4QBBA

Structure of the foot-and-mouth disease virus leader proteinase in complex with inhibitor (n~2~-[(3s)-4-({(2r)-1-[(4-carbamimidamidobutyl)amino]-4-methyl-1-oxopentan-2-yl}amino)-3-hydroxy-4-oxobutanoyl]-l-arginyl-l-prolinamide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNCWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leader protease
publication title Foot-and-mouth disease virus leader proteinase: Structural insights into the mechanism of intermolecular cleavage.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qbbA00
1NB5A 2NQAA 2AUZA 2HXZA 2FTDA 1AU2A 4HWYA 4PP2E 1QDQA 5EGWA 5J94A 3OF9A 1CTEA 2E01A 3V6EA 1CPJA 1GECE 1YK7A 2FYEA 1MHWA 2P0RA 1PPNA 2XU5A 5JA7A 3MTNA 5JH3A 3O0UA 4CDDB 4ZUXU 3PBHA 2JQFR 4BSQA 2JQGR 2PBHA 2P86A 3K9MA 1F29A 1AU4A 2R6NA 4Q8HA 4BS5A 1KFXL 1PBHA 1U9XA 4YYWA 2YJ8A 3CH2X 1CV8A 1M6DA 1BP4A 1PPDA 2O6XA 2G8EA 4QH6A 2WBFX 3HD3A 1MDWA 1NL6A 2ARYA 4YV8A 4RY2A 4I04A 2HD5A 3MORA 2IPPB 2P7UA 6PADA 1F2CA 4KLBA 4CDCB 4X6JA 1Y4HA 4N4ZA 2HH5A 2OP3A 2DCBA 1MEMA 4MSXA 2ATOA 2FRQA 1F2AA 2Y5BA 2DC7A 3HWNA 1YALA 2IBIA 4G54A 2AYOA 1SP4B 3H7DA 4N79A 1KHPA 4MZSA 1STFE 3ZUAA 1TU6A 2AVWA 1CVZA 2FO5A 2DJFB 2NQGA 4PI3A 1IWDA 3H89A 1THEA 1FH0A 1POPA 5K16A 2C0YA 2DCDA 2YJ2A 1ZIVA 3KWBX 3HHAA 3U8EA 3H8BA 2E00A 1K3BB 3USVA 3WXFA 1S4VA 2DCCA 3CBKA 3BPFA 2GFOA 5A24A 3OISA 3NHEA 1TL9A 4XR7A 4CZWA 1ME4A 2DZYA 4DMYA 3N3KA 2R9MA 2VHFA 4YVAA 1ATKA 2CB5A 3H6SA 4MZOA 1YT7A 2G6DA 5CVOB 2XU4A 2YJ9A 1XKGA 2BDZA 4BQVA 1AU0A 3I3TA 3BC3A 2Y6EA 3M99A 3IUTA 2E02A 1GMYA 1PPPA 1QXPA 7PCKA 1PPOA 3D6SA 3KWZA 1EWOA 2DCAA 1Y08A 1NB3A 1NPZA 2B1MA 2OULA 4BS6A 1BY8A 1PCIA 3PDFA 2R9OA 3BOWA 3GCBA 2AYNA 5PADA 1AU3A 2YJCA 3AI8A 1ZCMA 2G7YA 3E1ZB 1AIMA 4Q8GA 2XU3A 2AS8A 3OVZA 4OEMA 2R9NA 3DF0A 2R9FA 2B1NA 3LFYA 4FK5A 3IV2A 1EWLA 3LXSA 2XU1A 3RVXA 2AUXA 1DEUA 1AYWA 4QRGA 1U9QX 4QBBA 4QRXA 1DF0A 4YYRA 3QSDA 1ITOA 4CDEB 4QRVA 3WXEA 1VSNA 3C9EA 3BCNA 4X6HA 2BDLA 1VJVA 3CBJA 1CB5A 4PADA 1AYVA 3F75A 1Q6KA 3QT4A 8PCHA 3CH3X 4AXMA 4YYQA 1ME3A 2VHSA 4XUIA 2CIOA 3MHHA 3MHSA 1EWPA 1O0EA 1MEGA 1EF7A 2DJGB 1EWMA 1QMYA 1A6RA 4FIPA 1JQPA 3F5VA 4I07A 2HHNA 1AYUA 1BQIA 3RVVA 3KFQA 3S3QA 1YK8A 2FUDA 3OVXA 2DC6A 2PNSA 2PREA 3N3GA 4DMXA 5CVMA 3TNXA 3IMAA 3P5VA 4BPVA 2F7DA 4X6IA 3P5UA 1PADA 2DC8A 1CJLA 5CHVA 4AXLA 2H7JA 2DC9A 1U9VA 3HHIA 2NQDB 4K7CA 1CSBB 2R9CA 2AU1A 4N8WA 2OZ2A 5CHTA 1PE6A 3N4CA 3I06A 4P6GA 5CVNB 1GLOA 3P5XA 3BPMA 2FQ9A 9PAPA 1TLOA 1PXVA 4YYUA 4W5CA 2FRAA 1YVBA 3K8UA 1U5IA 1MS6A 1PIPA 3WXGA 3O1GA 3PW3A 1NLJA 1KFUL 2AIMA 1NQCA 3H8CA 4P6EA 3S3RA 1KXRA 2FT2A 1MIRA 3ERVA 3KSEA 3IEJA 3IOQA 4CDFB 3KX1A 1AECA 4I05A 3QJ3A 2G8JA 5F02A 1U9WA 1KHQA 1SNKA 2GHUA 1ICFA 4W4UA 2F1GA 1CS8A 4WA6A 3P5WA 3K24A 3RVWA 1HUCB 2DZZA 1CQDA 2PADA 2E03A 1GCBA 4OELA 4FJCA 1X9YA 2ACTA 3BWKA 2NQIA 4W5BA 3KW9A 4YYVA 5EF4A 3KKUA 5FPWA 3B79A 2YJBA 3OF8A 1F2BA 1QOLA 3PNRA 1BGOA 3V6CA 3IHPA 4PP1A 4YYSA
chains in the Genus database with same CATH superfamily
1NB5A 2NQAA 2AUZA 4BOZA 2HXZA 2FTDA 1AU2A 4HWYA 4PP2E 1QDQA 5EGWA 5J94A 3OF9A 1CTEA 4GUAA 2E01A 3PRPA 3V6EA 1CPJA 1GECE 1YK7A 2FYEA 1MHWA 2P0RA 1PPNA 2XU5A 5JA7A 3MTNA 5JH3A 3O0UA 4CDDB 4ZUXU 4WURA 2FE8A 2BTWB 3PBHA 2JQFR 4BSQA 2JQGR 2PBHA 3BY4A 2P86A 3K9MA 1F29A 1AU4A 3TMPA 2R6NA 4Q8HA 4BS5A 1KFXL 1PBHA 1U9XA 4YYWA 2YJ8A 3CH2X 1CV8A 1M6DA 2HWKA 1BP4A 1PPDA 1DKIA 2O6XA 2BU3A 2G8EA 4QH6A 2WBFX 3HD3A 1MDWA 1NL6A 2ARYA 4YV8A 4RY2A 4I04A 2HD5A 3MORA 2IPPB 4PT5A 2P7UA 6PADA 1F2CA 4KLBA 4CDCB 4X6JA 1Y4HA 4N4ZA 4D8BA 2HH5A 4M0WA 2OP3A 2DCBA 1MEMA 4MSXA 2ATOA 2FRQA 1F2AA 2Y5BA 2AGAA 2DC7A 3BBAA 3HWNA 1YALA 2IBIA 4G54A 2AYOA 3C0RA 1SP4B 3H7DA 4N79A 1KHPA 4MZSA 1STFE 3ZUAA 4A5UA 1TU6A 3PHWA 2AVWA 1CVZA 2FO5A 2DJFB 2NQGA 4PI3A 1IWDA 3H89A 1THEA 1FH0A 1POPA 5K16A 2C0YA 2DCDA 2YJ2A 1ZIVA 3OQCA 3KWBX 1UKFA 3HHAA 4OW0A 3U8EA 3H8BA 2E00A 1K3BB 3USVA 3WXFA 1S4VA 2DCCA 3CBKA 3BPFA 2GFOA 5A24A 3OISA 3NHEA 1TL9A 4XR7A 4CZWA 1ME4A 2DZYA 4DMYA 4D8EA 3N3KA 2R9MA 2VHFA 4YVAA 1ATKA 2CB5A 3H6SA 4MZOA 1YT7A 2G6DA 5CVOB 2XU4A 2YJ9A 1XKGA 2BDZA 4BQVA 1AU0A 3I3TA 3BC3A 2Y6EA 3M99A 3IUTA 2E02A 1GMYA 3W31A 4RKXA 5JZEA 1PPPA 1QXPA 7PCKA 1PPOA 3D6SA 3KWZA 2JRIA 1EWOA 2DCAA 3MP2A 1Y08A 4ZTBA 1NB3A 1NPZA 3BB7A 2B1MA 2OULA 4BS6A 1BY8A 1PCIA 3PHXA 3PDFA 2R9OA 3BOWA 3GCBA 2AYNA 5PADA 1AU3A 2YJCA 3AI8A 4OVZA 1ZCMA 2G7YA 3E1ZB 1AIMA 4Q8GA 2XU3A 2AS8A 4D8IA 3OVZA 4OEMA 2R9NA 3DF0A 2R9FA 3IFUA 1YZBA 2B1NA 3LFYA 4FK5A 3IV2A 1EWLA 3LXSA 2XU1A 5E6JA 3W30A 3RVXA 2AUXA 4R3DA 1DEUA 1AYWA 4QRGA 3B21A 1U9QX 4QBBA 4QRXA 1DF0A 4YYRA 3QSDA 5KO3A 1ITOA 4CDEB 4QRVA 3WXEA 2J7QA 1VSNA 3C9EA 3BCNA 4X6HA 2BDLA 2BTWA 1VJVA 3CBJA 1CB5A 4PADA 1AYVA 3F75A 1Q6KA 3QT4A 8PCHA 3CH3X 4AXMA 2UZJA 4YYQA 1ME3A 2VHSA 4XUIA 2CIOA 3PT2A 3MHHA 3MHSA 1EWPA 1O0EA 1MEGA 1EF7A 2DJGB 1EWMA 1QMYA 1A6RA 4FIPA 1JQPA 3F5VA 4I07A 2HHNA 1AYUA 4BOUA 1BQIA 3MJ5A 3RVVA 3KFQA 3S3QA 1YK8A 2FUDA 4MI7A 3OVXA 4IP3A 2DC6A 2PNSA 2PREA 3N3GA 4DMXA 4REZA 3TRKA 5CVMA 3TNXA 4OVZB 3IMAA 3P5VA 4BPVA 2F7DA 4X6IA 4XZXA 3P5UA 1PADA 2DC8A 1CJLA 4RNAA 5CHVA 4AXLA 2H7JA 2DC9A 1U9VA 3HHIA 5EZQA 2NQDB 4K7CA 4RF1A 1CSBB 2R9CA 4HXDB 2AU1A 3PHUA 2OZ2A 4N8WA 5CHTA 1PE6A 3PRMA 3N4CA 3I06A 4P6GA 3PSEA 2DOSA 5CVNB 1GLOA 3P5XA 5EZSA 3BPMA 2FQ9A 4BOPA 9PAPA 1TLOA 1PXVA 3RNVA 4YYUA 2J7QC 4W5CA 2FRAA 1YVBA 3K8UA 1U5IA 1MS6A 1PIPA 3WXGA 3O1GA 3PW3A 1NLJA 1KFUL 2AIMA 3O65A 1NQCA 3H8CA 4P6EA 3S3RA 1KXRA 3ZNHA 2FT2A 4MM3B 1MIRA 3ERVA 3KSEA 4BOQA 3IEJA 3IOQA 4CDFB 3KX1A 1AECA 4I05A 3QJ3A 2G8JA 5F02A 1U9WA 1KHQA 2JTCA 1SNKA 2GHUA 1ICFA 4W4UA 2F1GA 1CS8A 4WA6A 3P5WA 3K24A 2Z84A 3RVWA 1HUCB 2DZZA 1CQDA 2PADA 4IUMA 2E03A 1GCBA 4OELA 4FJCA 1X9YA 2ACTA 3BWKA 2NQIA 4W5BA 3KW9A 4P16A 4YYVA 5EF4A 3E9SA 3KKUA 5FPWA 3B79A 2YJBA 3OF8A 1F2BA 4RF0A 1QOLA 3MTVA 3PNRA 1BGOA 4BOSA 3V6CA 3IHPA 1PVJA 4PP1A 4YYSA
chains in the Genus database with same CATH topology
1NB5A 2NQAA 2AUZA 2HXZA 2FTDA 1AU2A 4HWYA 4PP2E 1QDQA 5EGWA 5J94A 3OF9A 1CTEA 2E01A 3V6EA 1CPJA 1GECE 1YK7A 2FYEA 1MHWA 2P0RA 1PPNA 2XU5A 5JA7A 3MTNA 5JH3A 3O0UA 4CDDB 4ZUXU 3PBHA 2JQFR 4BSQA 2JQGR 2PBHA 2P86A 1W6FA 3K9MA 1F29A 1AU4A 2R6NA 4Q8HA 4BS5A 1KFXL 1PBHA 4C5PA 1U9XA 4YYWA 2YJ8A 3CH2X 1CV8A 1M6DA 1BP4A 1PPDA 2VFBA 2O6XA 2G8EA 4QH6A 2WBFX 3HD3A 1MDWA 1NL6A 2ARYA 4YV8A 4RY2A 4I04A 2HD5A 3MORA 2IPPB 2P7UA 6PADA 1F2CA 4KLBA 4CDCB 4X6JA 1Y4HA 4N4ZA 2HH5A 2OP3A 4B55A 2DCBA 1MEMA 4MSXA 2ATOA 2FRQA 1F2AA 2Y5BA 2DC7A 3HWNA 1YALA 2IBIA 4G54A 2AYOA 1SP4B 3H7DA 4N79A 1KHPA 4MZSA 1STFE 3ZUAA 1TU6A 2AVWA 1CVZA 2FO5A 2DJFB 2NQGA 4PI3A 1IWDA 3H89A 1THEA 1FH0A 1POPA 5K16A 2C0YA 2DCDA 1E2TA 1ZIVA 2YJ2A 3KWBX 3HHAA 3U8EA 4BGFA 3H8BA 2E00A 1K3BB 3USVA 3WXFA 1S4VA 2DCCA 3CBKA 3BPFA 2GFOA 5A24A 3OISA 3NHEA 1TL9A 4XR7A 4CZWA 1ME4A 2DZYA 4DMYA 3N3KA 2R9MA 2VHFA 4YVAA 1ATKA 2CB5A 3H6SA 4MZOA 1YT7A 2G6DA 5CVOB 2XU4A 2YJ9A 1XKGA 2BDZA 4BQVA 1AU0A 3I3TA 3BC3A 2Y6EA 3M99A 3IUTA 2E02A 1GMYA 1PPPA 1QXPA 7PCKA 1PPOA 3D6SA 3KWZA 2BSZA 1EWOA 2DCAA 1GX3A 1Y08A 1NB3A 1NPZA 2B1MA 2OULA 4BS6A 1BY8A 1PCIA 3PDFA 2R9OA 3BOWA 3GCBA 2AYNA 5PADA 1AU3A 2YJCA 3AI8A 1ZCMA 2G7YA 3E1ZB 1W5RA 1AIMA 4Q8GA 2XU3A 2AS8A 3OVZA 4OEMA 2R9NA 3DF0A 2R9FA 4NV8A 2B1NA 3LFYA 4FK5A 3IV2A 1EWLA 3LXSA 2XU1A 3RVXA 2AUXA 1DEUA 1AYWA 4QRGA 1U9QX 4QBBA 4QRXA 1DF0A 4YYRA 3QSDA 1ITOA 4CDEB 4QRVA 3WXEA 1VSNA 3C9EA 3BCNA 4X6HA 2BDLA 1VJVA 3CBJA 1CB5A 4PADA 1AYVA 3F75A 1Q6KA 3QT4A 8PCHA 3CH3X 4AXMA 4YYQA 1ME3A 2VHSA 4XUIA 2CIOA 3MHHA 3MHSA 1EWPA 1O0EA 1MEGA 1EF7A 2DJGB 1EWMA 1QMYA 1A6RA 4FIPA 1JQPA 3F5VA 4I07A 2HHNA 1AYUA 1BQIA 3RVVA 3KFQA 3S3QA 1YK8A 2FUDA 3OVXA 3D9WA 2DC6A 2PNSA 2PREA 3N3GA 4DMXA 5CVMA 3TNXA 3IMAA 3P5VA 4NV7A 4BPVA 2F7DA 4X6IA 3P5UA 1PADA 2DC8A 1CJLA 5CHVA 4AXLA 2H7JA 2DC9A 1U9VA 3HHIA 2NQDB 4K7CA 1CSBB 2R9CA 2AU1A 4N8WA 2OZ2A 5CHTA 1PE6A 1W4TA 3N4CA 3I06A 4P6GA 5CVNB 1GLOA 3P5XA 3BPMA 2FQ9A 9PAPA 1TLOA 1PXVA 4YYUA 4W5CA 2FRAA 1YVBA 3K8UA 1U5IA 1MS6A 1PIPA 3WXGA 3O1GA 3PW3A 1NLJA 1KFUL 2AIMA 2VFCA 1NQCA 3H8CA 4P6EA 3S3RA 1KXRA 2FT2A 1MIRA 3ERVA 3KSEA 3LTWA 3IEJA 3IOQA 4CDFB 3KX1A 1AECA 4I05A 3QJ3A 2G8JA 5F02A 1U9WA 1KHQA 1SNKA 2GHUA 1ICFA 4GUZA 4W4UA 2F1GA 1CS8A 4WA6A 3P5WA 3K24A 3RVWA 1HUCB 2DZZA 1CQDA 2PADA 2E03A 1GCBA 4OELA 4FJCA 1X9YA 2ACTA 3BWKA 2NQIA 4W5BA 3KW9A 4YYVA 5EF4A 3KKUA 5FPWA 3B79A 2YJBA 3OF8A 1F2BA 1QOLA 3PNRA 1BGOA 3V6CA 3IHPA 4PP1A 4YYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB5 A;  2NQA A;  2AUZ A;  2HXZ A;  2FTD A;  1AU2 A;  4HWY A;  4PP2 E;  1QDQ A;  5EGW A;  5J94 A;  3OF9 A;  1CTE A;  2E01 A;  3V6E A;  1CPJ A;  1GEC E;  1YK7 A;  2FYE A;  1MHW A;  2P0R A;  1PPN A;  2XU5 A;  5JA7 A;  3MTN A;  5JH3 A;  3O0U A;  4CDD B;  4ZUX U;  3PBH A;  2JQF R;  4BSQ A;  2JQG R;  2PBH A;  2P86 A;  3K9M A;  1F29 A;  1AU4 A;  2R6N A;  4Q8H A;  4BS5 A;  1KFX L;  1PBH A;  1U9X A;  4YYW A;  2YJ8 A;  3CH2 X;  1CV8 A;  1M6D A;  1BP4 A;  1PPD A;  2O6X A;  2G8E A;  4QH6 A;  2WBF X;  3HD3 A;  1MDW A;  1NL6 A;  2ARY A;  4YV8 A;  4RY2 A;  4I04 A;  2HD5 A;  3MOR A;  2IPP B;  2P7U A;  6PAD A;  1F2C A;  4KLB A;  4CDC B;  4X6J A;  1Y4H A;  4N4Z A;  2HH5 A;  2OP3 A;  2DCB A;  1MEM A;  4MSX A;  2ATO A;  2FRQ A;  1F2A A;  2Y5B A;  2DC7 A;  3HWN A;  1YAL A;  2IBI A;  4G54 A;  2AYO A;  1SP4 B;  3H7D A;  4N79 A;  1KHP A;  4MZS A;  1STF E;  3ZUA A;  1TU6 A;  2AVW A;  1CVZ A;  2FO5 A;  2DJF B;  2NQG A;  4PI3 A;  1IWD A;  3H89 A;  1THE A;  1FH0 A;  1POP A;  5K16 A;  2C0Y A;  2DCD A;  2YJ2 A;  1ZIV A;  3KWB X;  3HHA A;  3U8E A;  3H8B A;  2E00 A;  1K3B B;  3USV A;  3WXF A;  1S4V A;  2DCC A;  3CBK A;  3BPF A;  2GFO A;  5A24 A;  3OIS A;  3NHE A;  1TL9 A;  4XR7 A;  4CZW A;  1ME4 A;  2DZY A;  4DMY A;  3N3K A;  2R9M A;  2VHF A;  4YVA A;  1ATK A;  2CB5 A;  3H6S A;  4MZO A;  1YT7 A;  2G6D A;  5CVO B;  2XU4 A;  2YJ9 A;  1XKG A;  2BDZ A;  4BQV A;  1AU0 A;  3I3T A;  3BC3 A;  2Y6E A;  3M99 A;  3IUT A;  2E02 A;  1GMY A;  1PPP A;  1QXP A;  7PCK A;  1PPO A;  3D6S A;  3KWZ A;  1EWO A;  2DCA A;  1Y08 A;  1NB3 A;  1NPZ A;  2B1M A;  2OUL A;  4BS6 A;  1BY8 A;  1PCI A;  3PDF A;  2R9O A;  3BOW A;  3GCB A;  2AYN A;  5PAD A;  1AU3 A;  2YJC A;  3AI8 A;  1ZCM A;  2G7Y A;  3E1Z B;  1AIM A;  4Q8G A;  2XU3 A;  2AS8 A;  3OVZ A;  4OEM A;  2R9N A;  3DF0 A;  2R9F A;  2B1N A;  3LFY A;  4FK5 A;  3IV2 A;  1EWL A;  3LXS A;  2XU1 A;  3RVX A;  2AUX A;  1DEU A;  1AYW A;  4QRG A;  1U9Q X;  4QBB A;  4QRX A;  1DF0 A;  4YYR A;  3QSD A;  1ITO A;  4CDE B;  4QRV A;  3WXE A;  1VSN A;  3C9E A;  3BCN A;  4X6H A;  2BDL A;  1VJV A;  3CBJ A;  1CB5 A;  4PAD A;  1AYV A;  3F75 A;  1Q6K A;  3QT4 A;  8PCH A;  3CH3 X;  4AXM A;  4YYQ A;  1ME3 A;  2VHS A;  4XUI A;  2CIO A;  3MHH A;  3MHS A;  1EWP A;  1O0E A;  1MEG A;  1EF7 A;  2DJG B;  1EWM A;  1QMY A;  1A6R A;  4FIP A;  1JQP A;  3F5V A;  4I07 A;  2HHN A;  1AYU A;  1BQI A;  3RVV A;  3KFQ A;  3S3Q A;  1YK8 A;  2FUD A;  3OVX A;  2DC6 A;  2PNS A;  2PRE A;  3N3G A;  4DMX A;  5CVM A;  3TNX A;  3IMA A;  3P5V A;  4BPV A;  2F7D A;  4X6I A;  3P5U A;  1PAD A;  2DC8 A;  1CJL A;  5CHV A;  4AXL A;  2H7J A;  2DC9 A;  1U9V A;  3HHI A;  2NQD B;  4K7C A;  1CSB B;  2R9C A;  2AU1 A;  4N8W A;  2OZ2 A;  5CHT A;  1PE6 A;  3N4C A;  3I06 A;  4P6G A;  5CVN B;  1GLO A;  3P5X A;  3BPM A;  2FQ9 A;  9PAP A;  1TLO A;  1PXV A;  4YYU A;  4W5C A;  2FRA A;  1YVB A;  3K8U A;  1U5I A;  1MS6 A;  1PIP A;  3WXG A;  3O1G A;  3PW3 A;  1NLJ A;  1KFU L;  2AIM A;  1NQC A;  3H8C A;  4P6E A;  3S3R A;  1KXR A;  2FT2 A;  1MIR A;  3ERV A;  3KSE A;  3IEJ A;  3IOQ A;  4CDF B;  3KX1 A;  1AEC A;  4I05 A;  3QJ3 A;  2G8J A;  5F02 A;  1U9W A;  1KHQ A;  1SNK A;  2GHU A;  1ICF A;  4W4U A;  2F1G A;  1CS8 A;  4WA6 A;  3P5W A;  3K24 A;  3RVW A;  1HUC B;  2DZZ A;  1CQD A;  2PAD A;  2E03 A;  1GCB A;  4OEL A;  4FJC A;  1X9Y A;  2ACT A;  3BWK A;  2NQI A;  4W5B A;  3KW9 A;  4YYV A;  5EF4 A;  3KKU A;  5FPW A;  3B79 A;  2YJB A;  3OF8 A;  1F2B A;  1QOL A;  3PNR A;  1BGO A;  3V6C A;  3IHP A;  4PP1 A;  4YYS A; 
#chains in the Genus database with same CATH topology
 1NB5 A;  2NQA A;  2AUZ A;  4BOZ A;  2HXZ A;  2FTD A;  1AU2 A;  4HWY A;  4PP2 E;  1QDQ A;  5EGW A;  5J94 A;  3OF9 A;  1CTE A;  4GUA A;  2E01 A;  3PRP A;  3V6E A;  1CPJ A;  1GEC E;  1YK7 A;  2FYE A;  1MHW A;  2P0R A;  1PPN A;  2XU5 A;  5JA7 A;  3MTN A;  5JH3 A;  3O0U A;  4CDD B;  4ZUX U;  4WUR A;  2FE8 A;  2BTW B;  3PBH A;  2JQF R;  4BSQ A;  2JQG R;  2PBH A;  3BY4 A;  2P86 A;  3K9M A;  1F29 A;  1AU4 A;  3TMP A;  2R6N A;  4Q8H A;  4BS5 A;  1KFX L;  1PBH A;  1U9X A;  4YYW A;  2YJ8 A;  3CH2 X;  1CV8 A;  1M6D A;  2HWK A;  1BP4 A;  1PPD A;  1DKI A;  2O6X A;  2BU3 A;  2G8E A;  4QH6 A;  2WBF X;  3HD3 A;  1MDW A;  1NL6 A;  2ARY A;  4YV8 A;  4RY2 A;  4I04 A;  2HD5 A;  3MOR A;  2IPP B;  4PT5 A;  2P7U A;  6PAD A;  1F2C A;  4KLB A;  4CDC B;  4X6J A;  1Y4H A;  4N4Z A;  4D8B A;  2HH5 A;  4M0W A;  2OP3 A;  2DCB A;  1MEM A;  4MSX A;  2ATO A;  2FRQ A;  1F2A A;  2Y5B A;  2AGA A;  2DC7 A;  3BBA A;  3HWN A;  1YAL A;  2IBI A;  4G54 A;  2AYO A;  3C0R A;  1SP4 B;  3H7D A;  4N79 A;  1KHP A;  4MZS A;  1STF E;  3ZUA A;  4A5U A;  1TU6 A;  3PHW A;  2AVW A;  1CVZ A;  2FO5 A;  2DJF B;  2NQG A;  4PI3 A;  1IWD A;  3H89 A;  1THE A;  1FH0 A;  1POP A;  5K16 A;  2C0Y A;  2DCD A;  2YJ2 A;  1ZIV A;  3OQC A;  3KWB X;  1UKF A;  3HHA A;  4OW0 A;  3U8E A;  3H8B A;  2E00 A;  1K3B B;  3USV A;  3WXF A;  1S4V A;  2DCC A;  3CBK A;  3BPF A;  2GFO A;  5A24 A;  3OIS A;  3NHE A;  1TL9 A;  4XR7 A;  4CZW A;  1ME4 A;  2DZY A;  4DMY A;  4D8E A;  3N3K A;  2R9M A;  2VHF A;  4YVA A;  1ATK A;  2CB5 A;  3H6S A;  4MZO A;  1YT7 A;  2G6D A;  5CVO B;  2XU4 A;  2YJ9 A;  1XKG A;  2BDZ A;  4BQV A;  1AU0 A;  3I3T A;  3BC3 A;  2Y6E A;  3M99 A;  3IUT A;  2E02 A;  1GMY A;  3W31 A;  4RKX A;  5JZE A;  1PPP A;  1QXP A;  7PCK A;  1PPO A;  3D6S A;  3KWZ A;  2JRI A;  1EWO A;  2DCA A;  3MP2 A;  1Y08 A;  4ZTB A;  1NB3 A;  1NPZ A;  3BB7 A;  2B1M A;  2OUL A;  4BS6 A;  1BY8 A;  1PCI A;  3PHX A;  3PDF A;  2R9O A;  3BOW A;  3GCB A;  2AYN A;  5PAD A;  1AU3 A;  2YJC A;  3AI8 A;  4OVZ A;  1ZCM A;  2G7Y A;  3E1Z B;  1AIM A;  4Q8G A;  2XU3 A;  2AS8 A;  4D8I A;  3OVZ A;  4OEM A;  2R9N A;  3DF0 A;  2R9F A;  3IFU A;  1YZB A;  2B1N A;  3LFY A;  4FK5 A;  3IV2 A;  1EWL A;  3LXS A;  2XU1 A;  5E6J A;  3W30 A;  3RVX A;  2AUX A;  4R3D A;  1DEU A;  1AYW A;  4QRG A;  3B21 A;  1U9Q X;  4QBB A;  4QRX A;  1DF0 A;  4YYR A;  3QSD A;  5KO3 A;  1ITO A;  4CDE B;  4QRV A;  3WXE A;  2J7Q A;  1VSN A;  3C9E A;  3BCN A;  4X6H A;  2BDL A;  2BTW A;  1VJV A;  3CBJ A;  1CB5 A;  4PAD A;  1AYV A;  3F75 A;  1Q6K A;  3QT4 A;  8PCH A;  3CH3 X;  4AXM A;  2UZJ A;  4YYQ A;  1ME3 A;  2VHS A;  4XUI A;  2CIO A;  3PT2 A;  3MHH A;  3MHS A;  1EWP A;  1O0E A;  1MEG A;  1EF7 A;  2DJG B;  1EWM A;  1QMY A;  1A6R A;  4FIP A;  1JQP A;  3F5V A;  4I07 A;  2HHN A;  1AYU A;  4BOU A;  1BQI A;  3MJ5 A;  3RVV A;  3KFQ A;  3S3Q A;  1YK8 A;  2FUD A;  4MI7 A;  3OVX A;  4IP3 A;  2DC6 A;  2PNS A;  2PRE A;  3N3G A;  4DMX A;  4REZ A;  3TRK A;  5CVM A;  3TNX A;  4OVZ B;  3IMA A;  3P5V A;  4BPV A;  2F7D A;  4X6I A;  4XZX A;  3P5U A;  1PAD A;  2DC8 A;  1CJL A;  4RNA A;  5CHV A;  4AXL A;  2H7J A;  2DC9 A;  1U9V A;  3HHI A;  5EZQ A;  2NQD B;  4K7C A;  4RF1 A;  1CSB B;  2R9C A;  4HXD B;  2AU1 A;  3PHU A;  2OZ2 A;  4N8W A;  5CHT A;  1PE6 A;  3PRM A;  3N4C A;  3I06 A;  4P6G A;  3PSE A;  2DOS A;  5CVN B;  1GLO A;  3P5X A;  5EZS A;  3BPM A;  2FQ9 A;  4BOP A;  9PAP A;  1TLO A;  1PXV A;  3RNV A;  4YYU A;  2J7Q C;  4W5C A;  2FRA A;  1YVB A;  3K8U A;  1U5I A;  1MS6 A;  1PIP A;  3WXG A;  3O1G A;  3PW3 A;  1NLJ A;  1KFU L;  2AIM A;  3O65 A;  1NQC A;  3H8C A;  4P6E A;  3S3R A;  1KXR A;  3ZNH A;  2FT2 A;  4MM3 B;  1MIR A;  3ERV A;  3KSE A;  4BOQ A;  3IEJ A;  3IOQ A;  4CDF B;  3KX1 A;  1AEC A;  4I05 A;  3QJ3 A;  2G8J A;  5F02 A;  1U9W A;  1KHQ A;  2JTC A;  1SNK A;  2GHU A;  1ICF A;  4W4U A;  2F1G A;  1CS8 A;  4WA6 A;  3P5W A;  3K24 A;  2Z84 A;  3RVW A;  1HUC B;  2DZZ A;  1CQD A;  2PAD A;  4IUM A;  2E03 A;  1GCB A;  4OEL A;  4FJC A;  1X9Y A;  2ACT A;  3BWK A;  2NQI A;  4W5B A;  3KW9 A;  4P16 A;  4YYV A;  5EF4 A;  3E9S A;  3KKU A;  5FPW A;  3B79 A;  2YJB A;  3OF8 A;  1F2B A;  4RF0 A;  1QOL A;  3MTV A;  3PNR A;  1BGO A;  4BOS A;  3V6C A;  3IHP A;  1PVJ A;  4PP1 A;  4YYS A; 
#chains in the Genus database with same CATH homology
 1NB5 A;  2NQA A;  2AUZ A;  2HXZ A;  2FTD A;  1AU2 A;  4HWY A;  4PP2 E;  1QDQ A;  5EGW A;  5J94 A;  3OF9 A;  1CTE A;  2E01 A;  3V6E A;  1CPJ A;  1GEC E;  1YK7 A;  2FYE A;  1MHW A;  2P0R A;  1PPN A;  2XU5 A;  5JA7 A;  3MTN A;  5JH3 A;  3O0U A;  4CDD B;  4ZUX U;  3PBH A;  2JQF R;  4BSQ A;  2JQG R;  2PBH A;  2P86 A;  1W6F A;  3K9M A;  1F29 A;  1AU4 A;  2R6N A;  4Q8H A;  4BS5 A;  1KFX L;  1PBH A;  4C5P A;  1U9X A;  4YYW A;  2YJ8 A;  3CH2 X;  1CV8 A;  1M6D A;  1BP4 A;  1PPD A;  2VFB A;  2O6X A;  2G8E A;  4QH6 A;  2WBF X;  3HD3 A;  1MDW A;  1NL6 A;  2ARY A;  4YV8 A;  4RY2 A;  4I04 A;  2HD5 A;  3MOR A;  2IPP B;  2P7U A;  6PAD A;  1F2C A;  4KLB A;  4CDC B;  4X6J A;  1Y4H A;  4N4Z A;  2HH5 A;  2OP3 A;  4B55 A;  2DCB A;  1MEM A;  4MSX A;  2ATO A;  2FRQ A;  1F2A A;  2Y5B A;  2DC7 A;  3HWN A;  1YAL A;  2IBI A;  4G54 A;  2AYO A;  1SP4 B;  3H7D A;  4N79 A;  1KHP A;  4MZS A;  1STF E;  3ZUA A;  1TU6 A;  2AVW A;  1CVZ A;  2FO5 A;  2DJF B;  2NQG A;  4PI3 A;  1IWD A;  3H89 A;  1THE A;  1FH0 A;  1POP A;  5K16 A;  2C0Y A;  2DCD A;  1E2T A;  1ZIV A;  2YJ2 A;  3KWB X;  3HHA A;  3U8E A;  4BGF A;  3H8B A;  2E00 A;  1K3B B;  3USV A;  3WXF A;  1S4V A;  2DCC A;  3CBK A;  3BPF A;  2GFO A;  5A24 A;  3OIS A;  3NHE A;  1TL9 A;  4XR7 A;  4CZW A;  1ME4 A;  2DZY A;  4DMY A;  3N3K A;  2R9M A;  2VHF A;  4YVA A;  1ATK A;  2CB5 A;  3H6S A;  4MZO A;  1YT7 A;  2G6D A;  5CVO B;  2XU4 A;  2YJ9 A;  1XKG A;  2BDZ A;  4BQV A;  1AU0 A;  3I3T A;  3BC3 A;  2Y6E A;  3M99 A;  3IUT A;  2E02 A;  1GMY A;  1PPP A;  1QXP A;  7PCK A;  1PPO A;  3D6S A;  3KWZ A;  2BSZ A;  1EWO A;  2DCA A;  1GX3 A;  1Y08 A;  1NB3 A;  1NPZ A;  2B1M A;  2OUL A;  4BS6 A;  1BY8 A;  1PCI A;  3PDF A;  2R9O A;  3BOW A;  3GCB A;  2AYN A;  5PAD A;  1AU3 A;  2YJC A;  3AI8 A;  1ZCM A;  2G7Y A;  3E1Z B;  1W5R A;  1AIM A;  4Q8G A;  2XU3 A;  2AS8 A;  3OVZ A;  4OEM A;  2R9N A;  3DF0 A;  2R9F A;  4NV8 A;  2B1N A;  3LFY A;  4FK5 A;  3IV2 A;  1EWL A;  3LXS A;  2XU1 A;  3RVX A;  2AUX A;  1DEU A;  1AYW A;  4QRG A;  1U9Q X;  4QBB A;  4QRX A;  1DF0 A;  4YYR A;  3QSD A;  1ITO A;  4CDE B;  4QRV A;  3WXE A;  1VSN A;  3C9E A;  3BCN A;  4X6H A;  2BDL A;  1VJV A;  3CBJ A;  1CB5 A;  4PAD A;  1AYV A;  3F75 A;  1Q6K A;  3QT4 A;  8PCH A;  3CH3 X;  4AXM A;  4YYQ A;  1ME3 A;  2VHS A;  4XUI A;  2CIO A;  3MHH A;  3MHS A;  1EWP A;  1O0E A;  1MEG A;  1EF7 A;  2DJG B;  1EWM A;  1QMY A;  1A6R A;  4FIP A;  1JQP A;  3F5V A;  4I07 A;  2HHN A;  1AYU A;  1BQI A;  3RVV A;  3KFQ A;  3S3Q A;  1YK8 A;  2FUD A;  3OVX A;  3D9W A;  2DC6 A;  2PNS A;  2PRE A;  3N3G A;  4DMX A;  5CVM A;  3TNX A;  3IMA A;  3P5V A;  4NV7 A;  4BPV A;  2F7D A;  4X6I A;  3P5U A;  1PAD A;  2DC8 A;  1CJL A;  5CHV A;  4AXL A;  2H7J A;  2DC9 A;  1U9V A;  3HHI A;  2NQD B;  4K7C A;  1CSB B;  2R9C A;  2AU1 A;  4N8W A;  2OZ2 A;  5CHT A;  1PE6 A;  1W4T A;  3N4C A;  3I06 A;  4P6G A;  5CVN B;  1GLO A;  3P5X A;  3BPM A;  2FQ9 A;  9PAP A;  1TLO A;  1PXV A;  4YYU A;  4W5C A;  2FRA A;  1YVB A;  3K8U A;  1U5I A;  1MS6 A;  1PIP A;  3WXG A;  3O1G A;  3PW3 A;  1NLJ A;  1KFU L;  2AIM A;  2VFC A;  1NQC A;  3H8C A;  4P6E A;  3S3R A;  1KXR A;  2FT2 A;  1MIR A;  3ERV A;  3KSE A;  3LTW A;  3IEJ A;  3IOQ A;  4CDF B;  3KX1 A;  1AEC A;  4I05 A;  3QJ3 A;  2G8J A;  5F02 A;  1U9W A;  1KHQ A;  1SNK A;  2GHU A;  1ICF A;  4GUZ A;  4W4U A;  2F1G A;  1CS8 A;  4WA6 A;  3P5W A;  3K24 A;  3RVW A;  1HUC B;  2DZZ A;  1CQD A;  2PAD A;  2E03 A;  1GCB A;  4OEL A;  4FJC A;  1X9Y A;  2ACT A;  3BWK A;  2NQI A;  4W5B A;  3KW9 A;  4YYV A;  5EF4 A;  3KKU A;  5FPW A;  3B79 A;  2YJB A;  3OF8 A;  1F2B A;  1QOL A;  3PNR A;  1BGO A;  3V6C A;  3IHP A;  4PP1 A;  4YYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...