2GHUA

Crystal structure of falcipain-2 from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
publication title Structural and Functional Characterization of Falcipain-2, a Hemoglobinase from the Malarial Parasite Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 67
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ghuA00
1NB5A 4CZWA 3MORA 3N3GA 4HWYA 2E03A 2GHUA 1IWDA 1PPDA 3H7DA 3RVWA 4BQVA 1VJVA 2PNSA 1ITOA 1CB5A 2OULA 4CDFB 4QRGA 1ME3A 1YK8A 2NQGA 3KWZA 3WXFA 3IEJA 1AIMA 2NQAA 2PREA 3IOQA 4PP1A 4QH6A 2H7JA 4BS5A 1U5IA 2P7UA 1F2BA 1TU6A 1Y08A 3PW3A 1X9YA 2B1NA 4MSXA 4YYQA 3USVA 2XU1A 1NL6A 2YJCA 3OF9A 2FUDA 5EF4A 1CV8A 1CS8A 4PI3A 3IUTA 2E02A 4Q8HA 1SP4B 4YYRA 2WBFX 1ZCMA 3P5XA 3MHSA 1MS6A 1BGOA 1THEA 4PP2E 2DC9A 3KWBX 3KFQA 1STFE 3I3TA 2R6NA 2FQ9A 9PAPA 3P5VA 1GLOA 2JQFR 2G8JA 1K3BB 1U9VA 4MZOA 2Y6EA 3S3QA 1DF0A 3N4CA 1BQIA 2AIMA 2YJ2A 4OELA 3O1GA 2BDLA 1CPJA 2Y5BA 1S4VA 2NQDB 3DF0A 1CVZA 3CH3X 3KSEA 4QBBA 3AI8A 3KW9A 4X6HA 3PNRA 3O0UA 2G7YA 2VHSA 3PDFA 4YVAA 4XR7A 1EWPA 2DZZA 5JA7A 4X6JA 2AUXA 5CHTA 5CVNB 2E01A 1PXVA 3CH2X 3H8BA 4OEMA 2R9FA 2AYOA 2IBIA 1KFXL 2YJ8A 1PBHA 1PE6A 2DC6A 3BPFA 1AYVA 1YALA 3F75A 1U9WA 4I05A 1POPA 2DCAA 1DEUA 3HHAA 4P6EA 1VSNA 3ZUAA 4WA6A 1CSBB 3OVXA 2ATOA 2FTDA 2YJBA 4ZUXU 2F7DA 2FYEA 1QXPA 4P6GA 3IV2A 1A6RA 2HH5A 2G8EA 4N79A 1KFUL 4FJCA 4QRXA 1ME4A 2DCCA 3PBHA 1CJLA 2P0RA 3H8CA 4BSQA 4RY2A 3BPMA 3V6CA 4X6IA 3HWNA 4KLBA 2AU1A 1BY8A 2DCDA 1BP4A 1CQDA 1XKGA 1MEMA 5CVOB 3RVVA 3BC3A 1QDQA 4AXLA 2XU4A 2ARYA 2NQIA 3E1ZB 2CIOA 1ATKA 3QJ3A 7PCKA 1YT7A 2F1GA 1EWMA 4BPVA 1GMYA 3IMAA 1KXRA 3KX1A 4CDCB 3GCBA 1CTEA 1O0EA 1AU4A 5EGWA 2AYNA 2HXZA 3K9MA 2E00A 3V6EA 8PCHA 3HD3A 3I06A 1HUCB 2OP3A 1MDWA 2C0YA 2OZ2A 2YJ9A 2GFOA 2XU5A 4YYWA 1NLJA 5FPWA 4AXMA 3BWKA 6PADA 1PCIA 2R9OA 1PADA 1NB3A 2DJGB 3U8EA 2PADA 2FO5A 3QSDA 4CDEB 3MTNA 1JQPA 2AS8A 2JQGR 3H6SA 2R9NA 4XUIA 1KHQA 1EWLA 1GCBA 1KHPA 2G6DA 2DCBA 1YVBA 1NPZA 1TL9A 3CBKA 3B79A 3LXSA 1ICFA 3NHEA 1PPNA 2VHFA 3OVZA 2FRQA 4W4UA 1NQCA 1QMYA 4BS6A 2DJFB 1YK7A 3N3KA 1PPPA 1SNKA 2B1MA 3BOWA 4I07A 4DMXA 5J94A 4MZSA 4Q8GA 1ZIVA 3F5VA 3OF8A 4DMYA 2CB5A 4N8WA 1AYUA 1EF7A 1GECE 1PPOA 3OISA 2FT2A 1U9QX 5K16A 5F02A 2ACTA 1EWOA 3K24A 5JH3A 4W5BA 2HD5A 4I04A 3C9EA 3MHHA 3S3RA 3TNXA 1PIPA 1U9XA 3K8UA 2PBHA 2DC7A 4FIPA 1AU2A 3LFYA 2FRAA 3H89A 1AU0A 1MHWA 2DC8A 3P5WA 2AUZA 1F29A 3CBJA 3HHIA 1Q6KA 1M6DA 5PADA 1AECA 1AU3A 2R9MA 2XU3A 4CDDB 2BDZA 2AVWA 2DZYA 3RVXA 1FH0A 3IHPA 3P5UA 3M99A 4YYVA 4FK5A 3WXGA 1Y4HA 4K7CA 4G54A 5A24A 3BCNA 4YYUA 4N4ZA 4QRVA 3KKUA 4YYSA 2R9CA 4PADA 2IPPB 4W5CA 1AYWA 5CVMA 3D6SA 2HHNA 1F2AA 1QOLA 2P86A 3ERVA 1MEGA 3WXEA 1MIRA 2O6XA 5CHVA 4YV8A 3QT4A 1F2CA 1TLOA
chains in the Genus database with same CATH superfamily
1NB5A 4CZWA 3MORA 3N3GA 4HWYA 4RKXA 2E03A 4WURA 2GHUA 1IWDA 1PPDA 3H7DA 3RVWA 4BQVA 1VJVA 2BTWA 2PNSA 1ITOA 3C0RA 1CB5A 2OULA 4CDFB 4D8IA 4IUMA 4QRGA 1ME3A 1YK8A 2NQGA 2BTWB 1PVJA 3KWZA 4BOQA 3WXFA 3IEJA 1AIMA 2NQAA 2PREA 4M0WA 4BOZA 3IOQA 4PP1A 4QH6A 2H7JA 4BS5A 1U5IA 2P7UA 3O65A 1F2BA 1TU6A 1Y08A 3PW3A 1X9YA 2B1NA 4MSXA 4YYQA 3USVA 2XU1A 1NL6A 2YJCA 3OF9A 2FUDA 5EF4A 1CV8A 1CS8A 4PI3A 2J7QA 3IUTA 2E02A 4Q8HA 3PSEA 1SP4B 3PT2A 4YYRA 2WBFX 1ZCMA 3P5XA 4GUAA 3MHSA 4MM3B 1MS6A 1BGOA 1THEA 4PP2E 2DC9A 3KWBX 3KFQA 5EZQA 1STFE 3I3TA 2R6NA 2FQ9A 9PAPA 3P5VA 1GLOA 2JQFR 2G8JA 1K3BB 1U9VA 2FE8A 4MZOA 2Y6EA 3S3QA 1DF0A 3N4CA 1BQIA 2AIMA 2YJ2A 3PHWA 4OELA 4RNAA 3O1GA 2BDLA 1CPJA 2Y5BA 3MTVA 1S4VA 2NQDB 3DF0A 1CVZA 3CH3X 3KSEA 4QBBA 3AI8A 3KW9A 4X6HA 3PNRA 3RNVA 3O0UA 2G7YA 2VHSA 3PDFA 4YVAA 4XR7A 1EWPA 3ZNHA 2DZZA 2J7QC 5JA7A 4X6JA 2AUXA 5CHTA 5CVNB 2BU3A 2E01A 1PXVA 3CH2X 3H8BA 4OEMA 2R9FA 2AYOA 2IBIA 1KFXL 2YJ8A 1PBHA 1PE6A 2DC6A 3BPFA 1AYVA 1YALA 3F75A 1U9WA 4I05A 1POPA 2DCAA 1DEUA 3OQCA 3HHAA 3PRMA 4P6EA 1VSNA 3ZUAA 4WA6A 1CSBB 3OVXA 2ATOA 4IP3A 2FTDA 2YJBA 4ZUXU 2F7DA 4R3DA 2FYEA 1QXPA 4P6GA 3IV2A 3PRPA 3BB7A 1A6RA 2HH5A 2G8EA 3BBAA 3BY4A 4N79A 1KFUL 4FJCA 4QRXA 4OVZB 1ME4A 2DCCA 3PBHA 1CJLA 2P0RA 3H8CA 5EZSA 3B21A 4BSQA 4RY2A 3BPMA 3V6CA 4X6IA 3HWNA 4KLBA 2AU1A 1BY8A 2DCDA 1BP4A 2Z84A 3W31A 5JZEA 1CQDA 1XKGA 1MEMA 5CVOB 5KO3A 3RVVA 3BC3A 1QDQA 4AXLA 4BOPA 2XU4A 4HXDB 2ARYA 2NQIA 3E1ZB 2CIOA 1ATKA 3QJ3A 7PCKA 4XZXA 1YT7A 2F1GA 1EWMA 4BPVA 1GMYA 3W30A 3IMAA 4ZTBA 1KXRA 3KX1A 4CDCB 2DOSA 2UZJA 3GCBA 1CTEA 1O0EA 1AU4A 5EGWA 2AYNA 2HXZA 3K9MA 2E00A 3V6EA 8PCHA 3HD3A 3I06A 1HUCB 2OP3A 1MDWA 2C0YA 2OZ2A 2YJ9A 2GFOA 4D8BA 2XU5A 4YYWA 1NLJA 5FPWA 4P16A 4AXMA 3BWKA 6PADA 1PCIA 2R9OA 1PADA 1NB3A 2DJGB 3U8EA 3TMPA 4A5UA 2PADA 2FO5A 3QSDA 4CDEB 3MTNA 4MI7A 1JQPA 3TRKA 2AS8A 2JQGR 3H6SA 2R9NA 4XUIA 1KHQA 1EWLA 1GCBA 1KHPA 2G6DA 2AGAA 2DCBA 1YVBA 1NPZA 1TL9A 3CBKA 4OVZA 3B79A 3LXSA 1ICFA 3NHEA 1PPNA 2VHFA 3OVZA 2FRQA 4W4UA 5E6JA 1NQCA 1QMYA 4BS6A 2DJFB 1YK7A 3N3KA 1PPPA 1SNKA 2B1MA 4RF1A 3BOWA 4I07A 4DMXA 5J94A 4MZSA 4Q8GA 1ZIVA 3F5VA 3OF8A 4DMYA 2CB5A 4N8WA 1AYUA 1EF7A 1GECE 1PPOA 3OISA 2FT2A 1U9QX 4RF0A 5K16A 4BOUA 5F02A 2ACTA 1EWOA 3K24A 3E9SA 5JH3A 4W5BA 2HD5A 4I04A 3C9EA 3MHHA 3S3RA 4REZA 3TNXA 4OW0A 1PIPA 1U9XA 3K8UA 3PHXA 3IFUA 2PBHA 2DC7A 2JRIA 4FIPA 1AU2A 3LFYA 2FRAA 1UKFA 3H89A 1AU0A 3MP2A 1MHWA 2DC8A 2HWKA 3P5WA 2AUZA 1F29A 3CBJA 3HHIA 1Q6KA 1M6DA 5PADA 1AECA 1AU3A 2R9MA 2XU3A 4CDDB 2BDZA 2AVWA 2DZYA 3RVXA 1FH0A 3IHPA 3P5UA 1YZBA 3M99A 4BOSA 4D8EA 4YYVA 4FK5A 3WXGA 1Y4HA 4K7CA 4G54A 5A24A 3BCNA 4YYUA 4N4ZA 3MJ5A 4QRVA 3KKUA 4YYSA 2R9CA 4PADA 2IPPB 4W5CA 1AYWA 5CVMA 1DKIA 3PHUA 3D6SA 2HHNA 1F2AA 1QOLA 2P86A 3ERVA 1MEGA 2JTCA 3WXEA 1MIRA 2O6XA 5CHVA 4YV8A 4PT5A 3QT4A 1F2CA 1TLOA
chains in the Genus database with same CATH topology
1NB5A 4CZWA 3MORA 3N3GA 4HWYA 2E03A 2GHUA 1IWDA 3D9WA 1PPDA 3H7DA 3RVWA 4BQVA 1VJVA 1W6FA 2PNSA 1ITOA 1CB5A 2OULA 4CDFB 4QRGA 1ME3A 1YK8A 2NQGA 3KWZA 3WXFA 3IEJA 1AIMA 2NQAA 2PREA 3IOQA 4PP1A 4QH6A 2H7JA 4BS5A 1U5IA 2P7UA 1F2BA 1TU6A 1Y08A 3PW3A 1X9YA 2B1NA 4MSXA 4YYQA 3USVA 2XU1A 1NL6A 2YJCA 3OF9A 2FUDA 5EF4A 1CV8A 1CS8A 2VFCA 3LTWA 4PI3A 3IUTA 2E02A 4Q8HA 1W4TA 4BGFA 1SP4B 4YYRA 2WBFX 1ZCMA 3P5XA 3MHSA 1MS6A 1BGOA 1THEA 4PP2E 2DC9A 3KWBX 3KFQA 1STFE 3I3TA 2R6NA 2FQ9A 9PAPA 3P5VA 1GLOA 2JQFR 2G8JA 1K3BB 1U9VA 4MZOA 2Y6EA 3S3QA 1DF0A 3N4CA 1BQIA 2AIMA 2YJ2A 4OELA 3O1GA 2BDLA 1CPJA 2Y5BA 1S4VA 2NQDB 3DF0A 1CVZA 3CH3X 3KSEA 4QBBA 3AI8A 3KW9A 4X6HA 3PNRA 3O0UA 2G7YA 2VHSA 3PDFA 4YVAA 4XR7A 1EWPA 2DZZA 5JA7A 4X6JA 2AUXA 5CHTA 5CVNB 2E01A 1PXVA 3CH2X 3H8BA 4OEMA 2R9FA 2AYOA 2IBIA 1KFXL 2YJ8A 1PBHA 1PE6A 2DC6A 3BPFA 1AYVA 1YALA 3F75A 1U9WA 4I05A 1W5RA 1POPA 2DCAA 1DEUA 4B55A 3HHAA 4P6EA 1VSNA 3ZUAA 4WA6A 1CSBB 3OVXA 2ATOA 2FTDA 2YJBA 4ZUXU 2F7DA 2BSZA 2FYEA 1QXPA 4P6GA 3IV2A 1A6RA 2HH5A 2G8EA 4N79A 4NV7A 1KFUL 4FJCA 4QRXA 1ME4A 2DCCA 4C5PA 3PBHA 1CJLA 2P0RA 3H8CA 4BSQA 4RY2A 3BPMA 3V6CA 4X6IA 3HWNA 4KLBA 2AU1A 1BY8A 2DCDA 1BP4A 1CQDA 1XKGA 1MEMA 5CVOB 3RVVA 3BC3A 1QDQA 4AXLA 2XU4A 2ARYA 2NQIA 3E1ZB 2CIOA 1ATKA 3QJ3A 7PCKA 1YT7A 2F1GA 1EWMA 4BPVA 1GMYA 3IMAA 1KXRA 1E2TA 3KX1A 4CDCB 3GCBA 1CTEA 1O0EA 1AU4A 5EGWA 2AYNA 2HXZA 3K9MA 2E00A 3V6EA 8PCHA 3HD3A 3I06A 1HUCB 2OP3A 1MDWA 2C0YA 2OZ2A 2YJ9A 2GFOA 2XU5A 4YYWA 1NLJA 5FPWA 4AXMA 3BWKA 6PADA 1PCIA 2R9OA 1PADA 1NB3A 2DJGB 3U8EA 2PADA 2FO5A 3QSDA 4CDEB 3MTNA 1JQPA 2AS8A 2JQGR 3H6SA 2R9NA 4XUIA 1KHQA 1EWLA 1GCBA 1KHPA 2G6DA 2DCBA 1YVBA 1NPZA 1TL9A 3CBKA 3B79A 3LXSA 1ICFA 3NHEA 1PPNA 2VHFA 3OVZA 2FRQA 4W4UA 1NQCA 1QMYA 4NV8A 4BS6A 2DJFB 1YK7A 3N3KA 1PPPA 1SNKA 2B1MA 3BOWA 4I07A 4DMXA 5J94A 4MZSA 4Q8GA 1GX3A 1ZIVA 3F5VA 3OF8A 4DMYA 2CB5A 4N8WA 1AYUA 1EF7A 1GECE 1PPOA 3OISA 2FT2A 1U9QX 5K16A 5F02A 2ACTA 1EWOA 3K24A 5JH3A 4W5BA 2HD5A 4I04A 3C9EA 3MHHA 3S3RA 3TNXA 1PIPA 1U9XA 3K8UA 2PBHA 2DC7A 4FIPA 1AU2A 3LFYA 2FRAA 3H89A 1AU0A 1MHWA 2DC8A 3P5WA 2AUZA 1F29A 3CBJA 3HHIA 1Q6KA 1M6DA 5PADA 1AECA 1AU3A 2R9MA 2XU3A 4CDDB 2BDZA 2AVWA 2DZYA 3RVXA 1FH0A 3IHPA 3P5UA 3M99A 4YYVA 4FK5A 2VFBA 3WXGA 1Y4HA 4K7CA 4G54A 4GUZA 3BCNA 5A24A 4YYUA 4N4ZA 4QRVA 3KKUA 4YYSA 2R9CA 4PADA 2IPPB 4W5CA 1AYWA 5CVMA 3D6SA 2HHNA 1F2AA 1QOLA 2P86A 3ERVA 1MEGA 3WXEA 1MIRA 2O6XA 5CHVA 4YV8A 3QT4A 1F2CA 1TLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB5 A;  4CZW A;  3MOR A;  3N3G A;  4HWY A;  2E03 A;  2GHU A;  1IWD A;  1PPD A;  3H7D A;  3RVW A;  4BQV A;  1VJV A;  2PNS A;  1ITO A;  1CB5 A;  2OUL A;  4CDF B;  4QRG A;  1ME3 A;  1YK8 A;  2NQG A;  3KWZ A;  3WXF A;  3IEJ A;  1AIM A;  2NQA A;  2PRE A;  3IOQ A;  4PP1 A;  4QH6 A;  2H7J A;  4BS5 A;  1U5I A;  2P7U A;  1F2B A;  1TU6 A;  1Y08 A;  3PW3 A;  1X9Y A;  2B1N A;  4MSX A;  4YYQ A;  3USV A;  2XU1 A;  1NL6 A;  2YJC A;  3OF9 A;  2FUD A;  5EF4 A;  1CV8 A;  1CS8 A;  4PI3 A;  3IUT A;  2E02 A;  4Q8H A;  1SP4 B;  4YYR A;  2WBF X;  1ZCM A;  3P5X A;  3MHS A;  1MS6 A;  1BGO A;  1THE A;  4PP2 E;  2DC9 A;  3KWB X;  3KFQ A;  1STF E;  3I3T A;  2R6N A;  2FQ9 A;  9PAP A;  3P5V A;  1GLO A;  2JQF R;  2G8J A;  1K3B B;  1U9V A;  4MZO A;  2Y6E A;  3S3Q A;  1DF0 A;  3N4C A;  1BQI A;  2AIM A;  2YJ2 A;  4OEL A;  3O1G A;  2BDL A;  1CPJ A;  2Y5B A;  1S4V A;  2NQD B;  3DF0 A;  1CVZ A;  3CH3 X;  3KSE A;  4QBB A;  3AI8 A;  3KW9 A;  4X6H A;  3PNR A;  3O0U A;  2G7Y A;  2VHS A;  3PDF A;  4YVA A;  4XR7 A;  1EWP A;  2DZZ A;  5JA7 A;  4X6J A;  2AUX A;  5CHT A;  5CVN B;  2E01 A;  1PXV A;  3CH2 X;  3H8B A;  4OEM A;  2R9F A;  2AYO A;  2IBI A;  1KFX L;  2YJ8 A;  1PBH A;  1PE6 A;  2DC6 A;  3BPF A;  1AYV A;  1YAL A;  3F75 A;  1U9W A;  4I05 A;  1POP A;  2DCA A;  1DEU A;  3HHA A;  4P6E A;  1VSN A;  3ZUA A;  4WA6 A;  1CSB B;  3OVX A;  2ATO A;  2FTD A;  2YJB A;  4ZUX U;  2F7D A;  2FYE A;  1QXP A;  4P6G A;  3IV2 A;  1A6R A;  2HH5 A;  2G8E A;  4N79 A;  1KFU L;  4FJC A;  4QRX A;  1ME4 A;  2DCC A;  3PBH A;  1CJL A;  2P0R A;  3H8C A;  4BSQ A;  4RY2 A;  3BPM A;  3V6C A;  4X6I A;  3HWN A;  4KLB A;  2AU1 A;  1BY8 A;  2DCD A;  1BP4 A;  1CQD A;  1XKG A;  1MEM A;  5CVO B;  3RVV A;  3BC3 A;  1QDQ A;  4AXL A;  2XU4 A;  2ARY A;  2NQI A;  3E1Z B;  2CIO A;  1ATK A;  3QJ3 A;  7PCK A;  1YT7 A;  2F1G A;  1EWM A;  4BPV A;  1GMY A;  3IMA A;  1KXR A;  3KX1 A;  4CDC B;  3GCB A;  1CTE A;  1O0E A;  1AU4 A;  5EGW A;  2AYN A;  2HXZ A;  3K9M A;  2E00 A;  3V6E A;  8PCH A;  3HD3 A;  3I06 A;  1HUC B;  2OP3 A;  1MDW A;  2C0Y A;  2OZ2 A;  2YJ9 A;  2GFO A;  2XU5 A;  4YYW A;  1NLJ A;  5FPW A;  4AXM A;  3BWK A;  6PAD A;  1PCI A;  2R9O A;  1PAD A;  1NB3 A;  2DJG B;  3U8E A;  2PAD A;  2FO5 A;  3QSD A;  4CDE B;  3MTN A;  1JQP A;  2AS8 A;  2JQG R;  3H6S A;  2R9N A;  4XUI A;  1KHQ A;  1EWL A;  1GCB A;  1KHP A;  2G6D A;  2DCB A;  1YVB A;  1NPZ A;  1TL9 A;  3CBK A;  3B79 A;  3LXS A;  1ICF A;  3NHE A;  1PPN A;  2VHF A;  3OVZ A;  2FRQ A;  4W4U A;  1NQC A;  1QMY A;  4BS6 A;  2DJF B;  1YK7 A;  3N3K A;  1PPP A;  1SNK A;  2B1M A;  3BOW A;  4I07 A;  4DMX A;  5J94 A;  4MZS A;  4Q8G A;  1ZIV A;  3F5V A;  3OF8 A;  4DMY A;  2CB5 A;  4N8W A;  1AYU A;  1EF7 A;  1GEC E;  1PPO A;  3OIS A;  2FT2 A;  1U9Q X;  5K16 A;  5F02 A;  2ACT A;  1EWO A;  3K24 A;  5JH3 A;  4W5B A;  2HD5 A;  4I04 A;  3C9E A;  3MHH A;  3S3R A;  3TNX A;  1PIP A;  1U9X A;  3K8U A;  2PBH A;  2DC7 A;  4FIP A;  1AU2 A;  3LFY A;  2FRA A;  3H89 A;  1AU0 A;  1MHW A;  2DC8 A;  3P5W A;  2AUZ A;  1F29 A;  3CBJ A;  3HHI A;  1Q6K A;  1M6D A;  5PAD A;  1AEC A;  1AU3 A;  2R9M A;  2XU3 A;  4CDD B;  2BDZ A;  2AVW A;  2DZY A;  3RVX A;  1FH0 A;  3IHP A;  3P5U A;  3M99 A;  4YYV A;  4FK5 A;  3WXG A;  1Y4H A;  4K7C A;  4G54 A;  5A24 A;  3BCN A;  4YYU A;  4N4Z A;  4QRV A;  3KKU A;  4YYS A;  2R9C A;  4PAD A;  2IPP B;  4W5C A;  1AYW A;  5CVM A;  3D6S A;  2HHN A;  1F2A A;  1QOL A;  2P86 A;  3ERV A;  1MEG A;  3WXE A;  1MIR A;  2O6X A;  5CHV A;  4YV8 A;  3QT4 A;  1F2C A;  1TLO A; 
#chains in the Genus database with same CATH topology
 1NB5 A;  4CZW A;  3MOR A;  3N3G A;  4HWY A;  4RKX A;  2E03 A;  4WUR A;  2GHU A;  1IWD A;  1PPD A;  3H7D A;  3RVW A;  4BQV A;  1VJV A;  2BTW A;  2PNS A;  1ITO A;  3C0R A;  1CB5 A;  2OUL A;  4CDF B;  4D8I A;  4IUM A;  4QRG A;  1ME3 A;  1YK8 A;  2NQG A;  2BTW B;  1PVJ A;  3KWZ A;  4BOQ A;  3WXF A;  3IEJ A;  1AIM A;  2NQA A;  2PRE A;  4M0W A;  4BOZ A;  3IOQ A;  4PP1 A;  4QH6 A;  2H7J A;  4BS5 A;  1U5I A;  2P7U A;  3O65 A;  1F2B A;  1TU6 A;  1Y08 A;  3PW3 A;  1X9Y A;  2B1N A;  4MSX A;  4YYQ A;  3USV A;  2XU1 A;  1NL6 A;  2YJC A;  3OF9 A;  2FUD A;  5EF4 A;  1CV8 A;  1CS8 A;  4PI3 A;  2J7Q A;  3IUT A;  2E02 A;  4Q8H A;  3PSE A;  1SP4 B;  3PT2 A;  4YYR A;  2WBF X;  1ZCM A;  3P5X A;  4GUA A;  3MHS A;  4MM3 B;  1MS6 A;  1BGO A;  1THE A;  4PP2 E;  2DC9 A;  3KWB X;  3KFQ A;  5EZQ A;  1STF E;  3I3T A;  2R6N A;  2FQ9 A;  9PAP A;  3P5V A;  1GLO A;  2JQF R;  2G8J A;  1K3B B;  1U9V A;  2FE8 A;  4MZO A;  2Y6E A;  3S3Q A;  1DF0 A;  3N4C A;  1BQI A;  2AIM A;  2YJ2 A;  3PHW A;  4OEL A;  4RNA A;  3O1G A;  2BDL A;  1CPJ A;  2Y5B A;  3MTV A;  1S4V A;  2NQD B;  3DF0 A;  1CVZ A;  3CH3 X;  3KSE A;  4QBB A;  3AI8 A;  3KW9 A;  4X6H A;  3PNR A;  3RNV A;  3O0U A;  2G7Y A;  2VHS A;  3PDF A;  4YVA A;  4XR7 A;  1EWP A;  3ZNH A;  2DZZ A;  2J7Q C;  5JA7 A;  4X6J A;  2AUX A;  5CHT A;  5CVN B;  2BU3 A;  2E01 A;  1PXV A;  3CH2 X;  3H8B A;  4OEM A;  2R9F A;  2AYO A;  2IBI A;  1KFX L;  2YJ8 A;  1PBH A;  1PE6 A;  2DC6 A;  3BPF A;  1AYV A;  1YAL A;  3F75 A;  1U9W A;  4I05 A;  1POP A;  2DCA A;  1DEU A;  3OQC A;  3HHA A;  3PRM A;  4P6E A;  1VSN A;  3ZUA A;  4WA6 A;  1CSB B;  3OVX A;  2ATO A;  4IP3 A;  2FTD A;  2YJB A;  4ZUX U;  2F7D A;  4R3D A;  2FYE A;  1QXP A;  4P6G A;  3IV2 A;  3PRP A;  3BB7 A;  1A6R A;  2HH5 A;  2G8E A;  3BBA A;  3BY4 A;  4N79 A;  1KFU L;  4FJC A;  4QRX A;  4OVZ B;  1ME4 A;  2DCC A;  3PBH A;  1CJL A;  2P0R A;  3H8C A;  5EZS A;  3B21 A;  4BSQ A;  4RY2 A;  3BPM A;  3V6C A;  4X6I A;  3HWN A;  4KLB A;  2AU1 A;  1BY8 A;  2DCD A;  1BP4 A;  2Z84 A;  3W31 A;  5JZE A;  1CQD A;  1XKG A;  1MEM A;  5CVO B;  5KO3 A;  3RVV A;  3BC3 A;  1QDQ A;  4AXL A;  4BOP A;  2XU4 A;  4HXD B;  2ARY A;  2NQI A;  3E1Z B;  2CIO A;  1ATK A;  3QJ3 A;  7PCK A;  4XZX A;  1YT7 A;  2F1G A;  1EWM A;  4BPV A;  1GMY A;  3W30 A;  3IMA A;  4ZTB A;  1KXR A;  3KX1 A;  4CDC B;  2DOS A;  2UZJ A;  3GCB A;  1CTE A;  1O0E A;  1AU4 A;  5EGW A;  2AYN A;  2HXZ A;  3K9M A;  2E00 A;  3V6E A;  8PCH A;  3HD3 A;  3I06 A;  1HUC B;  2OP3 A;  1MDW A;  2C0Y A;  2OZ2 A;  2YJ9 A;  2GFO A;  4D8B A;  2XU5 A;  4YYW A;  1NLJ A;  5FPW A;  4P16 A;  4AXM A;  3BWK A;  6PAD A;  1PCI A;  2R9O A;  1PAD A;  1NB3 A;  2DJG B;  3U8E A;  3TMP A;  4A5U A;  2PAD A;  2FO5 A;  3QSD A;  4CDE B;  3MTN A;  4MI7 A;  1JQP A;  3TRK A;  2AS8 A;  2JQG R;  3H6S A;  2R9N A;  4XUI A;  1KHQ A;  1EWL A;  1GCB A;  1KHP A;  2G6D A;  2AGA A;  2DCB A;  1YVB A;  1NPZ A;  1TL9 A;  3CBK A;  4OVZ A;  3B79 A;  3LXS A;  1ICF A;  3NHE A;  1PPN A;  2VHF A;  3OVZ A;  2FRQ A;  4W4U A;  5E6J A;  1NQC A;  1QMY A;  4BS6 A;  2DJF B;  1YK7 A;  3N3K A;  1PPP A;  1SNK A;  2B1M A;  4RF1 A;  3BOW A;  4I07 A;  4DMX A;  5J94 A;  4MZS A;  4Q8G A;  1ZIV A;  3F5V A;  3OF8 A;  4DMY A;  2CB5 A;  4N8W A;  1AYU A;  1EF7 A;  1GEC E;  1PPO A;  3OIS A;  2FT2 A;  1U9Q X;  4RF0 A;  5K16 A;  4BOU A;  5F02 A;  2ACT A;  1EWO A;  3K24 A;  3E9S A;  5JH3 A;  4W5B A;  2HD5 A;  4I04 A;  3C9E A;  3MHH A;  3S3R A;  4REZ A;  3TNX A;  4OW0 A;  1PIP A;  1U9X A;  3K8U A;  3PHX A;  3IFU A;  2PBH A;  2DC7 A;  2JRI A;  4FIP A;  1AU2 A;  3LFY A;  2FRA A;  1UKF A;  3H89 A;  1AU0 A;  3MP2 A;  1MHW A;  2DC8 A;  2HWK A;  3P5W A;  2AUZ A;  1F29 A;  3CBJ A;  3HHI A;  1Q6K A;  1M6D A;  5PAD A;  1AEC A;  1AU3 A;  2R9M A;  2XU3 A;  4CDD B;  2BDZ A;  2AVW A;  2DZY A;  3RVX A;  1FH0 A;  3IHP A;  3P5U A;  1YZB A;  3M99 A;  4BOS A;  4D8E A;  4YYV A;  4FK5 A;  3WXG A;  1Y4H A;  4K7C A;  4G54 A;  5A24 A;  3BCN A;  4YYU A;  4N4Z A;  3MJ5 A;  4QRV A;  3KKU A;  4YYS A;  2R9C A;  4PAD A;  2IPP B;  4W5C A;  1AYW A;  5CVM A;  1DKI A;  3PHU A;  3D6S A;  2HHN A;  1F2A A;  1QOL A;  2P86 A;  3ERV A;  1MEG A;  2JTC A;  3WXE A;  1MIR A;  2O6X A;  5CHV A;  4YV8 A;  4PT5 A;  3QT4 A;  1F2C A;  1TLO A; 
#chains in the Genus database with same CATH homology
 1NB5 A;  4CZW A;  3MOR A;  3N3G A;  4HWY A;  2E03 A;  2GHU A;  1IWD A;  3D9W A;  1PPD A;  3H7D A;  3RVW A;  4BQV A;  1VJV A;  1W6F A;  2PNS A;  1ITO A;  1CB5 A;  2OUL A;  4CDF B;  4QRG A;  1ME3 A;  1YK8 A;  2NQG A;  3KWZ A;  3WXF A;  3IEJ A;  1AIM A;  2NQA A;  2PRE A;  3IOQ A;  4PP1 A;  4QH6 A;  2H7J A;  4BS5 A;  1U5I A;  2P7U A;  1F2B A;  1TU6 A;  1Y08 A;  3PW3 A;  1X9Y A;  2B1N A;  4MSX A;  4YYQ A;  3USV A;  2XU1 A;  1NL6 A;  2YJC A;  3OF9 A;  2FUD A;  5EF4 A;  1CV8 A;  1CS8 A;  2VFC A;  3LTW A;  4PI3 A;  3IUT A;  2E02 A;  4Q8H A;  1W4T A;  4BGF A;  1SP4 B;  4YYR A;  2WBF X;  1ZCM A;  3P5X A;  3MHS A;  1MS6 A;  1BGO A;  1THE A;  4PP2 E;  2DC9 A;  3KWB X;  3KFQ A;  1STF E;  3I3T A;  2R6N A;  2FQ9 A;  9PAP A;  3P5V A;  1GLO A;  2JQF R;  2G8J A;  1K3B B;  1U9V A;  4MZO A;  2Y6E A;  3S3Q A;  1DF0 A;  3N4C A;  1BQI A;  2AIM A;  2YJ2 A;  4OEL A;  3O1G A;  2BDL A;  1CPJ A;  2Y5B A;  1S4V A;  2NQD B;  3DF0 A;  1CVZ A;  3CH3 X;  3KSE A;  4QBB A;  3AI8 A;  3KW9 A;  4X6H A;  3PNR A;  3O0U A;  2G7Y A;  2VHS A;  3PDF A;  4YVA A;  4XR7 A;  1EWP A;  2DZZ A;  5JA7 A;  4X6J A;  2AUX A;  5CHT A;  5CVN B;  2E01 A;  1PXV A;  3CH2 X;  3H8B A;  4OEM A;  2R9F A;  2AYO A;  2IBI A;  1KFX L;  2YJ8 A;  1PBH A;  1PE6 A;  2DC6 A;  3BPF A;  1AYV A;  1YAL A;  3F75 A;  1U9W A;  4I05 A;  1W5R A;  1POP A;  2DCA A;  1DEU A;  4B55 A;  3HHA A;  4P6E A;  1VSN A;  3ZUA A;  4WA6 A;  1CSB B;  3OVX A;  2ATO A;  2FTD A;  2YJB A;  4ZUX U;  2F7D A;  2BSZ A;  2FYE A;  1QXP A;  4P6G A;  3IV2 A;  1A6R A;  2HH5 A;  2G8E A;  4N79 A;  4NV7 A;  1KFU L;  4FJC A;  4QRX A;  1ME4 A;  2DCC A;  4C5P A;  3PBH A;  1CJL A;  2P0R A;  3H8C A;  4BSQ A;  4RY2 A;  3BPM A;  3V6C A;  4X6I A;  3HWN A;  4KLB A;  2AU1 A;  1BY8 A;  2DCD A;  1BP4 A;  1CQD A;  1XKG A;  1MEM A;  5CVO B;  3RVV A;  3BC3 A;  1QDQ A;  4AXL A;  2XU4 A;  2ARY A;  2NQI A;  3E1Z B;  2CIO A;  1ATK A;  3QJ3 A;  7PCK A;  1YT7 A;  2F1G A;  1EWM A;  4BPV A;  1GMY A;  3IMA A;  1KXR A;  1E2T A;  3KX1 A;  4CDC B;  3GCB A;  1CTE A;  1O0E A;  1AU4 A;  5EGW A;  2AYN A;  2HXZ A;  3K9M A;  2E00 A;  3V6E A;  8PCH A;  3HD3 A;  3I06 A;  1HUC B;  2OP3 A;  1MDW A;  2C0Y A;  2OZ2 A;  2YJ9 A;  2GFO A;  2XU5 A;  4YYW A;  1NLJ A;  5FPW A;  4AXM A;  3BWK A;  6PAD A;  1PCI A;  2R9O A;  1PAD A;  1NB3 A;  2DJG B;  3U8E A;  2PAD A;  2FO5 A;  3QSD A;  4CDE B;  3MTN A;  1JQP A;  2AS8 A;  2JQG R;  3H6S A;  2R9N A;  4XUI A;  1KHQ A;  1EWL A;  1GCB A;  1KHP A;  2G6D A;  2DCB A;  1YVB A;  1NPZ A;  1TL9 A;  3CBK A;  3B79 A;  3LXS A;  1ICF A;  3NHE A;  1PPN A;  2VHF A;  3OVZ A;  2FRQ A;  4W4U A;  1NQC A;  1QMY A;  4NV8 A;  4BS6 A;  2DJF B;  1YK7 A;  3N3K A;  1PPP A;  1SNK A;  2B1M A;  3BOW A;  4I07 A;  4DMX A;  5J94 A;  4MZS A;  4Q8G A;  1GX3 A;  1ZIV A;  3F5V A;  3OF8 A;  4DMY A;  2CB5 A;  4N8W A;  1AYU A;  1EF7 A;  1GEC E;  1PPO A;  3OIS A;  2FT2 A;  1U9Q X;  5K16 A;  5F02 A;  2ACT A;  1EWO A;  3K24 A;  5JH3 A;  4W5B A;  2HD5 A;  4I04 A;  3C9E A;  3MHH A;  3S3R A;  3TNX A;  1PIP A;  1U9X A;  3K8U A;  2PBH A;  2DC7 A;  4FIP A;  1AU2 A;  3LFY A;  2FRA A;  3H89 A;  1AU0 A;  1MHW A;  2DC8 A;  3P5W A;  2AUZ A;  1F29 A;  3CBJ A;  3HHI A;  1Q6K A;  1M6D A;  5PAD A;  1AEC A;  1AU3 A;  2R9M A;  2XU3 A;  4CDD B;  2BDZ A;  2AVW A;  2DZY A;  3RVX A;  1FH0 A;  3IHP A;  3P5U A;  3M99 A;  4YYV A;  4FK5 A;  2VFB A;  3WXG A;  1Y4H A;  4K7C A;  4G54 A;  4GUZ A;  3BCN A;  5A24 A;  4YYU A;  4N4Z A;  4QRV A;  3KKU A;  4YYS A;  2R9C A;  4PAD A;  2IPP B;  4W5C A;  1AYW A;  5CVM A;  3D6S A;  2HHN A;  1F2A A;  1QOL A;  2P86 A;  3ERV A;  1MEG A;  3WXE A;  1MIR A;  2O6X A;  5CHV A;  4YV8 A;  3QT4 A;  1F2C A;  1TLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...