB 4G54A 3IFUA 1X9YA 1QDQA 4P6GA 3RVXA 1SNKA 3PW3A 4W5CA 2DC7A 3W31A 4D8EA 3MTVA 4P16A 2HXZA 4I05A 5EZSA 1YT7A 1Y08A 1CB5A 3K9MA 4K7CA 4YV8A 1NLJA 4N8WA 2VHSA 1U9XA 4BOSA 2DC6A 4BOZA 1SP4B 1F2BA 4RNAA 3WXFA 5JZEA 3CH3X 3P5VA 3ZNHA 1PBHA 3B21A 3S3RA 2B1MA 1MS6A 2DCDA 2BU3A 4RF0A 4PP2E 2JQGR 4WURA 1KHQA 1KHPA 4XR7A 1TLOA 2AYOA 3BCNA 5A24A 1CQDA 3O65A 2DC8A 3H6SA 1AYVA 4YYUA 3ERVA 1Q6KA 3IEJA 3OQCA 1AU3A 1PPPA 4XZXA 1CVZA 3P5XA 1KXRA 1POPA 3E1ZB 3QJ3A 2DOSA 4I07A 1THEA 5J94A 1EF7A 1EWMA 1PPOA 2E02A 3N4CA 3IV2A 4MM3B 4X6HA 2OULA 4FJCA 3KKUA 1YZBA 1CJLA 3BB7A 1VSNA 2G6DA 3P5UA 5CVNB 3D6SA 4A5UA 5EF4A 1ME4A 3CBJA 2FO5A 3PBHA 4N4ZA 2GHUA 2JTCA 1AECA 3O0UA 1QOLA 3M99A 1NL6A 1GCBA 4OVZB 2HHNA 3KFQA 1MDWA 4PP1A 5KO3A 1PE6A 1M6DA 4CDDB 2FTDA 4CDEB 1CS8A 2ATOA 2P86A 3IMAA 1ITOA 2IPPB 1NB5A 1IWDA 4CDFB 3BWKA 2JQFR 2R9OA 3P5WA 2DJGB 1ATKA 2DJFB 1AU0A 4XUIA 3MTNA 3H7DA 2PADA 2DCCA 4HXDB 4OVZA 3PHUA 3OF9A 5CVMA 2IBIA 4GUAA 3AI8A 1NB3A 4D8BA 4AXMA 2HD5A 4X6JA 3RNVA 1AU2A 3OVZA 3W30A 3ZUAA 4D8IA 3H89A 4W5BA 2JRIA 2DZYA 4PI3A 3PSEA 3KWBX 1Y4HA 3PHWA 1PPDA 4PADA 5PADA 4R3DA 3PRMA 4HWYA 2XU1A 4YYVA 4YYWA 4AXLA 1NQCA 2G7YA 3I3TA 2E01A 1U5IA 1U9VA 4BPVA 3OF8A 3H8CA 1QMYA 3HWNA 4N79A 1TU6A 4WA6A 4BS6A 3RVWA 4RF1A 3IUTA 5CVOB 4BQVA 3PDFA 4Q8HA 3F5VA 2BDZA 4I04A 1EWLA 2YJBA 1GLOA 2Y6EA 1ICFA 1BGOA 1CTEA 3IOQA 2J7QC 2ARYA 1MEGA 1PIPA 2CB5A 3U8EA 1A6RA 2XU5A 2BDLA 1O0EA 4KLBA 3TMPA 1KFXL 4P6EA 4PT5A 4BSQA 1BQIA 3BPMA 4ZTBA 1S4VA 3HHAA 3I06A 2F1GA 3H8BA 1XKGA 2WBFX 2FRAA 4DMXA 1UKFA 4BOQA 3GCBA 5F02A 3BBAA 2E00A 4QRVA 9PAPA 2NQIA 2NQDB 1ZIVA 1PADA 2BTWB 3OISA 4IP3A 3S3QA 1DEUA 3BPFA 5JH3A 5JA7A 4DMYA 2R9NA 3F75A 3QT4A 3E9SA 4QH6A 3IHPA 2OP3A 8PCHA 7PCKA 2H7JA 2J7QA 3N3GA 4FIPA 3KWZA 1MEMA 4MZOA 2R9FA 1DF0A 2DCAA 3LXSA 4W4UA 2R9MA 2BTWA 4RY2A 3K24A 1YK7A 2YJ9A 4X6IA 3BC3A 2VHFA 3KX1A 3V6EA 1AYUA 2G8JA 3MHHA 3WXEA 2FQ9A 2R6NA 1AIMA 1QXPA 4BOPA 1YVBA 1U9WA 4M0WA 1U9QX 2UZJA 3PHXA 1EWPA 2PNSA 2DCBA 4MZSA 6PADA 1PVJA 1F29A 2FYEA 2YJ8A 4IUMA 4ZUXU 4MSXA 4YYSA 1HUCB 3O1GA 3MORA 4REZA 2NQAA 1TL9A 3OVXA 1PXVA 1YALA 2O6XA 2FRQA 3HHIA 1F2AA 3N3KA 5CHTA 3PRPA 1STFE 3RVVA 5CHVA 1CSBB 2P7UA 1BP4A 1BY8A 3PT2A 2HH5A 3NHEA 2Z84A 1DKIA 1NPZA 2DC9A 2AVWA 3DF0A 5E6JA 2Y5BA 3KSEA 2P0RA 1AYWA 4OEMA 1YK8A 3TNXA 3BY4A 4FK5A 3C9EA 3MHSA 4BS5A 3C0RA 2AYNA 2CIOA 3K8UA 1GECE 2NQGA 2FT2A 1VJVA 2XU3A 2C0YA 3V6CA 1ZCMA 4RKXA 5EZQA 4CZWA 2YJCA 2OZ2A 2ACTA 4YYRA 1K3BB 3MP2A 2AUXA 4QBBA 5K16A 2G8EA 3MJ5A 4MI7A 4OW0A 2AIMA 3CBKA 4BOUA 2F7DA 3BOWA 5EGWA 1MIRA 3B79A 3LFYA 5FPWA 3HD3A 4YVAA 2AS8A 2GFOA 2YJ2A 3TRKA 2R9CA 3QSDA 1EWOA 4Q8GA 3CH2X 2XU4A 2PBHA 2AGAA 2DZZA 2FE8A 3PNRA 1PCIA 1MHWA 4QRGA
chains in the Genus database with same CATH topology
3USVA 3WXGA 2FUDA 1AU4A 4QRXA 1GMYA 1KFUL 2B1NA 1CV8A 3KW9A 2PREA 1JQPA 2E03A 4OELA 1FH0A 1CPJA 1PPNA 1F2CA 2AUZA 2AU1A 1ME3A 4YYQA 4CDCB 4G54A 1X9YA 1QDQA 4P6GA 3RVXA 1SNKA 3PW3A 4W5CA 2DC7A 2HXZA 4I05A 1YT7A 1Y08A 1CB5A 3K9MA 4K7CA 4YV8A 1NLJA 4N8WA 2VHSA 1U9XA 2DC6A 1SP4B 1F2BA 3WXFA 3CH3X 3P5VA 1PBHA 3S3RA 2B1MA 1MS6A 2DCDA 4PP2E 2JQGR 1KHQA 1KHPA 4XR7A 1TLOA 2AYOA 3BCNA 5A24A 1CQDA 2DC8A 3H6SA 1AYVA 4YYUA 3ERVA 1Q6KA 3IEJA 1AU3A 1PPPA 1CVZA 3P5XA 1KXRA 1POPA 3E1ZB 3QJ3A 4I07A 1THEA 5J94A 1EF7A 1EWMA 1PPOA 2E02A 3N4CA 3IV2A 4X6HA 2OULA 4FJCA 3KKUA 1CJLA 1VSNA 2G6DA 3P5UA 5CVNB 3D6SA 5EF4A 1ME4A 3CBJA 2FO5A 3PBHA 4N4ZA 2GHUA 1AECA 3O0UA 1QOLA 3M99A 1NL6A 1GCBA 2HHNA 3KFQA 1MDWA 4PP1A 1PE6A 1M6DA 4CDDB 2FTDA 4CDEB 1CS8A 2ATOA 2P86A 3IMAA 1ITOA 2IPPB 1NB5A 1IWDA 4CDFB 3BWKA 2JQFR 2R9OA 3P5WA 2DJGB 1ATKA 2DJFB 1AU0A 4XUIA 3MTNA 3H7DA 2PADA 2DCCA 4B55A 3OF9A 5CVMA 2IBIA 3AI8A 1NB3A 4AXMA 2HD5A 4X6JA 1AU2A 3OVZA 3ZUAA 3H89A 4W5BA 2DZYA 4PI3A 3KWBX 1Y4HA 1PPDA 4PADA 5PADA 4HWYA 2XU1A 4YYVA 4YYWA 4AXLA 1NQCA 2G7YA 3I3TA 2E01A 1U5IA 1U9VA 4BPVA 3OF8A 3H8CA 1QMYA 3HWNA 1W6FA 4N79A 1TU6A 4WA6A 4BS6A 3RVWA 3IUTA 5CVOB 4BQVA 3PDFA 4Q8HA 3F5VA 2BDZA 4I04A 1EWLA 2YJBA 1GLOA 2Y6EA 1ICFA 1BGOA 1CTEA 3IOQA 2ARYA 1MEGA 1PIPA 2CB5A 3U8EA 1A6RA 2XU5A 2BDLA 1O0EA 4KLBA 1W5RA 1KFXL 4P6EA 4BSQA 1BQIA 3BPMA 1S4VA 3HHAA 3I06A 2F1GA 3H8BA 4C5PA 1XKGA 2WBFX 2FRAA 4BGFA 4DMXA 3GCBA 5F02A 4GUZA 2E00A 4QRVA 9PAPA 2NQIA 2NQDB 1ZIVA 1PADA 3OISA 3S3QA 1DEUA 3BPFA 5JH3A 1GX3A 5JA7A 4DMYA 2R9NA 3F75A 3QT4A 4NV8A 4QH6A 3IHPA 2OP3A 8PCHA 7PCKA 2H7JA 3N3GA 4FIPA 3KWZA 1MEMA 4MZOA 2R9FA 1DF0A 2DCAA 3LXSA 4W4UA 2R9MA 4RY2A 3K24A 1YK7A 2YJ9A 4X6IA 3BC3A 2VHFA 3KX1A 1W4TA 3V6EA 1AYUA 2G8JA 4NV7A 3MHHA 3WXEA 2FQ9A 2R6NA 1AIMA 1QXPA 1YVBA 1U9WA 1U9QX 1E2TA 1EWPA 2PNSA 2DCBA 4MZSA 6PADA 2FYEA 1F29A 2VFCA 2YJ8A 4ZUXU 4MSXA 4YYSA 1HUCB 3O1GA 3MORA 2NQAA 1TL9A 3OVXA 1PXVA 1YALA 2O6XA 2FRQA 2BSZA 3HHIA 1F2AA 3N3KA 5CHTA 1STFE 3RVVA 5CHVA 1CSBB 2P7UA 1BP4A 1BY8A 3LTWA 2HH5A 3NHEA 1NPZA 2DC9A 2AVWA 3DF0A 2Y5BA 3KSEA 2P0RA 1AYWA 4OEMA 1YK8A 3TNXA 4FK5A 3C9EA 3MHSA 4BS5A 2AYNA 2CIOA 3K8UA 1GECE 2NQGA 2FT2A 1VJVA 2XU3A 2C0YA 3V6CA 1ZCMA 4CZWA 2YJCA 2OZ2A 2ACTA 4YYRA 1K3BB 2AUXA 4QBBA 2VFBA 5K16A 2G8EA 2AIMA 3CBKA 2F7DA 3BOWA 5EGWA 1MIRA 3B79A 3LFYA 5FPWA 3HD3A 4YVAA 2AS8A 2GFOA 2YJ2A 2R9CA 3QSDA 1EWOA 3D9WA 4Q8GA 3CH2X 2XU4A 2PBHA 2DZZA 3PNRA 1PCIA 1MHWA 4QRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USV A;  3WXG A;  2FUD A;  1AU4 A;  4QRX A;  1GMY A;  1KFU L;  2B1N A;  1CV8 A;  3KW9 A;  2PRE A;  1JQP A;  2E03 A;  4OEL A;  1FH0 A;  1CPJ A;  1PPN A;  1F2C A;  2AUZ A;  2AU1 A;  1ME3 A;  4YYQ A;  4CDC B;  4G54 A;  1X9Y A;  1QDQ A;  4P6G A;  3RVX A;  1SNK A;  3PW3 A;  4W5C A;  2DC7 A;  2HXZ A;  4I05 A;  1YT7 A;  1Y08 A;  1CB5 A;  3K9M A;  4K7C A;  4YV8 A;  1NLJ A;  4N8W A;  2VHS A;  1U9X A;  2DC6 A;  1SP4 B;  1F2B A;  3WXF A;  3CH3 X;  3P5V A;  1PBH A;  3S3R A;  2B1M A;  1MS6 A;  2DCD A;  4PP2 E;  2JQG R;  1KHQ A;  1KHP A;  4XR7 A;  1TLO A;  2AYO A;  3BCN A;  5A24 A;  1CQD A;  2DC8 A;  3H6S A;  1AYV A;  4YYU A;  3ERV A;  1Q6K A;  3IEJ A;  1AU3 A;  1PPP A;  1CVZ A;  3P5X A;  1KXR A;  1POP A;  3E1Z B;  3QJ3 A;  4I07 A;  1THE A;  5J94 A;  1EF7 A;  1EWM A;  1PPO A;  2E02 A;  3N4C A;  3IV2 A;  4X6H A;  2OUL A;  4FJC A;  3KKU A;  1CJL A;  1VSN A;  2G6D A;  3P5U A;  5CVN B;  3D6S A;  5EF4 A;  1ME4 A;  3CBJ A;  2FO5 A;  3PBH A;  4N4Z A;  2GHU A;  1AEC A;  3O0U A;  1QOL A;  3M99 A;  1NL6 A;  1GCB A;  2HHN A;  3KFQ A;  1MDW A;  4PP1 A;  1PE6 A;  1M6D A;  4CDD B;  2FTD A;  4CDE B;  1CS8 A;  2ATO A;  2P86 A;  3IMA A;  1ITO A;  2IPP B;  1NB5 A;  1IWD A;  4CDF B;  3BWK A;  2JQF R;  2R9O A;  3P5W A;  2DJG B;  1ATK A;  2DJF B;  1AU0 A;  4XUI A;  3MTN A;  3H7D A;  2PAD A;  2DCC A;  3OF9 A;  5CVM A;  2IBI A;  3AI8 A;  1NB3 A;  4AXM A;  2HD5 A;  4X6J A;  1AU2 A;  3OVZ A;  3ZUA A;  3H89 A;  4W5B A;  2DZY A;  4PI3 A;  3KWB X;  1Y4H A;  1PPD A;  4PAD A;  5PAD A;  4HWY A;  2XU1 A;  4YYV A;  4YYW A;  4AXL A;  1NQC A;  2G7Y A;  3I3T A;  2E01 A;  1U5I A;  1U9V A;  4BPV A;  3OF8 A;  3H8C A;  1QMY A;  3HWN A;  4N79 A;  1TU6 A;  4WA6 A;  4BS6 A;  3RVW A;  3IUT A;  5CVO B;  4BQV A;  3PDF A;  4Q8H A;  3F5V A;  2BDZ A;  4I04 A;  1EWL A;  2YJB A;  1GLO A;  2Y6E A;  1ICF A;  1BGO A;  1CTE A;  3IOQ A;  2ARY A;  1MEG A;  1PIP A;  2CB5 A;  3U8E A;  1A6R A;  2XU5 A;  2BDL A;  1O0E A;  4KLB A;  1KFX L;  4P6E A;  4BSQ A;  1BQI A;  3BPM A;  1S4V A;  3HHA A;  3I06 A;  2F1G A;  3H8B A;  1XKG A;  2WBF X;  2FRA A;  4DMX A;  3GCB A;  5F02 A;  2E00 A;  4QRV A;  9PAP A;  2NQI A;  2NQD B;  1ZIV A;  1PAD A;  3OIS A;  3S3Q A;  1DEU A;  3BPF A;  5JH3 A;  5JA7 A;  4DMY A;  2R9N A;  3F75 A;  3QT4 A;  4QH6 A;  3IHP A;  2OP3 A;  8PCH A;  7PCK A;  2H7J A;  3N3G A;  4FIP A;  3KWZ A;  1MEM A;  4MZO A;  2R9F A;  1DF0 A;  2DCA A;  3LXS A;  4W4U A;  2R9M A;  4RY2 A;  3K24 A;  1YK7 A;  2YJ9 A;  4X6I A;  3BC3 A;  2VHF A;  3KX1 A;  3V6E A;  1AYU A;  2G8J A;  3MHH A;  3WXE A;  2FQ9 A;  2R6N A;  1AIM A;  1QXP A;  1YVB A;  1U9W A;  1U9Q X;  1EWP A;  2PNS A;  2DCB A;  4MZS A;  6PAD A;  2FYE A;  1F29 A;  2YJ8 A;  4ZUX U;  4MSX A;  4YYS A;  1HUC B;  3O1G A;  3MOR A;  2NQA A;  1TL9 A;  3OVX A;  1PXV A;  1YAL A;  2O6X A;  2FRQ A;  3HHI A;  1F2A A;  3N3K A;  5CHT A;  1STF E;  3RVV A;  5CHV A;  1CSB B;  2P7U A;  1BP4 A;  1BY8 A;  2HH5 A;  3NHE A;  1NPZ A;  2DC9 A;  2AVW A;  3DF0 A;  2Y5B A;  3KSE A;  2P0R A;  1AYW A;  4OEM A;  1YK8 A;  3TNX A;  4FK5 A;  3C9E A;  3MHS A;  4BS5 A;  2AYN A;  2CIO A;  3K8U A;  1GEC E;  2NQG A;  2FT2 A;  1VJV A;  2XU3 A;  2C0Y A;  3V6C A;  1ZCM A;  4CZW A;  2YJC A;  2OZ2 A;  2ACT A;  4YYR A;  1K3B B;  2AUX A;  4QBB A;  5K16 A;  2G8E A;  2AIM A;  3CBK A;  2F7D A;  3BOW A;  5EGW A;  1MIR A;  3B79 A;  3LFY A;  5FPW A;  3HD3 A;  4YVA A;  2AS8 A;  2GFO A;  2YJ2 A;  2R9C A;  3QSD A;  1EWO A;  4Q8G A;  3CH2 X;  2XU4 A;  2PBH A;  2DZZ A;  3PNR A;  1PCI A;  1MHW A;  4QRG A; 
#chains in the Genus database with same CATH topology
 2HWK A;  3USV A;  3WXG A;  2FUD A;  1AU4 A;  4QRX A;  1GMY A;  1KFU L;  2B1N A;  1CV8 A;  3KW9 A;  2PRE A;  1JQP A;  2E03 A;  4OEL A;  1FH0 A;  1CPJ A;  1PPN A;  1F2C A;  2AUZ A;  2AU1 A;  1ME3 A;  4YYQ A;  4CDC B;  4G54 A;  3IFU A;  1X9Y A;  1QDQ A;  4P6G A;  3RVX A;  1SNK A;  3PW3 A;  4W5C A;  2DC7 A;  3W31 A;  4D8E A;  3MTV A;  4P16 A;  2HXZ A;  4I05 A;  5EZS A;  1YT7 A;  1Y08 A;  1CB5 A;  3K9M A;  4K7C A;  4YV8 A;  1NLJ A;  4N8W A;  2VHS A;  1U9X A;  4BOS A;  2DC6 A;  4BOZ A;  1SP4 B;  1F2B A;  4RNA A;  3WXF A;  5JZE A;  3CH3 X;  3P5V A;  3ZNH A;  1PBH A;  3B21 A;  3S3R A;  2B1M A;  1MS6 A;  2DCD A;  2BU3 A;  4RF0 A;  4PP2 E;  2JQG R;  4WUR A;  1KHQ A;  1KHP A;  4XR7 A;  1TLO A;  2AYO A;  3BCN A;  5A24 A;  1CQD A;  3O65 A;  2DC8 A;  3H6S A;  1AYV A;  4YYU A;  3ERV A;  1Q6K A;  3IEJ A;  3OQC A;  1AU3 A;  1PPP A;  4XZX A;  1CVZ A;  3P5X A;  1KXR A;  1POP A;  3E1Z B;  3QJ3 A;  2DOS A;  4I07 A;  1THE A;  5J94 A;  1EF7 A;  1EWM A;  1PPO A;  2E02 A;  3N4C A;  3IV2 A;  4MM3 B;  4X6H A;  2OUL A;  4FJC A;  3KKU A;  1YZB A;  1CJL A;  3BB7 A;  1VSN A;  2G6D A;  3P5U A;  5CVN B;  3D6S A;  4A5U A;  5EF4 A;  1ME4 A;  3CBJ A;  2FO5 A;  3PBH A;  4N4Z A;  2GHU A;  2JTC A;  1AEC A;  3O0U A;  1QOL A;  3M99 A;  1NL6 A;  1GCB A;  4OVZ B;  2HHN A;  3KFQ A;  1MDW A;  4PP1 A;  5KO3 A;  1PE6 A;  1M6D A;  4CDD B;  2FTD A;  4CDE B;  1CS8 A;  2ATO A;  2P86 A;  3IMA A;  1ITO A;  2IPP B;  1NB5 A;  1IWD A;  4CDF B;  3BWK A;  2JQF R;  2R9O A;  3P5W A;  2DJG B;  1ATK A;  2DJF B;  1AU0 A;  4XUI A;  3MTN A;  3H7D A;  2PAD A;  2DCC A;  4HXD B;  4OVZ A;  3PHU A;  3OF9 A;  5CVM A;  2IBI A;  4GUA A;  3AI8 A;  1NB3 A;  4D8B A;  4AXM A;  2HD5 A;  4X6J A;  3RNV A;  1AU2 A;  3OVZ A;  3W30 A;  3ZUA A;  4D8I A;  3H89 A;  4W5B A;  2JRI A;  2DZY A;  4PI3 A;  3PSE A;  3KWB X;  1Y4H A;  3PHW A;  1PPD A;  4PAD A;  5PAD A;  4R3D A;  3PRM A;  4HWY A;  2XU1 A;  4YYV A;  4YYW A;  4AXL A;  1NQC A;  2G7Y A;  3I3T A;  2E01 A;  1U5I A;  1U9V A;  4BPV A;  3OF8 A;  3H8C A;  1QMY A;  3HWN A;  4N79 A;  1TU6 A;  4WA6 A;  4BS6 A;  3RVW A;  4RF1 A;  3IUT A;  5CVO B;  4BQV A;  3PDF A;  4Q8H A;  3F5V A;  2BDZ A;  4I04 A;  1EWL A;  2YJB A;  1GLO A;  2Y6E A;  1ICF A;  1BGO A;  1CTE A;  3IOQ A;  2J7Q C;  2ARY A;  1MEG A;  1PIP A;  2CB5 A;  3U8E A;  1A6R A;  2XU5 A;  2BDL A;  1O0E A;  4KLB A;  3TMP A;  1KFX L;  4P6E A;  4PT5 A;  4BSQ A;  1BQI A;  3BPM A;  4ZTB A;  1S4V A;  3HHA A;  3I06 A;  2F1G A;  3H8B A;  1XKG A;  2WBF X;  2FRA A;  4DMX A;  1UKF A;  4BOQ A;  3GCB A;  5F02 A;  3BBA A;  2E00 A;  4QRV A;  9PAP A;  2NQI A;  2NQD B;  1ZIV A;  1PAD A;  2BTW B;  3OIS A;  4IP3 A;  3S3Q A;  1DEU A;  3BPF A;  5JH3 A;  5JA7 A;  4DMY A;  2R9N A;  3F75 A;  3QT4 A;  3E9S A;  4QH6 A;  3IHP A;  2OP3 A;  8PCH A;  7PCK A;  2H7J A;  2J7Q A;  3N3G A;  4FIP A;  3KWZ A;  1MEM A;  4MZO A;  2R9F A;  1DF0 A;  2DCA A;  3LXS A;  4W4U A;  2R9M A;  2BTW A;  4RY2 A;  3K24 A;  1YK7 A;  2YJ9 A;  4X6I A;  3BC3 A;  2VHF A;  3KX1 A;  3V6E A;  1AYU A;  2G8J A;  3MHH A;  3WXE A;  2FQ9 A;  2R6N A;  1AIM A;  1QXP A;  4BOP A;  1YVB A;  1U9W A;  4M0W A;  1U9Q X;  2UZJ A;  3PHX A;  1EWP A;  2PNS A;  2DCB A;  4MZS A;  6PAD A;  1PVJ A;  1F29 A;  2FYE A;  2YJ8 A;  4IUM A;  4ZUX U;  4MSX A;  4YYS A;  1HUC B;  3O1G A;  3MOR A;  4REZ A;  2NQA A;  1TL9 A;  3OVX A;  1PXV A;  1YAL A;  2O6X A;  2FRQ A;  3HHI A;  1F2A A;  3N3K A;  5CHT A;  3PRP A;  1STF E;  3RVV A;  5CHV A;  1CSB B;  2P7U A;  1BP4 A;  1BY8 A;  3PT2 A;  2HH5 A;  3NHE A;  2Z84 A;  1DKI A;  1NPZ A;  2DC9 A;  2AVW A;  3DF0 A;  5E6J A;  2Y5B A;  3KSE A;  2P0R A;  1AYW A;  4OEM A;  1YK8 A;  3TNX A;  3BY4 A;  4FK5 A;  3C9E A;  3MHS A;  4BS5 A;  3C0R A;  2AYN A;  2CIO A;  3K8U A;  1GEC E;  2NQG A;  2FT2 A;  1VJV A;  2XU3 A;  2C0Y A;  3V6C A;  1ZCM A;  4RKX A;  5EZQ A;  4CZW A;  2YJC A;  2OZ2 A;  2ACT A;  4YYR A;  1K3B B;  3MP2 A;  2AUX A;  4QBB A;  5K16 A;  2G8E A;  3MJ5 A;  4MI7 A;  4OW0 A;  2AIM A;  3CBK A;  4BOU A;  2F7D A;  3BOW A;  5EGW A;  1MIR A;  3B79 A;  3LFY A;  5FPW A;  3HD3 A;  4YVA A;  2AS8 A;  2GFO A;  2YJ2 A;  3TRK A;  2R9C A;  3QSD A;  1EWO A;  4Q8G A;  3CH2 X;  2XU4 A;  2PBH A;  2AGA A;  2DZZ A;  2FE8 A;  3PNR A;  1PCI A;  1MHW A;  4QRG A; 
#chains in the Genus database with same CATH homology
 3USV A;  3WXG A;  2FUD A;  1AU4 A;  4QRX A;  1GMY A;  1KFU L;  2B1N A;  1CV8 A;  3KW9 A;  2PRE A;  1JQP A;  2E03 A;  4OEL A;  1FH0 A;  1CPJ A;  1PPN A;  1F2C A;  2AUZ A;  2AU1 A;  1ME3 A;  4YYQ A;  4CDC B;  4G54 A;  1X9Y A;  1QDQ A;  4P6G A;  3RVX A;  1SNK A;  3PW3 A;  4W5C A;  2DC7 A;  2HXZ A;  4I05 A;  1YT7 A;  1Y08 A;  1CB5 A;  3K9M A;  4K7C A;  4YV8 A;  1NLJ A;  4N8W A;  2VHS A;  1U9X A;  2DC6 A;  1SP4 B;  1F2B A;  3WXF A;  3CH3 X;  3P5V A;  1PBH A;  3S3R A;  2B1M A;  1MS6 A;  2DCD A;  4PP2 E;  2JQG R;  1KHQ A;  1KHP A;  4XR7 A;  1TLO A;  2AYO A;  3BCN A;  5A24 A;  1CQD A;  2DC8 A;  3H6S A;  1AYV A;  4YYU A;  3ERV A;  1Q6K A;  3IEJ A;  1AU3 A;  1PPP A;  1CVZ A;  3P5X A;  1KXR A;  1POP A;  3E1Z B;  3QJ3 A;  4I07 A;  1THE A;  5J94 A;  1EF7 A;  1EWM A;  1PPO A;  2E02 A;  3N4C A;  3IV2 A;  4X6H A;  2OUL A;  4FJC A;  3KKU A;  1CJL A;  1VSN A;  2G6D A;  3P5U A;  5CVN B;  3D6S A;  5EF4 A;  1ME4 A;  3CBJ A;  2FO5 A;  3PBH A;  4N4Z A;  2GHU A;  1AEC A;  3O0U A;  1QOL A;  3M99 A;  1NL6 A;  1GCB A;  2HHN A;  3KFQ A;  1MDW A;  4PP1 A;  1PE6 A;  1M6D A;  4CDD B;  2FTD A;  4CDE B;  1CS8 A;  2ATO A;  2P86 A;  3IMA A;  1ITO A;  2IPP B;  1NB5 A;  1IWD A;  4CDF B;  3BWK A;  2JQF R;  2R9O A;  3P5W A;  2DJG B;  1ATK A;  2DJF B;  1AU0 A;  4XUI A;  3MTN A;  3H7D A;  2PAD A;  2DCC A;  4B55 A;  3OF9 A;  5CVM A;  2IBI A;  3AI8 A;  1NB3 A;  4AXM A;  2HD5 A;  4X6J A;  1AU2 A;  3OVZ A;  3ZUA A;  3H89 A;  4W5B A;  2DZY A;  4PI3 A;  3KWB X;  1Y4H A;  1PPD A;  4PAD A;  5PAD A;  4HWY A;  2XU1 A;  4YYV A;  4YYW A;  4AXL A;  1NQC A;  2G7Y A;  3I3T A;  2E01 A;  1U5I A;  1U9V A;  4BPV A;  3OF8 A;  3H8C A;  1QMY A;  3HWN A;  1W6F A;  4N79 A;  1TU6 A;  4WA6 A;  4BS6 A;  3RVW A;  3IUT A;  5CVO B;  4BQV A;  3PDF A;  4Q8H A;  3F5V A;  2BDZ A;  4I04 A;  1EWL A;  2YJB A;  1GLO A;  2Y6E A;  1ICF A;  1BGO A;  1CTE A;  3IOQ A;  2ARY A;  1MEG A;  1PIP A;  2CB5 A;  3U8E A;  1A6R A;  2XU5 A;  2BDL A;  1O0E A;  4KLB A;  1W5R A;  1KFX L;  4P6E A;  4BSQ A;  1BQI A;  3BPM A;  1S4V A;  3HHA A;  3I06 A;  2F1G A;  3H8B A;  4C5P A;  1XKG A;  2WBF X;  2FRA A;  4BGF A;  4DMX A;  3GCB A;  5F02 A;  4GUZ A;  2E00 A;  4QRV A;  9PAP A;  2NQI A;  2NQD B;  1ZIV A;  1PAD A;  3OIS A;  3S3Q A;  1DEU A;  3BPF A;  5JH3 A;  1GX3 A;  5JA7 A;  4DMY A;  2R9N A;  3F75 A;  3QT4 A;  4NV8 A;  4QH6 A;  3IHP A;  2OP3 A;  8PCH A;  7PCK A;  2H7J A;  3N3G A;  4FIP A;  3KWZ A;  1MEM A;  4MZO A;  2R9F A;  1DF0 A;  2DCA A;  3LXS A;  4W4U A;  2R9M A;  4RY2 A;  3K24 A;  1YK7 A;  2YJ9 A;  4X6I A;  3BC3 A;  2VHF A;  3KX1 A;  1W4T A;  3V6E A;  1AYU A;  2G8J A;  4NV7 A;  3MHH A;  3WXE A;  2FQ9 A;  2R6N A;  1AIM A;  1QXP A;  1YVB A;  1U9W A;  1U9Q X;  1E2T A;  1EWP A;  2PNS A;  2DCB A;  4MZS A;  6PAD A;  2FYE A;  1F29 A;  2VFC A;  2YJ8 A;  4ZUX U;  4MSX A;  4YYS A;  1HUC B;  3O1G A;  3MOR A;  2NQA A;  1TL9 A;  3OVX A;  1PXV A;  1YAL A;  2O6X A;  2FRQ A;  2BSZ A;  3HHI A;  1F2A A;  3N3K A;  5CHT A;  1STF E;  3RVV A;  5CHV A;  1CSB B;  2P7U A;  1BP4 A;  1BY8 A;  3LTW A;  2HH5 A;  3NHE A;  1NPZ A;  2DC9 A;  2AVW A;  3DF0 A;  2Y5B A;  3KSE A;  2P0R A;  1AYW A;  4OEM A;  1YK8 A;  3TNX A;  4FK5 A;  3C9E A;  3MHS A;  4BS5 A;  2AYN A;  2CIO A;  3K8U A;  1GEC E;  2NQG A;  2FT2 A;  1VJV A;  2XU3 A;  2C0Y A;  3V6C A;  1ZCM A;  4CZW A;  2YJC A;  2OZ2 A;  2ACT A;  4YYR A;  1K3B B;  2AUX A;  4QBB A;  2VFB A;  5K16 A;  2G8E A;  2AIM A;  3CBK A;  2F7D A;  3BOW A;  5EGW A;  1MIR A;  3B79 A;  3LFY A;  5FPW A;  3HD3 A;  4YVA A;  2AS8 A;  2GFO A;  2YJ2 A;  2R9C A;  3QSD A;  1EWO A;  3D9W A;  4Q8G A;  3CH2 X;  2XU4 A;  2PBH A;  2DZZ A;  3PNR A;  1PCI A;  1MHW A;  4QRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...