2GHUA

Crystal structure of falcipain-2 from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
publication title Structural and Functional Characterization of Falcipain-2, a Hemoglobinase from the Malarial Parasite Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 67
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ghuA00
2B1MA 2E03A 2R6NA 4YYSA 3RVXA 4BSQA 1ATKA 2AUZA 3ERVA 4P6EA 2AIMA 1PPNA 2PREA 4QRVA 9PAPA 1TU6A 2G8EA 3I06A 1X9YA 1PPOA 4YYWA 3RVVA 1DF0A 1O0EA 1PADA 1XKGA 1ZIVA 1CPJA 4ZUXU 1U9QX 2ARYA 5CVMA 3WXGA 1CJLA 5J94A 5K16A 3CH2X 1PBHA 1QXPA 3V6CA 2HD5A 2E01A 4X6HA 5CVNB 3P5WA 1QMYA 2AYNA 4FK5A 5CHTA 1U5IA 4YYUA 3PNRA 5JA7A 3QT4A 3PBHA 1GMYA 3LFYA 3KWZA 3RVWA 3U8EA 1ZCMA 3H6SA 4CZWA 2YJCA 3O0UA 1JQPA 3KW9A 3HHAA 4N4ZA 1KXRA 2DZZA 3H89A 4W4UA 1GECE 1STFE 5PADA 2NQGA 3CH3X 3F5VA 1NB3A 3I3TA 1CQDA 2DC9A 4FIPA 4OELA 3DF0A 2XU3A 4W5CA 1BGOA 2FTDA 3PDFA 4P6GA 1PIPA 1VJVA 5JH3A 3D6SA 3F75A 1CSBB 1NPZA 1Y4HA 4PP2E 1KHQA 1MIRA 2ATOA 2GHUA 2H7JA 1EWPA 5F02A 2YJ9A 4HWYA 4CDEB 7PCKA 4WA6A 1AYUA 1NLJA 3CBKA 6PADA 4X6IA 1MHWA 4MZOA 2F1GA 1TLOA 3PW3A 4OEMA 1EF7A 3H7DA 3WXFA 1DEUA 2DCCA 2DCDA 3N3KA 3IOQA 4MSXA 1CS8A 1PXVA 2PBHA 1NB5A 1GLOA 1MEGA 1ICFA 3LXSA 3BPFA 3IV2A 4I04A 3TNXA 2YJ8A 3MTNA 1HUCB 3KKUA 2CB5A 1TL9A 2XU5A 2IBIA 1POPA 1MDWA 2OULA 2AVWA 1EWOA 2G7YA 3OVZA 3BPMA 4CDFB 4CDCB 3K8UA 2DCAA 1QDQA 1KFXL 3BC3A 1QOLA 2P86A 3KX1A 1SP4B 2Y6EA 1PCIA 2NQDB 3M99A 4XUIA 3BWKA 3IUTA 1PPDA 1VSNA 3OF9A 2XU4A 4YYVA 4N79A 4BQVA 2BDLA 3S3RA 2DC7A 4QBBA 4CDDB 5CVOB 1AU3A 3ZUAA 3P5XA 1Q6KA 1GCBA 4YYQA 3K9MA 5CHVA 2FO5A 3OVXA 2DJFB 2JQGR 2IPPB 3KWBX 1CV8A 3H8BA 2Y5BA 1MS6A 1YVBA 2NQIA 2YJ2A 2F7DA 3CBJA 3N4CA 2OZ2A 3OF8A 3MHHA 1ME3A 4MZSA 1YALA 2CIOA 2YJBA 3O1GA 4PADA 4AXLA 2NQAA 3BCNA 3USVA 1THEA 2BDZA 3H8CA 1ITOA 1S4VA 3IEJA 4BS6A 1YK7A 2O6XA 2R9NA 3QSDA 3QJ3A 1AIMA 4YYRA 1FH0A 3P5UA 2R9FA 1NL6A 4QRXA 3K24A 2FRAA 4K7CA 2HXZA 3C9EA 4I05A 4DMXA 1YK8A 3HHIA 3HWNA 1U9XA 1F2CA 1AECA 3AI8A 1AU0A 4QRGA 1CTEA 2FQ9A 2P7UA 4QH6A 1ME4A 3E1ZB 2ACTA 1EWLA 2FYEA 3IHPA 1MEMA 3WXEA 4W5BA 1F29A 4YV8A 1AYVA 2WBFX 1KHPA 2AUXA 2AYOA 2E02A 5EF4A 2DCBA 2DZYA 2DJGB 2G8JA 3KFQA 1KFUL 1AU2A 2C0YA 4Q8HA 1CB5A 3KSEA 2HH5A 3P5VA 3N3GA 2AU1A 2AS8A 4X6JA 2VHFA 5FPWA 1BP4A 1M6DA 1K3BB 4KLBA 1AU4A 3B79A 4Q8GA 2FT2A 4G54A 1NQCA 4YVAA 1BQIA 4FJCA 1U9VA 2R9MA 3GCBA 1PPPA 2R9CA 1A6RA 4PP1A 4AXMA 2R9OA 3S3QA 2HHNA 5A24A 1F2AA 4DMYA 2GFOA 2XU1A 2B1NA 2VHSA 3MORA 2FUDA 4RY2A 1CVZA 2G6DA 3HD3A 3IMAA 1IWDA 4N8WA 2PNSA 1PE6A 2JQFR 3OISA 8PCHA 1BY8A 1U9WA 4I07A 4BS5A 2FRQA 1SNKA 3MHSA 1Y08A 1EWMA 2OP3A 4XR7A 5EGWA 2PADA 2P0RA 1F2BA 1YT7A 2DC8A 2DC6A 2E00A 3BOWA 4PI3A 4BPVA 3V6EA 3NHEA 1AYWA
chains in the Genus database with same CATH superfamily
2B1MA 2E03A 2R6NA 4YYSA 3RVXA 4BSQA 1ATKA 2AUZA 4RNAA 3ERVA 4P6EA 2AIMA 1PPNA 3MTVA 2PREA 4OVZA 4QRVA 9PAPA 1TU6A 4D8EA 2G8EA 3RNVA 3I06A 1X9YA 1PPOA 4YYWA 3RVVA 1DF0A 3E9SA 1O0EA 1PADA 4P16A 2JRIA 1XKGA 1ZIVA 1CPJA 4ZUXU 1U9QX 2ARYA 5CVMA 2BU3A 3WXGA 1CJLA 5J94A 4MM3B 5K16A 4WURA 3CH2X 1PBHA 1QXPA 3V6CA 2HD5A 2E01A 4X6HA 5CVNB 3MP2A 3C0RA 4BOQA 3P5WA 1QMYA 2AYNA 4FK5A 5CHTA 1U5IA 4YYUA 3PNRA 5JA7A 3QT4A 3PBHA 1GMYA 3LFYA 3KWZA 3RVWA 3U8EA 1ZCMA 3H6SA 4CZWA 2YJCA 3O0UA 1JQPA 3KW9A 3HHAA 4HXDB 2FE8A 4N4ZA 1KXRA 2DZZA 3BY4A 2J7QA 3B21A 3H89A 4W4UA 1GECE 1STFE 5PADA 2NQGA 3CH3X 3F5VA 3I3TA 1NB3A 1CQDA 2DC9A 4FIPA 3DF0A 2XU3A 4OELA 4W5CA 4OVZB 1BGOA 2FTDA 3PDFA 4P6GA 1PIPA 1VJVA 5JH3A 3D6SA 5E6JA 3F75A 1CSBB 1NPZA 1Y4HA 4PP2E 1KHQA 1MIRA 3PHWA 2ATOA 4D8BA 2GHUA 2H7JA 1EWPA 5F02A 2YJ9A 4HWYA 4CDEB 7PCKA 4WA6A 1AYUA 1NLJA 3CBKA 6PADA 4X6IA 1MHWA 5EZSA 4MZOA 2F1GA 1TLOA 3PW3A 4OEMA 3PRPA 4GUAA 1EF7A 3H7DA 3WXFA 4RF0A 1DEUA 2DCCA 2DCDA 4REZA 3N3KA 3IOQA 4MSXA 1CS8A 1PXVA 2PBHA 1NB5A 3W30A 1GLOA 1MEGA 1ICFA 3LXSA 4R3DA 3BPFA 3IV2A 3MJ5A 4I04A 3TNXA 2YJ8A 3MTNA 1HUCB 3KKUA 2CB5A 2BTWB 1TL9A 2XU5A 2IBIA 3TRKA 1POPA 1MDWA 2OULA 2AVWA 1EWOA 2G7YA 3OVZA 3BPMA 4CDFB 4CDCB 3K8UA 2DCAA 1QDQA 4BOPA 1KFXL 3BC3A 1QOLA 2P86A 3KX1A 1SP4B 2Y6EA 1PCIA 2NQDB 3M99A 4XUIA 3BWKA 3IUTA 1PPDA 1VSNA 3OF9A 4OW0A 2XU4A 4YYVA 4N79A 4BQVA 2BDLA 3S3RA 2DC7A 3OQCA 3TMPA 4QBBA 4BOSA 2BTWA 4CDDB 5CVOB 1AU3A 3ZUAA 3P5XA 1Q6KA 3PHUA 1GCBA 4YYQA 3K9MA 5CHVA 4IUMA 2HWKA 2FO5A 3W31A 3OVXA 2DJFB 2JQGR 2IPPB 3KWBX 3PHXA 3PRMA 1CV8A 3H8BA 2Y5BA 1MS6A 1YVBA 2NQIA 5EZQA 1DKIA 3O65A 2YJ2A 4A5UA 2F7DA 3CBJA 3N4CA 2OZ2A 3OF8A 3MHHA 1ME3A 4MZSA 1YALA 2CIOA 2YJBA 3O1GA 4PADA 4AXLA 1PVJA 2NQAA 3BCNA 3USVA 1THEA 2BDZA 4RKXA 3H8CA 4XZXA 1ITOA 1S4VA 3IEJA 4BS6A 1YK7A 2O6XA 2R9NA 3QSDA 3QJ3A 1AIMA 4YYRA 1FH0A 3P5UA 2R9FA 1NL6A 4QRXA 3K24A 2FRAA 3ZNHA 4K7CA 2HXZA 3C9EA 4I05A 4DMXA 1YK8A 3HHIA 3HWNA 1U9XA 1F2CA 1AECA 3AI8A 1AU0A 4QRGA 1CTEA 4PT5A 2FQ9A 2P7UA 4QH6A 1ME4A 3E1ZB 2ACTA 1EWLA 2FYEA 5KO3A 3IHPA 4M0WA 1MEMA 3WXEA 2DOSA 4BOUA 4W5BA 1F29A 4YV8A 1AYVA 2WBFX 1KHPA 2AUXA 2AYOA 2E02A 5EF4A 2DCBA 3IFUA 2DZYA 3BBAA 2DJGB 2G8JA 4IP3A 3PT2A 3KFQA 1KFUL 1AU2A 2C0YA 4Q8HA 3BB7A 1CB5A 3KSEA 2HH5A 3P5VA 3N3GA 4RF1A 2AU1A 2AS8A 4X6JA 2VHFA 5FPWA 1BP4A 2JTCA 1M6DA 1K3BB 4KLBA 1YZBA 1AU4A 3B79A 4Q8GA 2FT2A 4G54A 1NQCA 4YVAA 1BQIA 4ZTBA 4FJCA 1U9VA 2R9MA 3GCBA 2AGAA 1PPPA 2R9CA 1A6RA 4PP1A 4AXMA 2J7QC 2R9OA 3S3QA 2HHNA 5A24A 4D8IA 1F2AA 4DMYA 2GFOA 2XU1A 1UKFA 2B1NA 2VHSA 3MORA 5JZEA 2UZJA 3PSEA 4BOZA 2FUDA 4RY2A 1CVZA 2G6DA 3HD3A 3IMAA 1IWDA 4N8WA 2PNSA 1PE6A 2JQFR 3OISA 8PCHA 1BY8A 1U9WA 4I07A 4BS5A 2FRQA 1SNKA 3MHSA 1Y08A 1EWMA 4MI7A 2Z84A 2OP3A 4XR7A 5EGWA 2PADA 2P0RA 1F2BA 1YT7A 2DC8A 2DC6A 2E00A 3BOWA 4PI3A 4BPVA 3V6EA 3NHEA 1AYWA
chains in the Genus database with same CATH topology
2B1MA 4B55A 2E03A 2R6NA 4YYSA 3RVXA 4BSQA 1ATKA 2AUZA 3ERVA 4P6EA 2AIMA 1PPNA 2PREA 4QRVA 9PAPA 1TU6A 2G8EA 3I06A 1X9YA 1PPOA 4YYWA 3RVVA 1DF0A 2VFCA 1O0EA 1PADA 1XKGA 1ZIVA 1CPJA 4ZUXU 1U9QX 2ARYA 5CVMA 3WXGA 1CJLA 5J94A 5K16A 3CH2X 1PBHA 1QXPA 1W6FA 3V6CA 2HD5A 2E01A 4X6HA 5CVNB 3P5WA 1QMYA 1E2TA 2AYNA 4FK5A 5CHTA 1U5IA 4YYUA 3PNRA 5JA7A 3QT4A 3PBHA 1GMYA 3LFYA 3KWZA 3RVWA 3U8EA 1ZCMA 3H6SA 4CZWA 2YJCA 3O0UA 1JQPA 3KW9A 3HHAA 4N4ZA 1KXRA 2DZZA 3H89A 4W4UA 1GECE 1STFE 5PADA 2NQGA 3CH3X 3F5VA 1NB3A 3I3TA 1CQDA 2DC9A 4FIPA 3DF0A 2XU3A 4OELA 4W5CA 1BGOA 2FTDA 2VFBA 3PDFA 4P6GA 1PIPA 1VJVA 5JH3A 3D6SA 3F75A 1CSBB 1NPZA 1Y4HA 4PP2E 1KHQA 1MIRA 2ATOA 2GHUA 2H7JA 1EWPA 5F02A 1GX3A 1W4TA 2YJ9A 4HWYA 4CDEB 7PCKA 4WA6A 1AYUA 1NLJA 3CBKA 6PADA 4X6IA 1MHWA 4MZOA 2F1GA 1TLOA 3PW3A 4OEMA 1EF7A 3H7DA 3WXFA 1DEUA 2DCCA 2DCDA 3N3KA 3IOQA 4MSXA 1CS8A 1PXVA 2PBHA 4NV7A 1NB5A 1GLOA 1MEGA 1ICFA 3LXSA 3BPFA 3IV2A 4I04A 3TNXA 2YJ8A 3MTNA 1HUCB 3KKUA 2CB5A 1TL9A 2XU5A 2IBIA 1POPA 1MDWA 2OULA 2AVWA 1EWOA 2G7YA 3OVZA 3BPMA 4CDFB 4CDCB 3K8UA 2DCAA 1QDQA 1KFXL 3BC3A 1QOLA 2P86A 3KX1A 1SP4B 2Y6EA 1PCIA 2NQDB 3M99A 4XUIA 3BWKA 3IUTA 1PPDA 1VSNA 3OF9A 2XU4A 4YYVA 4N79A 4BQVA 2BDLA 3S3RA 2DC7A 4QBBA 4CDDB 5CVOB 1AU3A 3ZUAA 3P5XA 1Q6KA 1GCBA 4YYQA 3K9MA 5CHVA 1W5RA 2FO5A 4NV8A 3OVXA 2DJFB 2JQGR 2IPPB 3KWBX 1CV8A 2BSZA 3H8BA 2Y5BA 1MS6A 1YVBA 2NQIA 2YJ2A 2F7DA 3CBJA 3N4CA 2OZ2A 3OF8A 3MHHA 1ME3A 4BGFA 4MZSA 1YALA 2CIOA 2YJBA 4C5PA 3O1GA 4PADA 4AXLA 2NQAA 3BCNA 3USVA 1THEA 2BDZA 3H8CA 1ITOA 1S4VA 3IEJA 4BS6A 1YK7A 2O6XA 2R9NA 3QSDA 3QJ3A 1AIMA 4YYRA 1FH0A 3P5UA 2R9FA 1NL6A 4QRXA 3K24A 2FRAA 4K7CA 2HXZA 4GUZA 3C9EA 4I05A 4DMXA 1YK8A 3HHIA 3HWNA 1U9XA 1F2CA 1AECA 3AI8A 1AU0A 4QRGA 1CTEA 2FQ9A 2P7UA 4QH6A 1ME4A 3E1ZB 2ACTA 1EWLA 2FYEA 3IHPA 1MEMA 3WXEA 4W5BA 1F29A 4YV8A 1AYVA 2WBFX 1KHPA 2AUXA 2AYOA 2E02A 5EF4A 2DCBA 2DZYA 2DJGB 2G8JA 3KFQA 1KFUL 1AU2A 2C0YA 4Q8HA 1CB5A 3KSEA 2HH5A 3P5VA 3N3GA 2AU1A 2AS8A 4X6JA 2VHFA 5FPWA 1BP4A 1M6DA 1K3BB 4KLBA 1AU4A 3B79A 4Q8GA 2FT2A 4G54A 1NQCA 4YVAA 1BQIA 4FJCA 3LTWA 1U9VA 3D9WA 2R9MA 3GCBA 1PPPA 2R9CA 1A6RA 4PP1A 4AXMA 2R9OA 3S3QA 2HHNA 5A24A 1F2AA 4DMYA 2GFOA 2XU1A 2B1NA 2VHSA 3MORA 2FUDA 4RY2A 1CVZA 2G6DA 3HD3A 3IMAA 1IWDA 4N8WA 2PNSA 1PE6A 2JQFR 3OISA 8PCHA 1BY8A 1U9WA 4I07A 4BS5A 2FRQA 1SNKA 3MHSA 1Y08A 1EWMA 2OP3A 4XR7A 5EGWA 2PADA 2P0RA 1F2BA 1YT7A 2DC8A 2DC6A 2E00A 3BOWA 4PI3A 4BPVA 3V6EA 3NHEA 1AYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1M A;  2E03 A;  2R6N A;  4YYS A;  3RVX A;  4BSQ A;  1ATK A;  2AUZ A;  3ERV A;  4P6E A;  2AIM A;  1PPN A;  2PRE A;  4QRV A;  9PAP A;  1TU6 A;  2G8E A;  3I06 A;  1X9Y A;  1PPO A;  4YYW A;  3RVV A;  1DF0 A;  1O0E A;  1PAD A;  1XKG A;  1ZIV A;  1CPJ A;  4ZUX U;  1U9Q X;  2ARY A;  5CVM A;  3WXG A;  1CJL A;  5J94 A;  5K16 A;  3CH2 X;  1PBH A;  1QXP A;  3V6C A;  2HD5 A;  2E01 A;  4X6H A;  5CVN B;  3P5W A;  1QMY A;  2AYN A;  4FK5 A;  5CHT A;  1U5I A;  4YYU A;  3PNR A;  5JA7 A;  3QT4 A;  3PBH A;  1GMY A;  3LFY A;  3KWZ A;  3RVW A;  3U8E A;  1ZCM A;  3H6S A;  4CZW A;  2YJC A;  3O0U A;  1JQP A;  3KW9 A;  3HHA A;  4N4Z A;  1KXR A;  2DZZ A;  3H89 A;  4W4U A;  1GEC E;  1STF E;  5PAD A;  2NQG A;  3CH3 X;  3F5V A;  1NB3 A;  3I3T A;  1CQD A;  2DC9 A;  4FIP A;  4OEL A;  3DF0 A;  2XU3 A;  4W5C A;  1BGO A;  2FTD A;  3PDF A;  4P6G A;  1PIP A;  1VJV A;  5JH3 A;  3D6S A;  3F75 A;  1CSB B;  1NPZ A;  1Y4H A;  4PP2 E;  1KHQ A;  1MIR A;  2ATO A;  2GHU A;  2H7J A;  1EWP A;  5F02 A;  2YJ9 A;  4HWY A;  4CDE B;  7PCK A;  4WA6 A;  1AYU A;  1NLJ A;  3CBK A;  6PAD A;  4X6I A;  1MHW A;  4MZO A;  2F1G A;  1TLO A;  3PW3 A;  4OEM A;  1EF7 A;  3H7D A;  3WXF A;  1DEU A;  2DCC A;  2DCD A;  3N3K A;  3IOQ A;  4MSX A;  1CS8 A;  1PXV A;  2PBH A;  1NB5 A;  1GLO A;  1MEG A;  1ICF A;  3LXS A;  3BPF A;  3IV2 A;  4I04 A;  3TNX A;  2YJ8 A;  3MTN A;  1HUC B;  3KKU A;  2CB5 A;  1TL9 A;  2XU5 A;  2IBI A;  1POP A;  1MDW A;  2OUL A;  2AVW A;  1EWO A;  2G7Y A;  3OVZ A;  3BPM A;  4CDF B;  4CDC B;  3K8U A;  2DCA A;  1QDQ A;  1KFX L;  3BC3 A;  1QOL A;  2P86 A;  3KX1 A;  1SP4 B;  2Y6E A;  1PCI A;  2NQD B;  3M99 A;  4XUI A;  3BWK A;  3IUT A;  1PPD A;  1VSN A;  3OF9 A;  2XU4 A;  4YYV A;  4N79 A;  4BQV A;  2BDL A;  3S3R A;  2DC7 A;  4QBB A;  4CDD B;  5CVO B;  1AU3 A;  3ZUA A;  3P5X A;  1Q6K A;  1GCB A;  4YYQ A;  3K9M A;  5CHV A;  2FO5 A;  3OVX A;  2DJF B;  2JQG R;  2IPP B;  3KWB X;  1CV8 A;  3H8B A;  2Y5B A;  1MS6 A;  1YVB A;  2NQI A;  2YJ2 A;  2F7D A;  3CBJ A;  3N4C A;  2OZ2 A;  3OF8 A;  3MHH A;  1ME3 A;  4MZS A;  1YAL A;  2CIO A;  2YJB A;  3O1G A;  4PAD A;  4AXL A;  2NQA A;  3BCN A;  3USV A;  1THE A;  2BDZ A;  3H8C A;  1ITO A;  1S4V A;  3IEJ A;  4BS6 A;  1YK7 A;  2O6X A;  2R9N A;  3QSD A;  3QJ3 A;  1AIM A;  4YYR A;  1FH0 A;  3P5U A;  2R9F A;  1NL6 A;  4QRX A;  3K24 A;  2FRA A;  4K7C A;  2HXZ A;  3C9E A;  4I05 A;  4DMX A;  1YK8 A;  3HHI A;  3HWN A;  1U9X A;  1F2C A;  1AEC A;  3AI8 A;  1AU0 A;  4QRG A;  1CTE A;  2FQ9 A;  2P7U A;  4QH6 A;  1ME4 A;  3E1Z B;  2ACT A;  1EWL A;  2FYE A;  3IHP A;  1MEM A;  3WXE A;  4W5B A;  1F29 A;  4YV8 A;  1AYV A;  2WBF X;  1KHP A;  2AUX A;  2AYO A;  2E02 A;  5EF4 A;  2DCB A;  2DZY A;  2DJG B;  2G8J A;  3KFQ A;  1KFU L;  1AU2 A;  2C0Y A;  4Q8H A;  1CB5 A;  3KSE A;  2HH5 A;  3P5V A;  3N3G A;  2AU1 A;  2AS8 A;  4X6J A;  2VHF A;  5FPW A;  1BP4 A;  1M6D A;  1K3B B;  4KLB A;  1AU4 A;  3B79 A;  4Q8G A;  2FT2 A;  4G54 A;  1NQC A;  4YVA A;  1BQI A;  4FJC A;  1U9V A;  2R9M A;  3GCB A;  1PPP A;  2R9C A;  1A6R A;  4PP1 A;  4AXM A;  2R9O A;  3S3Q A;  2HHN A;  5A24 A;  1F2A A;  4DMY A;  2GFO A;  2XU1 A;  2B1N A;  2VHS A;  3MOR A;  2FUD A;  4RY2 A;  1CVZ A;  2G6D A;  3HD3 A;  3IMA A;  1IWD A;  4N8W A;  2PNS A;  1PE6 A;  2JQF R;  3OIS A;  8PCH A;  1BY8 A;  1U9W A;  4I07 A;  4BS5 A;  2FRQ A;  1SNK A;  3MHS A;  1Y08 A;  1EWM A;  2OP3 A;  4XR7 A;  5EGW A;  2PAD A;  2P0R A;  1F2B A;  1YT7 A;  2DC8 A;  2DC6 A;  2E00 A;  3BOW A;  4PI3 A;  4BPV A;  3V6E A;  3NHE A;  1AYW A; 
#chains in the Genus database with same CATH topology
 2B1M A;  2E03 A;  2R6N A;  4YYS A;  3RVX A;  4BSQ A;  1ATK A;  2AUZ A;  4RNA A;  3ERV A;  4P6E A;  2AIM A;  1PPN A;  3MTV A;  2PRE A;  4OVZ A;  4QRV A;  9PAP A;  1TU6 A;  4D8E A;  2G8E A;  3RNV A;  3I06 A;  1X9Y A;  1PPO A;  4YYW A;  3RVV A;  1DF0 A;  3E9S A;  1O0E A;  1PAD A;  4P16 A;  2JRI A;  1XKG A;  1ZIV A;  1CPJ A;  4ZUX U;  1U9Q X;  2ARY A;  5CVM A;  2BU3 A;  3WXG A;  1CJL A;  5J94 A;  4MM3 B;  5K16 A;  4WUR A;  3CH2 X;  1PBH A;  1QXP A;  3V6C A;  2HD5 A;  2E01 A;  4X6H A;  5CVN B;  3MP2 A;  3C0R A;  4BOQ A;  3P5W A;  1QMY A;  2AYN A;  4FK5 A;  5CHT A;  1U5I A;  4YYU A;  3PNR A;  5JA7 A;  3QT4 A;  3PBH A;  1GMY A;  3LFY A;  3KWZ A;  3RVW A;  3U8E A;  1ZCM A;  3H6S A;  4CZW A;  2YJC A;  3O0U A;  1JQP A;  3KW9 A;  3HHA A;  4HXD B;  2FE8 A;  4N4Z A;  1KXR A;  2DZZ A;  3BY4 A;  2J7Q A;  3B21 A;  3H89 A;  4W4U A;  1GEC E;  1STF E;  5PAD A;  2NQG A;  3CH3 X;  3F5V A;  3I3T A;  1NB3 A;  1CQD A;  2DC9 A;  4FIP A;  3DF0 A;  2XU3 A;  4OEL A;  4W5C A;  4OVZ B;  1BGO A;  2FTD A;  3PDF A;  4P6G A;  1PIP A;  1VJV A;  5JH3 A;  3D6S A;  5E6J A;  3F75 A;  1CSB B;  1NPZ A;  1Y4H A;  4PP2 E;  1KHQ A;  1MIR A;  3PHW A;  2ATO A;  4D8B A;  2GHU A;  2H7J A;  1EWP A;  5F02 A;  2YJ9 A;  4HWY A;  4CDE B;  7PCK A;  4WA6 A;  1AYU A;  1NLJ A;  3CBK A;  6PAD A;  4X6I A;  1MHW A;  5EZS A;  4MZO A;  2F1G A;  1TLO A;  3PW3 A;  4OEM A;  3PRP A;  4GUA A;  1EF7 A;  3H7D A;  3WXF A;  4RF0 A;  1DEU A;  2DCC A;  2DCD A;  4REZ A;  3N3K A;  3IOQ A;  4MSX A;  1CS8 A;  1PXV A;  2PBH A;  1NB5 A;  3W30 A;  1GLO A;  1MEG A;  1ICF A;  3LXS A;  4R3D A;  3BPF A;  3IV2 A;  3MJ5 A;  4I04 A;  3TNX A;  2YJ8 A;  3MTN A;  1HUC B;  3KKU A;  2CB5 A;  2BTW B;  1TL9 A;  2XU5 A;  2IBI A;  3TRK A;  1POP A;  1MDW A;  2OUL A;  2AVW A;  1EWO A;  2G7Y A;  3OVZ A;  3BPM A;  4CDF B;  4CDC B;  3K8U A;  2DCA A;  1QDQ A;  4BOP A;  1KFX L;  3BC3 A;  1QOL A;  2P86 A;  3KX1 A;  1SP4 B;  2Y6E A;  1PCI A;  2NQD B;  3M99 A;  4XUI A;  3BWK A;  3IUT A;  1PPD A;  1VSN A;  3OF9 A;  4OW0 A;  2XU4 A;  4YYV A;  4N79 A;  4BQV A;  2BDL A;  3S3R A;  2DC7 A;  3OQC A;  3TMP A;  4QBB A;  4BOS A;  2BTW A;  4CDD B;  5CVO B;  1AU3 A;  3ZUA A;  3P5X A;  1Q6K A;  3PHU A;  1GCB A;  4YYQ A;  3K9M A;  5CHV A;  4IUM A;  2HWK A;  2FO5 A;  3W31 A;  3OVX A;  2DJF B;  2JQG R;  2IPP B;  3KWB X;  3PHX A;  3PRM A;  1CV8 A;  3H8B A;  2Y5B A;  1MS6 A;  1YVB A;  2NQI A;  5EZQ A;  1DKI A;  3O65 A;  2YJ2 A;  4A5U A;  2F7D A;  3CBJ A;  3N4C A;  2OZ2 A;  3OF8 A;  3MHH A;  1ME3 A;  4MZS A;  1YAL A;  2CIO A;  2YJB A;  3O1G A;  4PAD A;  4AXL A;  1PVJ A;  2NQA A;  3BCN A;  3USV A;  1THE A;  2BDZ A;  4RKX A;  3H8C A;  4XZX A;  1ITO A;  1S4V A;  3IEJ A;  4BS6 A;  1YK7 A;  2O6X A;  2R9N A;  3QSD A;  3QJ3 A;  1AIM A;  4YYR A;  1FH0 A;  3P5U A;  2R9F A;  1NL6 A;  4QRX A;  3K24 A;  2FRA A;  3ZNH A;  4K7C A;  2HXZ A;  3C9E A;  4I05 A;  4DMX A;  1YK8 A;  3HHI A;  3HWN A;  1U9X A;  1F2C A;  1AEC A;  3AI8 A;  1AU0 A;  4QRG A;  1CTE A;  4PT5 A;  2FQ9 A;  2P7U A;  4QH6 A;  1ME4 A;  3E1Z B;  2ACT A;  1EWL A;  2FYE A;  5KO3 A;  3IHP A;  4M0W A;  1MEM A;  3WXE A;  2DOS A;  4BOU A;  4W5B A;  1F29 A;  4YV8 A;  1AYV A;  2WBF X;  1KHP A;  2AUX A;  2AYO A;  2E02 A;  5EF4 A;  2DCB A;  3IFU A;  2DZY A;  3BBA A;  2DJG B;  2G8J A;  4IP3 A;  3PT2 A;  3KFQ A;  1KFU L;  1AU2 A;  2C0Y A;  4Q8H A;  3BB7 A;  1CB5 A;  3KSE A;  2HH5 A;  3P5V A;  3N3G A;  4RF1 A;  2AU1 A;  2AS8 A;  4X6J A;  2VHF A;  5FPW A;  1BP4 A;  2JTC A;  1M6D A;  1K3B B;  4KLB A;  1YZB A;  1AU4 A;  3B79 A;  4Q8G A;  2FT2 A;  4G54 A;  1NQC A;  4YVA A;  1BQI A;  4ZTB A;  4FJC A;  1U9V A;  2R9M A;  3GCB A;  2AGA A;  1PPP A;  2R9C A;  1A6R A;  4PP1 A;  4AXM A;  2J7Q C;  2R9O A;  3S3Q A;  2HHN A;  5A24 A;  4D8I A;  1F2A A;  4DMY A;  2GFO A;  2XU1 A;  1UKF A;  2B1N A;  2VHS A;  3MOR A;  5JZE A;  2UZJ A;  3PSE A;  4BOZ A;  2FUD A;  4RY2 A;  1CVZ A;  2G6D A;  3HD3 A;  3IMA A;  1IWD A;  4N8W A;  2PNS A;  1PE6 A;  2JQF R;  3OIS A;  8PCH A;  1BY8 A;  1U9W A;  4I07 A;  4BS5 A;  2FRQ A;  1SNK A;  3MHS A;  1Y08 A;  1EWM A;  4MI7 A;  2Z84 A;  2OP3 A;  4XR7 A;  5EGW A;  2PAD A;  2P0R A;  1F2B A;  1YT7 A;  2DC8 A;  2DC6 A;  2E00 A;  3BOW A;  4PI3 A;  4BPV A;  3V6E A;  3NHE A;  1AYW A; 
#chains in the Genus database with same CATH homology
 2B1M A;  4B55 A;  2E03 A;  2R6N A;  4YYS A;  3RVX A;  4BSQ A;  1ATK A;  2AUZ A;  3ERV A;  4P6E A;  2AIM A;  1PPN A;  2PRE A;  4QRV A;  9PAP A;  1TU6 A;  2G8E A;  3I06 A;  1X9Y A;  1PPO A;  4YYW A;  3RVV A;  1DF0 A;  2VFC A;  1O0E A;  1PAD A;  1XKG A;  1ZIV A;  1CPJ A;  4ZUX U;  1U9Q X;  2ARY A;  5CVM A;  3WXG A;  1CJL A;  5J94 A;  5K16 A;  3CH2 X;  1PBH A;  1QXP A;  1W6F A;  3V6C A;  2HD5 A;  2E01 A;  4X6H A;  5CVN B;  3P5W A;  1QMY A;  1E2T A;  2AYN A;  4FK5 A;  5CHT A;  1U5I A;  4YYU A;  3PNR A;  5JA7 A;  3QT4 A;  3PBH A;  1GMY A;  3LFY A;  3KWZ A;  3RVW A;  3U8E A;  1ZCM A;  3H6S A;  4CZW A;  2YJC A;  3O0U A;  1JQP A;  3KW9 A;  3HHA A;  4N4Z A;  1KXR A;  2DZZ A;  3H89 A;  4W4U A;  1GEC E;  1STF E;  5PAD A;  2NQG A;  3CH3 X;  3F5V A;  1NB3 A;  3I3T A;  1CQD A;  2DC9 A;  4FIP A;  3DF0 A;  2XU3 A;  4OEL A;  4W5C A;  1BGO A;  2FTD A;  2VFB A;  3PDF A;  4P6G A;  1PIP A;  1VJV A;  5JH3 A;  3D6S A;  3F75 A;  1CSB B;  1NPZ A;  1Y4H A;  4PP2 E;  1KHQ A;  1MIR A;  2ATO A;  2GHU A;  2H7J A;  1EWP A;  5F02 A;  1GX3 A;  1W4T A;  2YJ9 A;  4HWY A;  4CDE B;  7PCK A;  4WA6 A;  1AYU A;  1NLJ A;  3CBK A;  6PAD A;  4X6I A;  1MHW A;  4MZO A;  2F1G A;  1TLO A;  3PW3 A;  4OEM A;  1EF7 A;  3H7D A;  3WXF A;  1DEU A;  2DCC A;  2DCD A;  3N3K A;  3IOQ A;  4MSX A;  1CS8 A;  1PXV A;  2PBH A;  4NV7 A;  1NB5 A;  1GLO A;  1MEG A;  1ICF A;  3LXS A;  3BPF A;  3IV2 A;  4I04 A;  3TNX A;  2YJ8 A;  3MTN A;  1HUC B;  3KKU A;  2CB5 A;  1TL9 A;  2XU5 A;  2IBI A;  1POP A;  1MDW A;  2OUL A;  2AVW A;  1EWO A;  2G7Y A;  3OVZ A;  3BPM A;  4CDF B;  4CDC B;  3K8U A;  2DCA A;  1QDQ A;  1KFX L;  3BC3 A;  1QOL A;  2P86 A;  3KX1 A;  1SP4 B;  2Y6E A;  1PCI A;  2NQD B;  3M99 A;  4XUI A;  3BWK A;  3IUT A;  1PPD A;  1VSN A;  3OF9 A;  2XU4 A;  4YYV A;  4N79 A;  4BQV A;  2BDL A;  3S3R A;  2DC7 A;  4QBB A;  4CDD B;  5CVO B;  1AU3 A;  3ZUA A;  3P5X A;  1Q6K A;  1GCB A;  4YYQ A;  3K9M A;  5CHV A;  1W5R A;  2FO5 A;  4NV8 A;  3OVX A;  2DJF B;  2JQG R;  2IPP B;  3KWB X;  1CV8 A;  2BSZ A;  3H8B A;  2Y5B A;  1MS6 A;  1YVB A;  2NQI A;  2YJ2 A;  2F7D A;  3CBJ A;  3N4C A;  2OZ2 A;  3OF8 A;  3MHH A;  1ME3 A;  4BGF A;  4MZS A;  1YAL A;  2CIO A;  2YJB A;  4C5P A;  3O1G A;  4PAD A;  4AXL A;  2NQA A;  3BCN A;  3USV A;  1THE A;  2BDZ A;  3H8C A;  1ITO A;  1S4V A;  3IEJ A;  4BS6 A;  1YK7 A;  2O6X A;  2R9N A;  3QSD A;  3QJ3 A;  1AIM A;  4YYR A;  1FH0 A;  3P5U A;  2R9F A;  1NL6 A;  4QRX A;  3K24 A;  2FRA A;  4K7C A;  2HXZ A;  4GUZ A;  3C9E A;  4I05 A;  4DMX A;  1YK8 A;  3HHI A;  3HWN A;  1U9X A;  1F2C A;  1AEC A;  3AI8 A;  1AU0 A;  4QRG A;  1CTE A;  2FQ9 A;  2P7U A;  4QH6 A;  1ME4 A;  3E1Z B;  2ACT A;  1EWL A;  2FYE A;  3IHP A;  1MEM A;  3WXE A;  4W5B A;  1F29 A;  4YV8 A;  1AYV A;  2WBF X;  1KHP A;  2AUX A;  2AYO A;  2E02 A;  5EF4 A;  2DCB A;  2DZY A;  2DJG B;  2G8J A;  3KFQ A;  1KFU L;  1AU2 A;  2C0Y A;  4Q8H A;  1CB5 A;  3KSE A;  2HH5 A;  3P5V A;  3N3G A;  2AU1 A;  2AS8 A;  4X6J A;  2VHF A;  5FPW A;  1BP4 A;  1M6D A;  1K3B B;  4KLB A;  1AU4 A;  3B79 A;  4Q8G A;  2FT2 A;  4G54 A;  1NQC A;  4YVA A;  1BQI A;  4FJC A;  3LTW A;  1U9V A;  3D9W A;  2R9M A;  3GCB A;  1PPP A;  2R9C A;  1A6R A;  4PP1 A;  4AXM A;  2R9O A;  3S3Q A;  2HHN A;  5A24 A;  1F2A A;  4DMY A;  2GFO A;  2XU1 A;  2B1N A;  2VHS A;  3MOR A;  2FUD A;  4RY2 A;  1CVZ A;  2G6D A;  3HD3 A;  3IMA A;  1IWD A;  4N8W A;  2PNS A;  1PE6 A;  2JQF R;  3OIS A;  8PCH A;  1BY8 A;  1U9W A;  4I07 A;  4BS5 A;  2FRQ A;  1SNK A;  3MHS A;  1Y08 A;  1EWM A;  2OP3 A;  4XR7 A;  5EGW A;  2PAD A;  2P0R A;  1F2B A;  1YT7 A;  2DC8 A;  2DC6 A;  2E00 A;  3BOW A;  4PI3 A;  4BPV A;  3V6E A;  3NHE A;  1AYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...