2DC7A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca042 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
251
Chain Sequence
b'LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 74
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc7A00
1NQCA 2DZYA 3NHEA 2GFOA 2C0YA 1SP4B 2E03A 2YJCA 4QRXA 3U8EA 3K9MA 2AVWA 2YJ9A 3LXSA 3P5WA 1TLOA 2AIMA 2ARYA 2DC7A 1STFE 2P0RA 2DCCA 1NB5A 2O6XA 1EWMA 3HHAA 3HHIA 1AYWA 1AU4A 1Y08A 1K3BB 1CVZA 3CH3X 1KXRA 2H7JA 1BQIA 3BC3A 5JH3A 1KFUL 4YVAA 4FK5A 5EF4A 1AU3A 2XU5A 2JQGR 1ZIVA 4P6EA 3H8CA 2PREA 9PAPA 3IV2A 4X6IA 3OF8A 2DC6A 5CVMA 1QXPA 2DCAA 5K16A 3V6EA 3H7DA 1MS6A 3MTNA 5EGWA 3KWZA 1XKGA 3QSDA 8PCHA 4P6GA 4N79A 1TL9A 1U9QX 1PPPA 4OELA 3HWNA 3RVWA 3WXEA 2Y5BA 4ZUXU 4CDDB 4PI3A 1QMYA 1F2AA 4MSXA 2G8EA 4FIPA 1AYVA 1F2CA 1AYUA 2BDZA 5A24A 3KWBX 4HWYA 2AYNA 3BCNA 2AUXA 3KW9A 2AYOA 2E00A 2NQAA 1EWPA 1DEUA 3N3KA 1F2BA 2CIOA 1KHPA 3RVXA 1PCIA 3N3GA 2NQDB 3WXGA 1GCBA 3OVZA 1X9YA 2R9FA 2R9MA 4BSQA 3PBHA 5PADA 4N8WA 2DCBA 3P5VA 2OULA 4YYUA 2PADA 4BQVA 3S3QA 1PIPA 2DJFB 4PP1A 1YT7A 1BY8A 1Y4HA 3E1ZB 4AXLA 2ACTA 2FO5A 2YJ2A 1DF0A 3CBKA 1ME4A 2R9NA 3USVA 1S4VA 4QRVA 3IEJA 3O0UA 2JQFR 1AECA 1MHWA 1F29A 3H8BA 3PW3A 3IUTA 2OP3A 1U9XA 1SNKA 1FH0A 2R6NA 2FYEA 2HHNA 4CDFB 4QH6A 1AIMA 1U9VA 1PXVA 1IWDA 2FQ9A 3ZUAA 4RY2A 2BDLA 2DCDA 2CB5A 1EWOA 2HD5A 2G7YA 3I3TA 4K7CA 3N4CA 3KX1A 1ITOA 5CHTA 4XR7A 4PP2E 2XU3A 2PBHA 3QJ3A 1Q6KA 4DMXA 3CBJA 3F75A 1CSBB 1U9WA 2DZZA 1EWLA 2XU1A 4Q8GA 3S3RA 2B1MA 4WA6A 3CH2X 2YJ8A 4FJCA 3B79A 4AXMA 5FPWA 2IPPB 4YYQA 6PADA 3BPMA 4DMYA 1NB3A 1PPOA 4I04A 4PADA 2F7DA 1MIRA 3OF9A 2G8JA 2FRQA 3K24A 1EF7A 3PNRA 2NQGA 2AU1A 4I07A 1GECE 1MEMA 2FRAA 1MDWA 4BPVA 5CVNB 2XU4A 5CVOB 1GMYA 2FUDA 3OVXA 3WXFA 1PE6A 4YYVA 1NPZA 1THEA 1CPJA 3M99A 3LFYA 1POPA 1BGOA 2DJGB 2AS8A 3HD3A 1ATKA 1M6DA 1MEGA 2OZ2A 4YV8A 1CJLA 1ICFA 1PPNA 2E02A 2GHUA 1YK8A 3TNXA 3IHPA 1VSNA 4YYSA 1AU2A 4CZWA 1NL6A 5CHVA 1CTEA 2Y6EA 1VJVA 4MZSA 2FT2A 4X6HA 1PADA 4XUIA 2AUZA 4N4ZA 3D6SA 3P5UA 3V6CA 4Q8HA 7PCKA 2R9OA 4CDEB 3K8UA 4I05A 2P7UA 4X6JA 4BS6A 1PBHA 3BPFA 4QRGA 2G6DA 1JQPA 2HH5A 2E01A 1TU6A 4MZOA 1NLJA 3IMAA 1ZCMA 1CV8A 2IBIA 4YYWA 2P86A 2VHSA 1PPDA 1QDQA 3MHSA 3H89A 4CDCB 4KLBA 4W4UA 3O1GA 3BOWA 4G54A 2B1NA 2WBFX 3P5XA 1O0EA 3KKUA 3C9EA 3KFQA 1A6RA 2HXZA 2VHFA 3MORA 1GLOA 1YK7A 2DC8A 3GCBA 4OEMA 1AU0A 2YJBA 5JA7A 1KFXL 2PNSA 1U5IA 3I06A 4W5CA 2FTDA 2DC9A 4YYRA 4W5BA 1ME3A 3QT4A 3IOQA 1QOLA 1YVBA 1HUCB 3KSEA 1KHQA 3DF0A 5F02A 1CB5A 2ATOA 1BP4A 2R9CA 3BWKA 3OISA 1CQDA 2NQIA 3ERVA 3F5VA 3MHHA 1YALA 4QBBA 3PDFA 3H6SA 3RVVA 3AI8A 5J94A 2F1GA 4BS5A 1CS8A
chains in the Genus database with same CATH superfamily
5E6JA 1NQCA 2DZYA 3NHEA 2GFOA 2C0YA 1SP4B 2E03A 2YJCA 4QRXA 4D8BA 3U8EA 3K9MA 2AVWA 2YJ9A 3LXSA 3P5WA 1TLOA 1PVJA 2AIMA 2ARYA 4RF0A 2DC7A 1STFE 2P0RA 2DCCA 2FE8A 1NB5A 2O6XA 1EWMA 4D8EA 3HHAA 3HHIA 1AYWA 1AU4A 1Y08A 3O65A 1K3BB 1UKFA 1CVZA 3CH3X 1KXRA 2H7JA 1BQIA 3BC3A 5JH3A 1KFUL 4YVAA 4FK5A 5EF4A 1AU3A 2XU5A 2JQGR 1ZIVA 3PT2A 4P6EA 4D8IA 3H8CA 2PREA 9PAPA 3IV2A 4X6IA 3BY4A 3OF8A 2DC6A 5CVMA 4ZTBA 1QXPA 2DCAA 5K16A 3V6EA 3H7DA 1MS6A 3MTNA 5EGWA 3KWZA 3E9SA 1XKGA 3QSDA 8PCHA 4P6GA 4N79A 1TL9A 1U9QX 1PPPA 4OELA 3HWNA 3RVWA 3WXEA 2Y5BA 4ZUXU 2JRIA 4CDDB 4PI3A 4MM3B 4RNAA 1QMYA 3PSEA 1F2AA 4MSXA 2J7QC 2G8EA 4FIPA 1AYVA 1F2CA 1AYUA 2BDZA 5A24A 3KWBX 4HWYA 2AYNA 3BCNA 2AUXA 3KW9A 2AYOA 2E00A 2NQAA 1EWPA 1DEUA 3N3KA 1F2BA 2CIOA 1KHPA 3RVXA 1PCIA 3N3GA 2NQDB 3WXGA 1GCBA 3OVZA 1X9YA 2R9FA 2R9MA 4BSQA 3PBHA 5PADA 4N8WA 2DCBA 3P5VA 2OULA 3RNVA 4YYUA 4BOSA 2UZJA 2PADA 4BQVA 3S3QA 1PIPA 2DJFB 5EZQA 2Z84A 4PP1A 4XZXA 1YT7A 4IP3A 5JZEA 1BY8A 2JTCA 1Y4HA 4MI7A 3E1ZB 4AXLA 2ACTA 2FO5A 2YJ2A 1DF0A 3CBKA 1ME4A 2R9NA 3USVA 1S4VA 4QRVA 3IEJA 3O0UA 2JQFR 1AECA 1MHWA 1F29A 3H8BA 3PW3A 3IUTA 2OP3A 1U9XA 1SNKA 4GUAA 1FH0A 2R6NA 2FYEA 2HHNA 4CDFB 3BBAA 4QH6A 1AIMA 1U9VA 4REZA 1PXVA 1IWDA 3W30A 2FQ9A 3ZUAA 4RY2A 2BDLA 2DCDA 2CB5A 1EWOA 2HD5A 2G7YA 3I3TA 4K7CA 3B21A 3N4CA 3KX1A 1ITOA 5CHTA 4XR7A 4PP2E 2XU3A 2PBHA 3OQCA 3MTVA 5KO3A 3QJ3A 1Q6KA 4DMXA 3CBJA 3F75A 1CSBB 1U9WA 2DZZA 1EWLA 2XU1A 4Q8GA 3S3RA 2B1MA 4WA6A 3CH2X 3PHXA 2YJ8A 4FJCA 3B79A 3TRKA 4AXMA 5FPWA 4P16A 2IPPB 4R3DA 4OVZB 4YYQA 6PADA 3BPMA 4DMYA 1NB3A 4A5UA 1PPOA 4I04A 4PADA 2BTWA 2F7DA 1MIRA 3C0RA 3OF9A 2G8JA 2FRQA 3K24A 1EF7A 3PNRA 2NQGA 2AU1A 4I07A 4BOPA 1GECE 1MEMA 2FRAA 1MDWA 4BPVA 5CVNB 2XU4A 5CVOB 1GMYA 2FUDA 3OVXA 3WXFA 1PE6A 4RF1A 3IFUA 4YYVA 1NPZA 1THEA 1CPJA 3M99A 3LFYA 1POPA 1BGOA 2DOSA 2DJGB 2AS8A 3HD3A 1ATKA 1M6DA 1MEGA 3PRMA 2OZ2A 4YV8A 1CJLA 1ICFA 1PPNA 1YZBA 2E02A 2GHUA 1YK8A 3TNXA 3IHPA 1VSNA 4YYSA 1AU2A 4CZWA 1NL6A 5CHVA 4OW0A 1CTEA 2Y6EA 1VJVA 3TMPA 4MZSA 2FT2A 4X6HA 3BB7A 1PADA 4XUIA 2AUZA 4N4ZA 3D6SA 3P5UA 3V6CA 4Q8HA 7PCKA 2R9OA 4CDEB 3K8UA 2P7UA 4HXDB 4I05A 4X6JA 4BS6A 3ZNHA 2AGAA 1PBHA 3BPFA 4QRGA 4BOQA 2HWKA 2G6DA 4M0WA 1JQPA 2HH5A 2E01A 1TU6A 4MZOA 1NLJA 3IMAA 1ZCMA 1CV8A 2IBIA 4YYWA 4PT5A 2P86A 2VHSA 1PPDA 1QDQA 3MHSA 2J7QA 3H89A 4BOZA 4CDCB 1DKIA 4KLBA 4RKXA 4W4UA 5EZSA 3O1GA 3BOWA 4G54A 2BTWB 2B1NA 2WBFX 3P5XA 1O0EA 3MP2A 3KKUA 3C9EA 3KFQA 1A6RA 3PHWA 2HXZA 2VHFA 3MORA 4BOUA 3PHUA 1GLOA 4IUMA 1YK7A 2DC8A 4OVZA 3GCBA 4OEMA 1AU0A 2YJBA 5JA7A 1KFXL 2PNSA 1U5IA 3I06A 4W5CA 2FTDA 3W31A 2DC9A 3MJ5A 4YYRA 4W5BA 1ME3A 4WURA 3QT4A 3IOQA 1QOLA 1YVBA 1HUCB 3KSEA 1KHQA 3DF0A 5F02A 1CB5A 2ATOA 3OISA 1BP4A 2R9CA 3BWKA 1CQDA 2NQIA 2BU3A 3ERVA 3F5VA 3MHHA 3PRPA 1YALA 3PDFA 4QBBA 3H6SA 3RVVA 3AI8A 5J94A 2F1GA 4BS5A 1CS8A
chains in the Genus database with same CATH topology
1NQCA 2DZYA 3NHEA 2GFOA 2C0YA 1SP4B 2E03A 2YJCA 4QRXA 3U8EA 3K9MA 2AVWA 2YJ9A 3LXSA 3P5WA 1TLOA 2AIMA 2ARYA 2DC7A 1STFE 2P0RA 2DCCA 1NB5A 2O6XA 1EWMA 3HHAA 3HHIA 1AYWA 1AU4A 1Y08A 1K3BB 1CVZA 3CH3X 1KXRA 2H7JA 1BQIA 3BC3A 5JH3A 1KFUL 4YVAA 4FK5A 5EF4A 1AU3A 2XU5A 2JQGR 1ZIVA 4P6EA 3H8CA 2PREA 9PAPA 3IV2A 4X6IA 3OF8A 2DC6A 5CVMA 1QXPA 2DCAA 5K16A 3V6EA 3H7DA 1MS6A 3MTNA 5EGWA 3KWZA 1XKGA 3QSDA 8PCHA 4P6GA 4N79A 1TL9A 1U9QX 1PPPA 4NV8A 4OELA 3HWNA 3RVWA 3WXEA 2Y5BA 4ZUXU 2VFCA 4CDDB 4PI3A 1QMYA 1F2AA 4MSXA 2G8EA 4FIPA 1AYVA 1F2CA 1AYUA 2BDZA 5A24A 3KWBX 4HWYA 2AYNA 3BCNA 2AUXA 3KW9A 2AYOA 2E00A 2NQAA 1EWPA 1DEUA 3N3KA 1F2BA 2CIOA 1KHPA 3RVXA 1PCIA 3N3GA 2NQDB 3WXGA 1GCBA 3OVZA 1X9YA 2R9FA 2R9MA 4BSQA 3PBHA 5PADA 4N8WA 2DCBA 3P5VA 2OULA 1E2TA 4YYUA 2PADA 4BQVA 4NV7A 3S3QA 1PIPA 2DJFB 4PP1A 1YT7A 1BY8A 1Y4HA 3E1ZB 4AXLA 2ACTA 2FO5A 2YJ2A 1DF0A 3CBKA 1ME4A 2R9NA 3USVA 1S4VA 4QRVA 3IEJA 3O0UA 2JQFR 1AECA 1MHWA 1F29A 3H8BA 3PW3A 3IUTA 2OP3A 1U9XA 1SNKA 1FH0A 2R6NA 2FYEA 2HHNA 4CDFB 4QH6A 1AIMA 1U9VA 1PXVA 3D9WA 1IWDA 1W6FA 2FQ9A 3ZUAA 4RY2A 2BDLA 2DCDA 4GUZA 2CB5A 1EWOA 2HD5A 2G7YA 3LTWA 3I3TA 4K7CA 1W4TA 3N4CA 3KX1A 1ITOA 5CHTA 4XR7A 4PP2E 2XU3A 2PBHA 3QJ3A 1Q6KA 4DMXA 3CBJA 3F75A 1CSBB 1U9WA 2DZZA 1EWLA 2XU1A 4Q8GA 3S3RA 2B1MA 4WA6A 3CH2X 2YJ8A 4FJCA 3B79A 4AXMA 5FPWA 2IPPB 4BGFA 4YYQA 6PADA 3BPMA 4DMYA 1NB3A 1PPOA 4I04A 4PADA 2F7DA 1MIRA 3OF9A 2G8JA 2FRQA 3K24A 1EF7A 3PNRA 2NQGA 2AU1A 4I07A 1GECE 1MEMA 2FRAA 1MDWA 4BPVA 5CVNB 2XU4A 5CVOB 1GMYA 2FUDA 3OVXA 3WXFA 1PE6A 4YYVA 1NPZA 1THEA 1CPJA 3M99A 3LFYA 1POPA 1BGOA 2DJGB 2AS8A 3HD3A 1ATKA 1M6DA 1MEGA 1GX3A 2OZ2A 4YV8A 1CJLA 1ICFA 1PPNA 2E02A 2GHUA 1YK8A 3TNXA 3IHPA 1VSNA 4YYSA 1AU2A 4CZWA 1NL6A 5CHVA 1CTEA 2Y6EA 1VJVA 4MZSA 2FT2A 4X6HA 1PADA 4XUIA 2AUZA 4N4ZA 3D6SA 3P5UA 3V6CA 4Q8HA 7PCKA 2R9OA 4CDEB 3K8UA 4I05A 2P7UA 4X6JA 4BS6A 1PBHA 3BPFA 4QRGA 2G6DA 1JQPA 2HH5A 2E01A 1TU6A 4MZOA 1NLJA 3IMAA 1ZCMA 1CV8A 2IBIA 4YYWA 2P86A 2VHSA 1PPDA 1QDQA 3MHSA 3H89A 4CDCB 4KLBA 4W4UA 3O1GA 3BOWA 4G54A 2B1NA 2WBFX 3P5XA 2BSZA 1O0EA 3KKUA 3C9EA 3KFQA 1A6RA 2HXZA 2VHFA 3MORA 1GLOA 1YK7A 2DC8A 3GCBA 4OEMA 1AU0A 2YJBA 5JA7A 1KFXL 2PNSA 1U5IA 3I06A 4W5CA 2FTDA 4B55A 2VFBA 2DC9A 4YYRA 4W5BA 1ME3A 3QT4A 3IOQA 1QOLA 1YVBA 1W5RA 1HUCB 3KSEA 1KHQA 3DF0A 5F02A 1CB5A 2ATOA 1BP4A 2R9CA 3BWKA 3OISA 1CQDA 2NQIA 3ERVA 3F5VA 3MHHA 1YALA 3PDFA 4QBBA 3H6SA 3RVVA 3AI8A 5J94A 4C5PA 2F1GA 4BS5A 1CS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQC A;  2DZY A;  3NHE A;  2GFO A;  2C0Y A;  1SP4 B;  2E03 A;  2YJC A;  4QRX A;  3U8E A;  3K9M A;  2AVW A;  2YJ9 A;  3LXS A;  3P5W A;  1TLO A;  2AIM A;  2ARY A;  2DC7 A;  1STF E;  2P0R A;  2DCC A;  1NB5 A;  2O6X A;  1EWM A;  3HHA A;  3HHI A;  1AYW A;  1AU4 A;  1Y08 A;  1K3B B;  1CVZ A;  3CH3 X;  1KXR A;  2H7J A;  1BQI A;  3BC3 A;  5JH3 A;  1KFU L;  4YVA A;  4FK5 A;  5EF4 A;  1AU3 A;  2XU5 A;  2JQG R;  1ZIV A;  4P6E A;  3H8C A;  2PRE A;  9PAP A;  3IV2 A;  4X6I A;  3OF8 A;  2DC6 A;  5CVM A;  1QXP A;  2DCA A;  5K16 A;  3V6E A;  3H7D A;  1MS6 A;  3MTN A;  5EGW A;  3KWZ A;  1XKG A;  3QSD A;  8PCH A;  4P6G A;  4N79 A;  1TL9 A;  1U9Q X;  1PPP A;  4OEL A;  3HWN A;  3RVW A;  3WXE A;  2Y5B A;  4ZUX U;  4CDD B;  4PI3 A;  1QMY A;  1F2A A;  4MSX A;  2G8E A;  4FIP A;  1AYV A;  1F2C A;  1AYU A;  2BDZ A;  5A24 A;  3KWB X;  4HWY A;  2AYN A;  3BCN A;  2AUX A;  3KW9 A;  2AYO A;  2E00 A;  2NQA A;  1EWP A;  1DEU A;  3N3K A;  1F2B A;  2CIO A;  1KHP A;  3RVX A;  1PCI A;  3N3G A;  2NQD B;  3WXG A;  1GCB A;  3OVZ A;  1X9Y A;  2R9F A;  2R9M A;  4BSQ A;  3PBH A;  5PAD A;  4N8W A;  2DCB A;  3P5V A;  2OUL A;  4YYU A;  2PAD A;  4BQV A;  3S3Q A;  1PIP A;  2DJF B;  4PP1 A;  1YT7 A;  1BY8 A;  1Y4H A;  3E1Z B;  4AXL A;  2ACT A;  2FO5 A;  2YJ2 A;  1DF0 A;  3CBK A;  1ME4 A;  2R9N A;  3USV A;  1S4V A;  4QRV A;  3IEJ A;  3O0U A;  2JQF R;  1AEC A;  1MHW A;  1F29 A;  3H8B A;  3PW3 A;  3IUT A;  2OP3 A;  1U9X A;  1SNK A;  1FH0 A;  2R6N A;  2FYE A;  2HHN A;  4CDF B;  4QH6 A;  1AIM A;  1U9V A;  1PXV A;  1IWD A;  2FQ9 A;  3ZUA A;  4RY2 A;  2BDL A;  2DCD A;  2CB5 A;  1EWO A;  2HD5 A;  2G7Y A;  3I3T A;  4K7C A;  3N4C A;  3KX1 A;  1ITO A;  5CHT A;  4XR7 A;  4PP2 E;  2XU3 A;  2PBH A;  3QJ3 A;  1Q6K A;  4DMX A;  3CBJ A;  3F75 A;  1CSB B;  1U9W A;  2DZZ A;  1EWL A;  2XU1 A;  4Q8G A;  3S3R A;  2B1M A;  4WA6 A;  3CH2 X;  2YJ8 A;  4FJC A;  3B79 A;  4AXM A;  5FPW A;  2IPP B;  4YYQ A;  6PAD A;  3BPM A;  4DMY A;  1NB3 A;  1PPO A;  4I04 A;  4PAD A;  2F7D A;  1MIR A;  3OF9 A;  2G8J A;  2FRQ A;  3K24 A;  1EF7 A;  3PNR A;  2NQG A;  2AU1 A;  4I07 A;  1GEC E;  1MEM A;  2FRA A;  1MDW A;  4BPV A;  5CVN B;  2XU4 A;  5CVO B;  1GMY A;  2FUD A;  3OVX A;  3WXF A;  1PE6 A;  4YYV A;  1NPZ A;  1THE A;  1CPJ A;  3M99 A;  3LFY A;  1POP A;  1BGO A;  2DJG B;  2AS8 A;  3HD3 A;  1ATK A;  1M6D A;  1MEG A;  2OZ2 A;  4YV8 A;  1CJL A;  1ICF A;  1PPN A;  2E02 A;  2GHU A;  1YK8 A;  3TNX A;  3IHP A;  1VSN A;  4YYS A;  1AU2 A;  4CZW A;  1NL6 A;  5CHV A;  1CTE A;  2Y6E A;  1VJV A;  4MZS A;  2FT2 A;  4X6H A;  1PAD A;  4XUI A;  2AUZ A;  4N4Z A;  3D6S A;  3P5U A;  3V6C A;  4Q8H A;  7PCK A;  2R9O A;  4CDE B;  3K8U A;  4I05 A;  2P7U A;  4X6J A;  4BS6 A;  1PBH A;  3BPF A;  4QRG A;  2G6D A;  1JQP A;  2HH5 A;  2E01 A;  1TU6 A;  4MZO A;  1NLJ A;  3IMA A;  1ZCM A;  1CV8 A;  2IBI A;  4YYW A;  2P86 A;  2VHS A;  1PPD A;  1QDQ A;  3MHS A;  3H89 A;  4CDC B;  4KLB A;  4W4U A;  3O1G A;  3BOW A;  4G54 A;  2B1N A;  2WBF X;  3P5X A;  1O0E A;  3KKU A;  3C9E A;  3KFQ A;  1A6R A;  2HXZ A;  2VHF A;  3MOR A;  1GLO A;  1YK7 A;  2DC8 A;  3GCB A;  4OEM A;  1AU0 A;  2YJB A;  5JA7 A;  1KFX L;  2PNS A;  1U5I A;  3I06 A;  4W5C A;  2FTD A;  2DC9 A;  4YYR A;  4W5B A;  1ME3 A;  3QT4 A;  3IOQ A;  1QOL A;  1YVB A;  1HUC B;  3KSE A;  1KHQ A;  3DF0 A;  5F02 A;  1CB5 A;  2ATO A;  1BP4 A;  2R9C A;  3BWK A;  3OIS A;  1CQD A;  2NQI A;  3ERV A;  3F5V A;  3MHH A;  1YAL A;  4QBB A;  3PDF A;  3H6S A;  3RVV A;  3AI8 A;  5J94 A;  2F1G A;  4BS5 A;  1CS8 A; 
#chains in the Genus database with same CATH topology
 5E6J A;  1NQC A;  2DZY A;  3NHE A;  2GFO A;  2C0Y A;  1SP4 B;  2E03 A;  2YJC A;  4QRX A;  4D8B A;  3U8E A;  3K9M A;  2AVW A;  2YJ9 A;  3LXS A;  3P5W A;  1TLO A;  1PVJ A;  2AIM A;  2ARY A;  4RF0 A;  2DC7 A;  1STF E;  2P0R A;  2DCC A;  2FE8 A;  1NB5 A;  2O6X A;  1EWM A;  4D8E A;  3HHA A;  3HHI A;  1AYW A;  1AU4 A;  1Y08 A;  3O65 A;  1K3B B;  1UKF A;  1CVZ A;  3CH3 X;  1KXR A;  2H7J A;  1BQI A;  3BC3 A;  5JH3 A;  1KFU L;  4YVA A;  4FK5 A;  5EF4 A;  1AU3 A;  2XU5 A;  2JQG R;  1ZIV A;  3PT2 A;  4P6E A;  4D8I A;  3H8C A;  2PRE A;  9PAP A;  3IV2 A;  4X6I A;  3BY4 A;  3OF8 A;  2DC6 A;  5CVM A;  4ZTB A;  1QXP A;  2DCA A;  5K16 A;  3V6E A;  3H7D A;  1MS6 A;  3MTN A;  5EGW A;  3KWZ A;  3E9S A;  1XKG A;  3QSD A;  8PCH A;  4P6G A;  4N79 A;  1TL9 A;  1U9Q X;  1PPP A;  4OEL A;  3HWN A;  3RVW A;  3WXE A;  2Y5B A;  4ZUX U;  2JRI A;  4CDD B;  4PI3 A;  4MM3 B;  4RNA A;  1QMY A;  3PSE A;  1F2A A;  4MSX A;  2J7Q C;  2G8E A;  4FIP A;  1AYV A;  1F2C A;  1AYU A;  2BDZ A;  5A24 A;  3KWB X;  4HWY A;  2AYN A;  3BCN A;  2AUX A;  3KW9 A;  2AYO A;  2E00 A;  2NQA A;  1EWP A;  1DEU A;  3N3K A;  1F2B A;  2CIO A;  1KHP A;  3RVX A;  1PCI A;  3N3G A;  2NQD B;  3WXG A;  1GCB A;  3OVZ A;  1X9Y A;  2R9F A;  2R9M A;  4BSQ A;  3PBH A;  5PAD A;  4N8W A;  2DCB A;  3P5V A;  2OUL A;  3RNV A;  4YYU A;  4BOS A;  2UZJ A;  2PAD A;  4BQV A;  3S3Q A;  1PIP A;  2DJF B;  5EZQ A;  2Z84 A;  4PP1 A;  4XZX A;  1YT7 A;  4IP3 A;  5JZE A;  1BY8 A;  2JTC A;  1Y4H A;  4MI7 A;  3E1Z B;  4AXL A;  2ACT A;  2FO5 A;  2YJ2 A;  1DF0 A;  3CBK A;  1ME4 A;  2R9N A;  3USV A;  1S4V A;  4QRV A;  3IEJ A;  3O0U A;  2JQF R;  1AEC A;  1MHW A;  1F29 A;  3H8B A;  3PW3 A;  3IUT A;  2OP3 A;  1U9X A;  1SNK A;  4GUA A;  1FH0 A;  2R6N A;  2FYE A;  2HHN A;  4CDF B;  3BBA A;  4QH6 A;  1AIM A;  1U9V A;  4REZ A;  1PXV A;  1IWD A;  3W30 A;  2FQ9 A;  3ZUA A;  4RY2 A;  2BDL A;  2DCD A;  2CB5 A;  1EWO A;  2HD5 A;  2G7Y A;  3I3T A;  4K7C A;  3B21 A;  3N4C A;  3KX1 A;  1ITO A;  5CHT A;  4XR7 A;  4PP2 E;  2XU3 A;  2PBH A;  3OQC A;  3MTV A;  5KO3 A;  3QJ3 A;  1Q6K A;  4DMX A;  3CBJ A;  3F75 A;  1CSB B;  1U9W A;  2DZZ A;  1EWL A;  2XU1 A;  4Q8G A;  3S3R A;  2B1M A;  4WA6 A;  3CH2 X;  3PHX A;  2YJ8 A;  4FJC A;  3B79 A;  3TRK A;  4AXM A;  5FPW A;  4P16 A;  2IPP B;  4R3D A;  4OVZ B;  4YYQ A;  6PAD A;  3BPM A;  4DMY A;  1NB3 A;  4A5U A;  1PPO A;  4I04 A;  4PAD A;  2BTW A;  2F7D A;  1MIR A;  3C0R A;  3OF9 A;  2G8J A;  2FRQ A;  3K24 A;  1EF7 A;  3PNR A;  2NQG A;  2AU1 A;  4I07 A;  4BOP A;  1GEC E;  1MEM A;  2FRA A;  1MDW A;  4BPV A;  5CVN B;  2XU4 A;  5CVO B;  1GMY A;  2FUD A;  3OVX A;  3WXF A;  1PE6 A;  4RF1 A;  3IFU A;  4YYV A;  1NPZ A;  1THE A;  1CPJ A;  3M99 A;  3LFY A;  1POP A;  1BGO A;  2DOS A;  2DJG B;  2AS8 A;  3HD3 A;  1ATK A;  1M6D A;  1MEG A;  3PRM A;  2OZ2 A;  4YV8 A;  1CJL A;  1ICF A;  1PPN A;  1YZB A;  2E02 A;  2GHU A;  1YK8 A;  3TNX A;  3IHP A;  1VSN A;  4YYS A;  1AU2 A;  4CZW A;  1NL6 A;  5CHV A;  4OW0 A;  1CTE A;  2Y6E A;  1VJV A;  3TMP A;  4MZS A;  2FT2 A;  4X6H A;  3BB7 A;  1PAD A;  4XUI A;  2AUZ A;  4N4Z A;  3D6S A;  3P5U A;  3V6C A;  4Q8H A;  7PCK A;  2R9O A;  4CDE B;  3K8U A;  2P7U A;  4HXD B;  4I05 A;  4X6J A;  4BS6 A;  3ZNH A;  2AGA A;  1PBH A;  3BPF A;  4QRG A;  4BOQ A;  2HWK A;  2G6D A;  4M0W A;  1JQP A;  2HH5 A;  2E01 A;  1TU6 A;  4MZO A;  1NLJ A;  3IMA A;  1ZCM A;  1CV8 A;  2IBI A;  4YYW A;  4PT5 A;  2P86 A;  2VHS A;  1PPD A;  1QDQ A;  3MHS A;  2J7Q A;  3H89 A;  4BOZ A;  4CDC B;  1DKI A;  4KLB A;  4RKX A;  4W4U A;  5EZS A;  3O1G A;  3BOW A;  4G54 A;  2BTW B;  2B1N A;  2WBF X;  3P5X A;  1O0E A;  3MP2 A;  3KKU A;  3C9E A;  3KFQ A;  1A6R A;  3PHW A;  2HXZ A;  2VHF A;  3MOR A;  4BOU A;  3PHU A;  1GLO A;  4IUM A;  1YK7 A;  2DC8 A;  4OVZ A;  3GCB A;  4OEM A;  1AU0 A;  2YJB A;  5JA7 A;  1KFX L;  2PNS A;  1U5I A;  3I06 A;  4W5C A;  2FTD A;  3W31 A;  2DC9 A;  3MJ5 A;  4YYR A;  4W5B A;  1ME3 A;  4WUR A;  3QT4 A;  3IOQ A;  1QOL A;  1YVB A;  1HUC B;  3KSE A;  1KHQ A;  3DF0 A;  5F02 A;  1CB5 A;  2ATO A;  3OIS A;  1BP4 A;  2R9C A;  3BWK A;  1CQD A;  2NQI A;  2BU3 A;  3ERV A;  3F5V A;  3MHH A;  3PRP A;  1YAL A;  3PDF A;  4QBB A;  3H6S A;  3RVV A;  3AI8 A;  5J94 A;  2F1G A;  4BS5 A;  1CS8 A; 
#chains in the Genus database with same CATH homology
 1NQC A;  2DZY A;  3NHE A;  2GFO A;  2C0Y A;  1SP4 B;  2E03 A;  2YJC A;  4QRX A;  3U8E A;  3K9M A;  2AVW A;  2YJ9 A;  3LXS A;  3P5W A;  1TLO A;  2AIM A;  2ARY A;  2DC7 A;  1STF E;  2P0R A;  2DCC A;  1NB5 A;  2O6X A;  1EWM A;  3HHA A;  3HHI A;  1AYW A;  1AU4 A;  1Y08 A;  1K3B B;  1CVZ A;  3CH3 X;  1KXR A;  2H7J A;  1BQI A;  3BC3 A;  5JH3 A;  1KFU L;  4YVA A;  4FK5 A;  5EF4 A;  1AU3 A;  2XU5 A;  2JQG R;  1ZIV A;  4P6E A;  3H8C A;  2PRE A;  9PAP A;  3IV2 A;  4X6I A;  3OF8 A;  2DC6 A;  5CVM A;  1QXP A;  2DCA A;  5K16 A;  3V6E A;  3H7D A;  1MS6 A;  3MTN A;  5EGW A;  3KWZ A;  1XKG A;  3QSD A;  8PCH A;  4P6G A;  4N79 A;  1TL9 A;  1U9Q X;  1PPP A;  4NV8 A;  4OEL A;  3HWN A;  3RVW A;  3WXE A;  2Y5B A;  4ZUX U;  2VFC A;  4CDD B;  4PI3 A;  1QMY A;  1F2A A;  4MSX A;  2G8E A;  4FIP A;  1AYV A;  1F2C A;  1AYU A;  2BDZ A;  5A24 A;  3KWB X;  4HWY A;  2AYN A;  3BCN A;  2AUX A;  3KW9 A;  2AYO A;  2E00 A;  2NQA A;  1EWP A;  1DEU A;  3N3K A;  1F2B A;  2CIO A;  1KHP A;  3RVX A;  1PCI A;  3N3G A;  2NQD B;  3WXG A;  1GCB A;  3OVZ A;  1X9Y A;  2R9F A;  2R9M A;  4BSQ A;  3PBH A;  5PAD A;  4N8W A;  2DCB A;  3P5V A;  2OUL A;  1E2T A;  4YYU A;  2PAD A;  4BQV A;  4NV7 A;  3S3Q A;  1PIP A;  2DJF B;  4PP1 A;  1YT7 A;  1BY8 A;  1Y4H A;  3E1Z B;  4AXL A;  2ACT A;  2FO5 A;  2YJ2 A;  1DF0 A;  3CBK A;  1ME4 A;  2R9N A;  3USV A;  1S4V A;  4QRV A;  3IEJ A;  3O0U A;  2JQF R;  1AEC A;  1MHW A;  1F29 A;  3H8B A;  3PW3 A;  3IUT A;  2OP3 A;  1U9X A;  1SNK A;  1FH0 A;  2R6N A;  2FYE A;  2HHN A;  4CDF B;  4QH6 A;  1AIM A;  1U9V A;  1PXV A;  3D9W A;  1IWD A;  1W6F A;  2FQ9 A;  3ZUA A;  4RY2 A;  2BDL A;  2DCD A;  4GUZ A;  2CB5 A;  1EWO A;  2HD5 A;  2G7Y A;  3LTW A;  3I3T A;  4K7C A;  1W4T A;  3N4C A;  3KX1 A;  1ITO A;  5CHT A;  4XR7 A;  4PP2 E;  2XU3 A;  2PBH A;  3QJ3 A;  1Q6K A;  4DMX A;  3CBJ A;  3F75 A;  1CSB B;  1U9W A;  2DZZ A;  1EWL A;  2XU1 A;  4Q8G A;  3S3R A;  2B1M A;  4WA6 A;  3CH2 X;  2YJ8 A;  4FJC A;  3B79 A;  4AXM A;  5FPW A;  2IPP B;  4BGF A;  4YYQ A;  6PAD A;  3BPM A;  4DMY A;  1NB3 A;  1PPO A;  4I04 A;  4PAD A;  2F7D A;  1MIR A;  3OF9 A;  2G8J A;  2FRQ A;  3K24 A;  1EF7 A;  3PNR A;  2NQG A;  2AU1 A;  4I07 A;  1GEC E;  1MEM A;  2FRA A;  1MDW A;  4BPV A;  5CVN B;  2XU4 A;  5CVO B;  1GMY A;  2FUD A;  3OVX A;  3WXF A;  1PE6 A;  4YYV A;  1NPZ A;  1THE A;  1CPJ A;  3M99 A;  3LFY A;  1POP A;  1BGO A;  2DJG B;  2AS8 A;  3HD3 A;  1ATK A;  1M6D A;  1MEG A;  1GX3 A;  2OZ2 A;  4YV8 A;  1CJL A;  1ICF A;  1PPN A;  2E02 A;  2GHU A;  1YK8 A;  3TNX A;  3IHP A;  1VSN A;  4YYS A;  1AU2 A;  4CZW A;  1NL6 A;  5CHV A;  1CTE A;  2Y6E A;  1VJV A;  4MZS A;  2FT2 A;  4X6H A;  1PAD A;  4XUI A;  2AUZ A;  4N4Z A;  3D6S A;  3P5U A;  3V6C A;  4Q8H A;  7PCK A;  2R9O A;  4CDE B;  3K8U A;  4I05 A;  2P7U A;  4X6J A;  4BS6 A;  1PBH A;  3BPF A;  4QRG A;  2G6D A;  1JQP A;  2HH5 A;  2E01 A;  1TU6 A;  4MZO A;  1NLJ A;  3IMA A;  1ZCM A;  1CV8 A;  2IBI A;  4YYW A;  2P86 A;  2VHS A;  1PPD A;  1QDQ A;  3MHS A;  3H89 A;  4CDC B;  4KLB A;  4W4U A;  3O1G A;  3BOW A;  4G54 A;  2B1N A;  2WBF X;  3P5X A;  2BSZ A;  1O0E A;  3KKU A;  3C9E A;  3KFQ A;  1A6R A;  2HXZ A;  2VHF A;  3MOR A;  1GLO A;  1YK7 A;  2DC8 A;  3GCB A;  4OEM A;  1AU0 A;  2YJB A;  5JA7 A;  1KFX L;  2PNS A;  1U5I A;  3I06 A;  4W5C A;  2FTD A;  4B55 A;  2VFB A;  2DC9 A;  4YYR A;  4W5B A;  1ME3 A;  3QT4 A;  3IOQ A;  1QOL A;  1YVB A;  1W5R A;  1HUC B;  3KSE A;  1KHQ A;  3DF0 A;  5F02 A;  1CB5 A;  2ATO A;  1BP4 A;  2R9C A;  3BWK A;  3OIS A;  1CQD A;  2NQI A;  3ERV A;  3F5V A;  3MHH A;  1YAL A;  3PDF A;  4QBB A;  3H6S A;  3RVV A;  3AI8 A;  5J94 A;  4C5P A;  2F1G A;  4BS5 A;  1CS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...