2GHUA

Crystal structure of falcipain-2 from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Falcipain-2, a Hemoglobinase from the Malarial Parasite Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords falcipain 2
total genus 67
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ghuA00
2XU5A 1AYWA 2DCAA 2VHSA 3MORA 3HD3A 4Q8HA 2GHUA 2R9FA 4QRXA 4FK5A 1O0EA 1Q6KA 2CB5A 1CQDA 1BY8A 2P0RA 2Y6EA 4W5BA 1CVZA 2G8JA 4KLBA 3P5UA 1S4VA 1U9VA 4W4UA 1Y4HA 4X6IA 2YJBA 2DC8A 1EWPA 5CVNB 2JQGR 2ARYA 4X6HA 3P5VA 3P5WA 4PP2E 3IV2A 1AYUA 4BS6A 1ATKA 3HHAA 3BPMA 3E1ZB 5JA7A 3H89A 4BPVA 2R9MA 1CS8A 3IEJA 1MDWA 1GLOA 1ICFA 3LFYA 1TLOA 5JH3A 2DJGB 2HH5A 3H8CA 3N4CA 3IUTA 3IHPA 2F7DA 1U9XA 2R9OA 1ZIVA 3WXFA 2HHNA 8PCHA 3F75A 3PBHA 1AECA 2DJFB 3V6EA 4CDDB 3KW9A 3K8UA 3OF9A 5CHTA 2AUXA 2PNSA 2H7JA 1CTEA 4BSQA 4BS5A 4YYUA 2FUDA 2OZ2A 4FJCA 2NQAA 3PNRA 1BP4A 3H7DA 1BQIA 2R6NA 4ZUXU 1KXRA 2FTDA 3QT4A 4PADA 1MIRA 1AU0A 1QXPA 1YK7A 2O6XA 1CB5A 3H6SA 2VHFA 1F2BA 4QRVA 4FIPA 2DZZA 1F29A 3KWZA 2FRAA 2B1MA 1VJVA 4G54A 6PADA 1X9YA 2XU1A 3I3TA 1EWMA 2DCCA 1M6DA 3NHEA 4YYVA 1PPOA 1ZCMA 1HUCB 4CDCB 2R9NA 3KWBX 1IWDA 2E02A 3AI8A 2Y5BA 2DC9A 3CH2X 1F2CA 3LXSA 9PAPA 2ATOA 1KFXL 1NLJA 4N79A 3I06A 1AYVA 2OULA 4AXLA 2NQIA 3IMAA 3ZUAA 1K3BB 1TU6A 3S3QA 1NPZA 2HD5A 2OP3A 2DCBA 4I05A 1DEUA 2IPPB 3MHSA 3PDFA 2YJ9A 3OISA 3TNXA 4PI3A 4PP1A 2DZYA 1YALA 2JQFR 3HHIA 1DF0A 2F1GA 4DMXA 1THEA 2FYEA 1CPJA 5CVOB 2AUZA 3O0UA 3OVXA 1JQPA 2G8EA 2NQGA 5FPWA 4YV8A 1MEMA 3WXGA 5J94A 1NQCA 3P5XA 2AVWA 1Y08A 2FO5A 1BGOA 4DMYA 1SNKA 2C0YA 3KX1A 3KFQA 1AU2A 3D6SA 4YYSA 7PCKA 2E01A 2FT2A 4MZOA 2R9CA 1ME3A 2XU4A 3U8EA 5CVMA 2AYOA 1CJLA 4XR7A 4BQVA 3MHHA 1EF7A 1CSBB 4CDFB 1AIMA 2BDLA 2FQ9A 3K9MA 4X6JA 2PREA 3BPFA 3RVWA 1PPDA 4RY2A 2E03A 2B1NA 2YJ8A 1PXVA 1ITOA 2AU1A 2P7UA 4HWYA 4QH6A 3MTNA 1STFE 2ACTA 3H8BA 3KSEA 3ERVA 2G6DA 3BWKA 2AIMA 5EF4A 4WA6A 5CHVA 4YYWA 3RVVA 1PBHA 1QOLA 1GMYA 3QJ3A 2GFOA 3C9EA 4OELA 1U5IA 1F2AA 1A6RA 3RVXA 1KHQA 2BDZA 1EWLA 4P6EA 2DC6A 1PIPA 1MHWA 4P6GA 2E00A 3KKUA 2FRQA 3B79A 4K7CA 3IOQA 4CZWA 3PW3A 4I04A 1XKGA 2IBIA 3CBKA 1YT7A 3O1GA 2YJ2A 1QDQA 3GCBA 5K16A 5A24A 1MS6A 1CV8A 4CDEB 4YYRA 1VSNA 3HWNA 3BCNA 4I07A 3K24A 3DF0A 4N8WA 4W5CA 3QSDA 3USVA 1POPA 1U9QX 2PADA 3WXEA 2AYNA 3M99A 4YYQA 3BOWA 4QBBA 1PCIA 4YVAA 2HXZA 1AU3A 2P86A 1KFUL 3S3RA 1ME4A 4AXMA 4Q8GA 4QRGA 1NL6A 3CH3X 1YVBA 2DCDA 2G7YA 3CBJA 2AS8A 2YJCA 1PPPA 3N3GA 3OF8A 1PE6A 1PADA 5F02A 3OVZA 1MEGA 5PADA 3BC3A 2CIOA 4MSXA 1U9WA 1AU4A 4XUIA 2NQDB 5EGWA 1TL9A 4OEMA 3N3KA 2WBFX 1YK8A 1EWOA 4N4ZA 3F5VA 1GCBA 1KHPA 4MZSA 2PBHA 1QMYA 1NB3A 2XU3A 1FH0A 3V6CA 1GECE 1PPNA 2DC7A 1SP4B 1NB5A
chains in the Genus database with same CATH superfamily
2XU5A 1AYWA 3BY4A 2DCAA 5EZSA 2VHSA 3MORA 3HD3A 4Q8HA 2GHUA 2R9FA 4QRXA 4FK5A 1O0EA 1Q6KA 1DKIA 4OVZB 2CB5A 3TRKA 3W31A 1CQDA 1BY8A 2P0RA 2Y6EA 4W5BA 1CVZA 2G8JA 4M0WA 4KLBA 3P5UA 1S4VA 4ZTBA 1U9VA 4W4UA 1Y4HA 4X6IA 4BOUA 2YJBA 2DC8A 1EWPA 5CVNB 2JQGR 4PT5A 2ARYA 3PRMA 4MI7A 4X6HA 3P5VA 3P5WA 4PP2E 2DOSA 3O65A 3IV2A 1AYUA 4BS6A 1ATKA 3HHAA 1UKFA 3BPMA 3E1ZB 2Z84A 5JA7A 3H89A 4BPVA 2R9MA 4RNAA 1CS8A 3IEJA 1MDWA 1GLOA 1ICFA 3LFYA 1TLOA 5JH3A 2DJGB 2HH5A 2BTWB 3H8CA 3N4CA 3IUTA 3IHPA 2F7DA 1U9XA 2R9OA 4D8BA 1ZIVA 3BBAA 3WXFA 2HHNA 8PCHA 3F75A 3PBHA 1AECA 2DJFB 3V6EA 4CDDB 3KW9A 3K8UA 3OF9A 5CHTA 2AUXA 2PNSA 2H7JA 1CTEA 4BSQA 4BS5A 4OW0A 3MP2A 4YYUA 2FUDA 2OZ2A 4FJCA 2NQAA 3PNRA 1BP4A 3H7DA 4MM3B 3E9SA 1BQIA 2R6NA 4ZUXU 1KXRA 2FTDA 3QT4A 4PADA 5E6JA 1MIRA 1AU0A 3PHWA 1QXPA 1YK7A 2O6XA 1CB5A 3H6SA 2VHFA 4RKXA 1F2BA 4QRVA 4FIPA 2DZZA 3OQCA 1F29A 3KWZA 2FRAA 2B1MA 1VJVA 4G54A 6PADA 1X9YA 2XU1A 3I3TA 1EWMA 2UZJA 2DCCA 1M6DA 4RF0A 3NHEA 4YYVA 1PPOA 1ZCMA 1HUCB 4CDCB 2R9NA 3KWBX 1IWDA 2E02A 3AI8A 4GUAA 2Y5BA 2DC9A 3CH2X 1F2CA 3PRPA 3LXSA 9PAPA 2ATOA 1KFXL 1NLJA 4N79A 3I06A 3PSEA 2HWKA 1AYVA 2OULA 4AXLA 2NQIA 3IMAA 3ZUAA 1K3BB 1TU6A 3S3QA 1NPZA 4XZXA 2HD5A 2OP3A 2DCBA 4I05A 4BOSA 1DEUA 2IPPB 3MHSA 3PDFA 2YJ9A 3OISA 3TNXA 4PI3A 4PP1A 2DZYA 1YALA 3PT2A 2JQFR 3HHIA 1DF0A 2F1GA 4DMXA 1THEA 2FYEA 1CPJA 5CVOB 2AUZA 2BU3A 3O0UA 3OVXA 1JQPA 2G8EA 2NQGA 5FPWA 5JZEA 4YV8A 1MEMA 4BOZA 3WXGA 5J94A 5KO3A 1NQCA 3P5XA 2AVWA 1Y08A 2FO5A 1BGOA 3ZNHA 4DMYA 1SNKA 2C0YA 3KX1A 3KFQA 1AU2A 3D6SA 4YYSA 3C0RA 7PCKA 4P16A 2E01A 2FT2A 4MZOA 2R9CA 1ME3A 2XU4A 3U8EA 5CVMA 3MTVA 1PVJA 2AYOA 1CJLA 4XR7A 4BQVA 3MHHA 1EF7A 1CSBB 4CDFB 1AIMA 2BDLA 2FQ9A 3K9MA 4X6JA 4BOQA 2PREA 3BPFA 3RVWA 1PPDA 4IP3A 4RY2A 2E03A 2B1NA 2YJ8A 1PXVA 1ITOA 2AU1A 2P7UA 4HWYA 4QH6A 3MTNA 1STFE 2ACTA 3H8BA 3KSEA 3ERVA 2G6DA 3BWKA 2AIMA 5EF4A 4WA6A 5CHVA 4YYWA 3RVVA 1PBHA 1QOLA 1GMYA 3PHUA 3QJ3A 2GFOA 4D8EA 2AGAA 2JTCA 3C9EA 2JRIA 4OELA 1U5IA 1F2AA 1A6RA 3RVXA 1KHQA 2BDZA 1EWLA 4P6EA 2DC6A 1PIPA 1MHWA 5EZQA 3PHXA 2E00A 4P6GA 3KKUA 2FRQA 3B79A 1YZBA 2J7QA 4K7CA 3IOQA 3MJ5A 3TMPA 4CZWA 4D8IA 3PW3A 2FE8A 4I04A 1XKGA 2IBIA 2BTWA 3CBKA 1YT7A 3O1GA 2YJ2A 1QDQA 3GCBA 5K16A 3IFUA 4HXDB 5A24A 1MS6A 1CV8A 4CDEB 4WURA 4OVZA 2J7QC 4YYRA 1VSNA 4R3DA 3HWNA 3BCNA 3B21A 4I07A 3RNVA 3K24A 3DF0A 3BB7A 4N8WA 4REZA 4W5CA 3QSDA 3USVA 1POPA 1U9QX 2PADA 3WXEA 2AYNA 3M99A 4YYQA 3BOWA 4QBBA 1PCIA 4YVAA 2HXZA 4A5UA 4RF1A 1AU3A 2P86A 1KFUL 3S3RA 1ME4A 1NB5A 4AXMA 4Q8GA 4QRGA 1NL6A 3CH3X 1YVBA 2DCDA 2G7YA 3CBJA 2AS8A 2YJCA 1PPPA 3N3GA 3OF8A 1PE6A 1PADA 5F02A 3OVZA 1MEGA 5PADA 3BC3A 2CIOA 4MSXA 1U9WA 1AU4A 4XUIA 2NQDB 5EGWA 1TL9A 4OEMA 3N3KA 2WBFX 4IUMA 1YK8A 1EWOA 4BOPA 4N4ZA 3F5VA 1GCBA 1KHPA 4MZSA 2PBHA 1QMYA 1NB3A 2XU3A 1FH0A 3V6CA 1GECE 1PPNA 2DC7A 1SP4B 3W30A
chains in the Genus database with same CATH topology
2XU5A 1AYWA 2DCAA 4B55A 2VHSA 3MORA 3HD3A 4Q8HA 2GHUA 2R9FA 4QRXA 4FK5A 1O0EA 1Q6KA 2CB5A 1CQDA 1BY8A 2P0RA 2Y6EA 4W5BA 1CVZA 2G8JA 4KLBA 3P5UA 1S4VA 1U9VA 4W4UA 1Y4HA 4X6IA 2YJBA 2DC8A 1EWPA 5CVNB 2JQGR 2ARYA 4X6HA 3P5VA 3P5WA 4PP2E 3IV2A 1AYUA 4BS6A 4C5PA 1ATKA 3HHAA 1GX3A 3BPMA 3E1ZB 5JA7A 3H89A 4BPVA 2R9MA 1CS8A 4GUZA 3D9WA 3IEJA 1MDWA 1GLOA 1ICFA 3LFYA 1TLOA 5JH3A 2DJGB 2HH5A 3H8CA 3N4CA 4NV7A 3IUTA 3IHPA 2F7DA 1U9XA 2R9OA 1ZIVA 3WXFA 2HHNA 8PCHA 3F75A 3PBHA 1AECA 2DJFB 3V6EA 4CDDB 3KW9A 3K8UA 3OF9A 5CHTA 2AUXA 2PNSA 2H7JA 1CTEA 4BSQA 4BS5A 4YYUA 1W6FA 2FUDA 2OZ2A 4FJCA 2NQAA 3PNRA 1BP4A 3H7DA 1BQIA 1W4TA 2R6NA 4ZUXU 1KXRA 2FTDA 3QT4A 4PADA 1MIRA 1AU0A 1QXPA 1YK7A 2O6XA 1CB5A 3H6SA 2VHFA 1F2BA 4QRVA 4FIPA 2DZZA 1F29A 3KWZA 2FRAA 2B1MA 1VJVA 4G54A 6PADA 1X9YA 2XU1A 3I3TA 1EWMA 2DCCA 1M6DA 3NHEA 4YYVA 1PPOA 1ZCMA 1HUCB 4CDCB 2R9NA 3KWBX 1IWDA 2E02A 3AI8A 2Y5BA 2DC9A 3CH2X 1F2CA 3LXSA 9PAPA 2ATOA 1KFXL 1NLJA 4N79A 3I06A 1AYVA 2OULA 4AXLA 2NQIA 3IMAA 3ZUAA 1K3BB 1TU6A 3S3QA 1NPZA 2HD5A 2OP3A 2DCBA 2BSZA 4I05A 1DEUA 2IPPB 3MHSA 3PDFA 2YJ9A 3OISA 3TNXA 4PI3A 4PP1A 2DZYA 1YALA 2JQFR 3HHIA 1DF0A 2F1GA 4DMXA 1THEA 2FYEA 1CPJA 5CVOB 2AUZA 3O0UA 3OVXA 1JQPA 2G8EA 2NQGA 5FPWA 4YV8A 1MEMA 3WXGA 5J94A 1NQCA 3P5XA 2AVWA 1Y08A 2FO5A 1BGOA 4DMYA 1SNKA 2C0YA 3KX1A 3KFQA 1AU2A 3D6SA 4YYSA 7PCKA 2E01A 2FT2A 4MZOA 2R9CA 1ME3A 2XU4A 3U8EA 5CVMA 2AYOA 1CJLA 4XR7A 4BQVA 3MHHA 1EF7A 1CSBB 4CDFB 1AIMA 2BDLA 4X6JA 2FQ9A 3K9MA 2PREA 3BPFA 3RVWA 1PPDA 4RY2A 2E03A 2B1NA 2YJ8A 1W5RA 1PXVA 4NV8A 1ITOA 2AU1A 2P7UA 4HWYA 4QH6A 3MTNA 1STFE 2ACTA 3H8BA 3KSEA 3ERVA 2G6DA 3BWKA 2AIMA 5EF4A 4WA6A 5CHVA 4YYWA 3RVVA 1PBHA 1QOLA 1GMYA 3QJ3A 2GFOA 3C9EA 4OELA 1U5IA 1F2AA 1A6RA 3RVXA 1KHQA 2BDZA 1EWLA 4P6EA 2DC6A 1PIPA 1MHWA 4P6GA 2E00A 3KKUA 2FRQA 3B79A 4BGFA 4K7CA 3IOQA 2VFCA 4CZWA 3PW3A 4I04A 1XKGA 2IBIA 3CBKA 1YT7A 3O1GA 2YJ2A 1QDQA 3GCBA 5K16A 1E2TA 5A24A 1MS6A 1CV8A 4CDEB 4YYRA 1VSNA 3HWNA 3BCNA 4I07A 3K24A 3DF0A 4N8WA 4W5CA 3QSDA 3USVA 1POPA 1U9QX 2PADA 3WXEA 2AYNA 3M99A 4YYQA 3BOWA 4QBBA 1PCIA 4YVAA 2HXZA 1AU3A 2P86A 1KFUL 3S3RA 1ME4A 4AXMA 4Q8GA 4QRGA 1NL6A 3CH3X 1YVBA 2DCDA 2G7YA 3CBJA 2AS8A 2YJCA 1PPPA 3N3GA 3OF8A 1PE6A 1PADA 5F02A 3OVZA 1MEGA 5PADA 3LTWA 3BC3A 2CIOA 4MSXA 1U9WA 1AU4A 4XUIA 2NQDB 5EGWA 1TL9A 4OEMA 3N3KA 2WBFX 1YK8A 1EWOA 4N4ZA 3F5VA 1GCBA 1KHPA 4MZSA 2PBHA 1QMYA 1NB3A 2VFBA 2XU3A 1FH0A 3V6CA 1GECE 1PPNA 2DC7A 1SP4B 1NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU5 A;  1AYW A;  2DCA A;  2VHS A;  3MOR A;  3HD3 A;  4Q8H A;  2GHU A;  2R9F A;  4QRX A;  4FK5 A;  1O0E A;  1Q6K A;  2CB5 A;  1CQD A;  1BY8 A;  2P0R A;  2Y6E A;  4W5B A;  1CVZ A;  2G8J A;  4KLB A;  3P5U A;  1S4V A;  1U9V A;  4W4U A;  1Y4H A;  4X6I A;  2YJB A;  2DC8 A;  1EWP A;  5CVN B;  2JQG R;  2ARY A;  4X6H A;  3P5V A;  3P5W A;  4PP2 E;  3IV2 A;  1AYU A;  4BS6 A;  1ATK A;  3HHA A;  3BPM A;  3E1Z B;  5JA7 A;  3H89 A;  4BPV A;  2R9M A;  1CS8 A;  3IEJ A;  1MDW A;  1GLO A;  1ICF A;  3LFY A;  1TLO A;  5JH3 A;  2DJG B;  2HH5 A;  3H8C A;  3N4C A;  3IUT A;  3IHP A;  2F7D A;  1U9X A;  2R9O A;  1ZIV A;  3WXF A;  2HHN A;  8PCH A;  3F75 A;  3PBH A;  1AEC A;  2DJF B;  3V6E A;  4CDD B;  3KW9 A;  3K8U A;  3OF9 A;  5CHT A;  2AUX A;  2PNS A;  2H7J A;  1CTE A;  4BSQ A;  4BS5 A;  4YYU A;  2FUD A;  2OZ2 A;  4FJC A;  2NQA A;  3PNR A;  1BP4 A;  3H7D A;  1BQI A;  2R6N A;  4ZUX U;  1KXR A;  2FTD A;  3QT4 A;  4PAD A;  1MIR A;  1AU0 A;  1QXP A;  1YK7 A;  2O6X A;  1CB5 A;  3H6S A;  2VHF A;  1F2B A;  4QRV A;  4FIP A;  2DZZ A;  1F29 A;  3KWZ A;  2FRA A;  2B1M A;  1VJV A;  4G54 A;  6PAD A;  1X9Y A;  2XU1 A;  3I3T A;  1EWM A;  2DCC A;  1M6D A;  3NHE A;  4YYV A;  1PPO A;  1ZCM A;  1HUC B;  4CDC B;  2R9N A;  3KWB X;  1IWD A;  2E02 A;  3AI8 A;  2Y5B A;  2DC9 A;  3CH2 X;  1F2C A;  3LXS A;  9PAP A;  2ATO A;  1KFX L;  1NLJ A;  4N79 A;  3I06 A;  1AYV A;  2OUL A;  4AXL A;  2NQI A;  3IMA A;  3ZUA A;  1K3B B;  1TU6 A;  3S3Q A;  1NPZ A;  2HD5 A;  2OP3 A;  2DCB A;  4I05 A;  1DEU A;  2IPP B;  3MHS A;  3PDF A;  2YJ9 A;  3OIS A;  3TNX A;  4PI3 A;  4PP1 A;  2DZY A;  1YAL A;  2JQF R;  3HHI A;  1DF0 A;  2F1G A;  4DMX A;  1THE A;  2FYE A;  1CPJ A;  5CVO B;  2AUZ A;  3O0U A;  3OVX A;  1JQP A;  2G8E A;  2NQG A;  5FPW A;  4YV8 A;  1MEM A;  3WXG A;  5J94 A;  1NQC A;  3P5X A;  2AVW A;  1Y08 A;  2FO5 A;  1BGO A;  4DMY A;  1SNK A;  2C0Y A;  3KX1 A;  3KFQ A;  1AU2 A;  3D6S A;  4YYS A;  7PCK A;  2E01 A;  2FT2 A;  4MZO A;  2R9C A;  1ME3 A;  2XU4 A;  3U8E A;  5CVM A;  2AYO A;  1CJL A;  4XR7 A;  4BQV A;  3MHH A;  1EF7 A;  1CSB B;  4CDF B;  1AIM A;  2BDL A;  2FQ9 A;  3K9M A;  4X6J A;  2PRE A;  3BPF A;  3RVW A;  1PPD A;  4RY2 A;  2E03 A;  2B1N A;  2YJ8 A;  1PXV A;  1ITO A;  2AU1 A;  2P7U A;  4HWY A;  4QH6 A;  3MTN A;  1STF E;  2ACT A;  3H8B A;  3KSE A;  3ERV A;  2G6D A;  3BWK A;  2AIM A;  5EF4 A;  4WA6 A;  5CHV A;  4YYW A;  3RVV A;  1PBH A;  1QOL A;  1GMY A;  3QJ3 A;  2GFO A;  3C9E A;  4OEL A;  1U5I A;  1F2A A;  1A6R A;  3RVX A;  1KHQ A;  2BDZ A;  1EWL A;  4P6E A;  2DC6 A;  1PIP A;  1MHW A;  4P6G A;  2E00 A;  3KKU A;  2FRQ A;  3B79 A;  4K7C A;  3IOQ A;  4CZW A;  3PW3 A;  4I04 A;  1XKG A;  2IBI A;  3CBK A;  1YT7 A;  3O1G A;  2YJ2 A;  1QDQ A;  3GCB A;  5K16 A;  5A24 A;  1MS6 A;  1CV8 A;  4CDE B;  4YYR A;  1VSN A;  3HWN A;  3BCN A;  4I07 A;  3K24 A;  3DF0 A;  4N8W A;  4W5C A;  3QSD A;  3USV A;  1POP A;  1U9Q X;  2PAD A;  3WXE A;  2AYN A;  3M99 A;  4YYQ A;  3BOW A;  4QBB A;  1PCI A;  4YVA A;  2HXZ A;  1AU3 A;  2P86 A;  1KFU L;  3S3R A;  1ME4 A;  4AXM A;  4Q8G A;  4QRG A;  1NL6 A;  3CH3 X;  1YVB A;  2DCD A;  2G7Y A;  3CBJ A;  2AS8 A;  2YJC A;  1PPP A;  3N3G A;  3OF8 A;  1PE6 A;  1PAD A;  5F02 A;  3OVZ A;  1MEG A;  5PAD A;  3BC3 A;  2CIO A;  4MSX A;  1U9W A;  1AU4 A;  4XUI A;  2NQD B;  5EGW A;  1TL9 A;  4OEM A;  3N3K A;  2WBF X;  1YK8 A;  1EWO A;  4N4Z A;  3F5V A;  1GCB A;  1KHP A;  4MZS A;  2PBH A;  1QMY A;  1NB3 A;  2XU3 A;  1FH0 A;  3V6C A;  1GEC E;  1PPN A;  2DC7 A;  1SP4 B;  1NB5 A; 
#chains in the Genus database with same CATH topology
 2XU5 A;  1AYW A;  3BY4 A;  2DCA A;  5EZS A;  2VHS A;  3MOR A;  3HD3 A;  4Q8H A;  2GHU A;  2R9F A;  4QRX A;  4FK5 A;  1O0E A;  1Q6K A;  1DKI A;  4OVZ B;  2CB5 A;  3TRK A;  3W31 A;  1CQD A;  1BY8 A;  2P0R A;  2Y6E A;  4W5B A;  1CVZ A;  2G8J A;  4M0W A;  4KLB A;  3P5U A;  1S4V A;  4ZTB A;  1U9V A;  4W4U A;  1Y4H A;  4X6I A;  4BOU A;  2YJB A;  2DC8 A;  1EWP A;  5CVN B;  2JQG R;  4PT5 A;  2ARY A;  3PRM A;  4MI7 A;  4X6H A;  3P5V A;  3P5W A;  4PP2 E;  2DOS A;  3O65 A;  3IV2 A;  1AYU A;  4BS6 A;  1ATK A;  3HHA A;  1UKF A;  3BPM A;  3E1Z B;  2Z84 A;  5JA7 A;  3H89 A;  4BPV A;  2R9M A;  4RNA A;  1CS8 A;  3IEJ A;  1MDW A;  1GLO A;  1ICF A;  3LFY A;  1TLO A;  5JH3 A;  2DJG B;  2HH5 A;  2BTW B;  3H8C A;  3N4C A;  3IUT A;  3IHP A;  2F7D A;  1U9X A;  2R9O A;  4D8B A;  1ZIV A;  3BBA A;  3WXF A;  2HHN A;  8PCH A;  3F75 A;  3PBH A;  1AEC A;  2DJF B;  3V6E A;  4CDD B;  3KW9 A;  3K8U A;  3OF9 A;  5CHT A;  2AUX A;  2PNS A;  2H7J A;  1CTE A;  4BSQ A;  4BS5 A;  4OW0 A;  3MP2 A;  4YYU A;  2FUD A;  2OZ2 A;  4FJC A;  2NQA A;  3PNR A;  1BP4 A;  3H7D A;  4MM3 B;  3E9S A;  1BQI A;  2R6N A;  4ZUX U;  1KXR A;  2FTD A;  3QT4 A;  4PAD A;  5E6J A;  1MIR A;  1AU0 A;  3PHW A;  1QXP A;  1YK7 A;  2O6X A;  1CB5 A;  3H6S A;  2VHF A;  4RKX A;  1F2B A;  4QRV A;  4FIP A;  2DZZ A;  3OQC A;  1F29 A;  3KWZ A;  2FRA A;  2B1M A;  1VJV A;  4G54 A;  6PAD A;  1X9Y A;  2XU1 A;  3I3T A;  1EWM A;  2UZJ A;  2DCC A;  1M6D A;  4RF0 A;  3NHE A;  4YYV A;  1PPO A;  1ZCM A;  1HUC B;  4CDC B;  2R9N A;  3KWB X;  1IWD A;  2E02 A;  3AI8 A;  4GUA A;  2Y5B A;  2DC9 A;  3CH2 X;  1F2C A;  3PRP A;  3LXS A;  9PAP A;  2ATO A;  1KFX L;  1NLJ A;  4N79 A;  3I06 A;  3PSE A;  2HWK A;  1AYV A;  2OUL A;  4AXL A;  2NQI A;  3IMA A;  3ZUA A;  1K3B B;  1TU6 A;  3S3Q A;  1NPZ A;  4XZX A;  2HD5 A;  2OP3 A;  2DCB A;  4I05 A;  4BOS A;  1DEU A;  2IPP B;  3MHS A;  3PDF A;  2YJ9 A;  3OIS A;  3TNX A;  4PI3 A;  4PP1 A;  2DZY A;  1YAL A;  3PT2 A;  2JQF R;  3HHI A;  1DF0 A;  2F1G A;  4DMX A;  1THE A;  2FYE A;  1CPJ A;  5CVO B;  2AUZ A;  2BU3 A;  3O0U A;  3OVX A;  1JQP A;  2G8E A;  2NQG A;  5FPW A;  5JZE A;  4YV8 A;  1MEM A;  4BOZ A;  3WXG A;  5J94 A;  5KO3 A;  1NQC A;  3P5X A;  2AVW A;  1Y08 A;  2FO5 A;  1BGO A;  3ZNH A;  4DMY A;  1SNK A;  2C0Y A;  3KX1 A;  3KFQ A;  1AU2 A;  3D6S A;  4YYS A;  3C0R A;  7PCK A;  4P16 A;  2E01 A;  2FT2 A;  4MZO A;  2R9C A;  1ME3 A;  2XU4 A;  3U8E A;  5CVM A;  3MTV A;  1PVJ A;  2AYO A;  1CJL A;  4XR7 A;  4BQV A;  3MHH A;  1EF7 A;  1CSB B;  4CDF B;  1AIM A;  2BDL A;  2FQ9 A;  3K9M A;  4X6J A;  4BOQ A;  2PRE A;  3BPF A;  3RVW A;  1PPD A;  4IP3 A;  4RY2 A;  2E03 A;  2B1N A;  2YJ8 A;  1PXV A;  1ITO A;  2AU1 A;  2P7U A;  4HWY A;  4QH6 A;  3MTN A;  1STF E;  2ACT A;  3H8B A;  3KSE A;  3ERV A;  2G6D A;  3BWK A;  2AIM A;  5EF4 A;  4WA6 A;  5CHV A;  4YYW A;  3RVV A;  1PBH A;  1QOL A;  1GMY A;  3PHU A;  3QJ3 A;  2GFO A;  4D8E A;  2AGA A;  2JTC A;  3C9E A;  2JRI A;  4OEL A;  1U5I A;  1F2A A;  1A6R A;  3RVX A;  1KHQ A;  2BDZ A;  1EWL A;  4P6E A;  2DC6 A;  1PIP A;  1MHW A;  5EZQ A;  3PHX A;  2E00 A;  4P6G A;  3KKU A;  2FRQ A;  3B79 A;  1YZB A;  2J7Q A;  4K7C A;  3IOQ A;  3MJ5 A;  3TMP A;  4CZW A;  4D8I A;  3PW3 A;  2FE8 A;  4I04 A;  1XKG A;  2IBI A;  2BTW A;  3CBK A;  1YT7 A;  3O1G A;  2YJ2 A;  1QDQ A;  3GCB A;  5K16 A;  3IFU A;  4HXD B;  5A24 A;  1MS6 A;  1CV8 A;  4CDE B;  4WUR A;  4OVZ A;  2J7Q C;  4YYR A;  1VSN A;  4R3D A;  3HWN A;  3BCN A;  3B21 A;  4I07 A;  3RNV A;  3K24 A;  3DF0 A;  3BB7 A;  4N8W A;  4REZ A;  4W5C A;  3QSD A;  3USV A;  1POP A;  1U9Q X;  2PAD A;  3WXE A;  2AYN A;  3M99 A;  4YYQ A;  3BOW A;  4QBB A;  1PCI A;  4YVA A;  2HXZ A;  4A5U A;  4RF1 A;  1AU3 A;  2P86 A;  1KFU L;  3S3R A;  1ME4 A;  1NB5 A;  4AXM A;  4Q8G A;  4QRG A;  1NL6 A;  3CH3 X;  1YVB A;  2DCD A;  2G7Y A;  3CBJ A;  2AS8 A;  2YJC A;  1PPP A;  3N3G A;  3OF8 A;  1PE6 A;  1PAD A;  5F02 A;  3OVZ A;  1MEG A;  5PAD A;  3BC3 A;  2CIO A;  4MSX A;  1U9W A;  1AU4 A;  4XUI A;  2NQD B;  5EGW A;  1TL9 A;  4OEM A;  3N3K A;  2WBF X;  4IUM A;  1YK8 A;  1EWO A;  4BOP A;  4N4Z A;  3F5V A;  1GCB A;  1KHP A;  4MZS A;  2PBH A;  1QMY A;  1NB3 A;  2XU3 A;  1FH0 A;  3V6C A;  1GEC E;  1PPN A;  2DC7 A;  1SP4 B;  3W30 A; 
#chains in the Genus database with same CATH homology
 2XU5 A;  1AYW A;  2DCA A;  4B55 A;  2VHS A;  3MOR A;  3HD3 A;  4Q8H A;  2GHU A;  2R9F A;  4QRX A;  4FK5 A;  1O0E A;  1Q6K A;  2CB5 A;  1CQD A;  1BY8 A;  2P0R A;  2Y6E A;  4W5B A;  1CVZ A;  2G8J A;  4KLB A;  3P5U A;  1S4V A;  1U9V A;  4W4U A;  1Y4H A;  4X6I A;  2YJB A;  2DC8 A;  1EWP A;  5CVN B;  2JQG R;  2ARY A;  4X6H A;  3P5V A;  3P5W A;  4PP2 E;  3IV2 A;  1AYU A;  4BS6 A;  4C5P A;  1ATK A;  3HHA A;  1GX3 A;  3BPM A;  3E1Z B;  5JA7 A;  3H89 A;  4BPV A;  2R9M A;  1CS8 A;  4GUZ A;  3D9W A;  3IEJ A;  1MDW A;  1GLO A;  1ICF A;  3LFY A;  1TLO A;  5JH3 A;  2DJG B;  2HH5 A;  3H8C A;  3N4C A;  4NV7 A;  3IUT A;  3IHP A;  2F7D A;  1U9X A;  2R9O A;  1ZIV A;  3WXF A;  2HHN A;  8PCH A;  3F75 A;  3PBH A;  1AEC A;  2DJF B;  3V6E A;  4CDD B;  3KW9 A;  3K8U A;  3OF9 A;  5CHT A;  2AUX A;  2PNS A;  2H7J A;  1CTE A;  4BSQ A;  4BS5 A;  4YYU A;  1W6F A;  2FUD A;  2OZ2 A;  4FJC A;  2NQA A;  3PNR A;  1BP4 A;  3H7D A;  1BQI A;  1W4T A;  2R6N A;  4ZUX U;  1KXR A;  2FTD A;  3QT4 A;  4PAD A;  1MIR A;  1AU0 A;  1QXP A;  1YK7 A;  2O6X A;  1CB5 A;  3H6S A;  2VHF A;  1F2B A;  4QRV A;  4FIP A;  2DZZ A;  1F29 A;  3KWZ A;  2FRA A;  2B1M A;  1VJV A;  4G54 A;  6PAD A;  1X9Y A;  2XU1 A;  3I3T A;  1EWM A;  2DCC A;  1M6D A;  3NHE A;  4YYV A;  1PPO A;  1ZCM A;  1HUC B;  4CDC B;  2R9N A;  3KWB X;  1IWD A;  2E02 A;  3AI8 A;  2Y5B A;  2DC9 A;  3CH2 X;  1F2C A;  3LXS A;  9PAP A;  2ATO A;  1KFX L;  1NLJ A;  4N79 A;  3I06 A;  1AYV A;  2OUL A;  4AXL A;  2NQI A;  3IMA A;  3ZUA A;  1K3B B;  1TU6 A;  3S3Q A;  1NPZ A;  2HD5 A;  2OP3 A;  2DCB A;  2BSZ A;  4I05 A;  1DEU A;  2IPP B;  3MHS A;  3PDF A;  2YJ9 A;  3OIS A;  3TNX A;  4PI3 A;  4PP1 A;  2DZY A;  1YAL A;  2JQF R;  3HHI A;  1DF0 A;  2F1G A;  4DMX A;  1THE A;  2FYE A;  1CPJ A;  5CVO B;  2AUZ A;  3O0U A;  3OVX A;  1JQP A;  2G8E A;  2NQG A;  5FPW A;  4YV8 A;  1MEM A;  3WXG A;  5J94 A;  1NQC A;  3P5X A;  2AVW A;  1Y08 A;  2FO5 A;  1BGO A;  4DMY A;  1SNK A;  2C0Y A;  3KX1 A;  3KFQ A;  1AU2 A;  3D6S A;  4YYS A;  7PCK A;  2E01 A;  2FT2 A;  4MZO A;  2R9C A;  1ME3 A;  2XU4 A;  3U8E A;  5CVM A;  2AYO A;  1CJL A;  4XR7 A;  4BQV A;  3MHH A;  1EF7 A;  1CSB B;  4CDF B;  1AIM A;  2BDL A;  4X6J A;  2FQ9 A;  3K9M A;  2PRE A;  3BPF A;  3RVW A;  1PPD A;  4RY2 A;  2E03 A;  2B1N A;  2YJ8 A;  1W5R A;  1PXV A;  4NV8 A;  1ITO A;  2AU1 A;  2P7U A;  4HWY A;  4QH6 A;  3MTN A;  1STF E;  2ACT A;  3H8B A;  3KSE A;  3ERV A;  2G6D A;  3BWK A;  2AIM A;  5EF4 A;  4WA6 A;  5CHV A;  4YYW A;  3RVV A;  1PBH A;  1QOL A;  1GMY A;  3QJ3 A;  2GFO A;  3C9E A;  4OEL A;  1U5I A;  1F2A A;  1A6R A;  3RVX A;  1KHQ A;  2BDZ A;  1EWL A;  4P6E A;  2DC6 A;  1PIP A;  1MHW A;  4P6G A;  2E00 A;  3KKU A;  2FRQ A;  3B79 A;  4BGF A;  4K7C A;  3IOQ A;  2VFC A;  4CZW A;  3PW3 A;  4I04 A;  1XKG A;  2IBI A;  3CBK A;  1YT7 A;  3O1G A;  2YJ2 A;  1QDQ A;  3GCB A;  5K16 A;  1E2T A;  5A24 A;  1MS6 A;  1CV8 A;  4CDE B;  4YYR A;  1VSN A;  3HWN A;  3BCN A;  4I07 A;  3K24 A;  3DF0 A;  4N8W A;  4W5C A;  3QSD A;  3USV A;  1POP A;  1U9Q X;  2PAD A;  3WXE A;  2AYN A;  3M99 A;  4YYQ A;  3BOW A;  4QBB A;  1PCI A;  4YVA A;  2HXZ A;  1AU3 A;  2P86 A;  1KFU L;  3S3R A;  1ME4 A;  4AXM A;  4Q8G A;  4QRG A;  1NL6 A;  3CH3 X;  1YVB A;  2DCD A;  2G7Y A;  3CBJ A;  2AS8 A;  2YJC A;  1PPP A;  3N3G A;  3OF8 A;  1PE6 A;  1PAD A;  5F02 A;  3OVZ A;  1MEG A;  5PAD A;  3LTW A;  3BC3 A;  2CIO A;  4MSX A;  1U9W A;  1AU4 A;  4XUI A;  2NQD B;  5EGW A;  1TL9 A;  4OEM A;  3N3K A;  2WBF X;  1YK8 A;  1EWO A;  4N4Z A;  3F5V A;  1GCB A;  1KHP A;  4MZS A;  2PBH A;  1QMY A;  1NB3 A;  2VFB A;  2XU3 A;  1FH0 A;  3V6C A;  1GEC E;  1PPN A;  2DC7 A;  1SP4 B;  1NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...