4QBBA

Structure of the foot-and-mouth disease virus leader proteinase in complex with inhibitor (n~2~-[(3s)-4-({(2r)-1-[(4-carbamimidamidobutyl)amino]-4-methyl-1-oxopentan-2-yl}amino)-3-hydroxy-4-oxobutanoyl]-l-arginyl-l-prolinamide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
b'MELTLYNGEKKTFYSRPNNHDNCWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leader protease
publication title Foot-and-mouth disease virus leader proteinase: Structural insights into the mechanism of intermolecular cleavage.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qbbA00
2NQDB 2YJCA 2R9CA 2G8EA 5CVOB 3H8BA 2IPPB 2AYNA 1ZCMA 4N8WA 3AI8A 2BDZA 2FUDA 1YALA 4I05A 2PADA 5CVNB 4YYVA 1KFUL 4AXMA 1CSBB 2R9NA 1CS8A 3K8UA 2FO5A 1MEMA 3LFYA 1EWOA 4KLBA 3OVZA 1PADA 1MIRA 1KHQA 2BDLA 2DZZA 3D6SA 3KSEA 1NB5A 3HD3A 1HUCB 1CTEA 3PNRA 3PW3A 1AU0A 1EWMA 1TL9A 1CQDA 2O6XA 2OP3A 3K24A 3K9MA 2AS8A 2R9MA 3TNXA 2PNSA 3CBKA 3IV2A 5JH3A 1ZIVA 3M99A 1CVZA 2F1GA 1NB3A 1F2BA 1PIPA 1U9QX 4YVAA 4HWYA 3USVA 3V6EA 4YYWA 4Q8GA 3MHHA 2G7YA 3B79A 4I07A 2VHSA 4CDFB 2B1NA 4YV8A 3NHEA 3OVXA 1K3BB 1GECE 1A6RA 1DEUA 1DF0A 1ME4A 4YYRA 1YVBA 4FK5A 1FH0A 3QT4A 2R9OA 1CB5A 3QSDA 2CIOA 4MSXA 2IBIA 4ZUXU 3E1ZB 4Q8HA 1XKGA 1BY8A 1PPDA 2DC9A 2DC7A 3I06A 3IOQA 3IEJA 3ZUAA 1YT7A 3P5WA 1BGOA 2FYEA 4BSQA 3OISA 2XU4A 3KWBX 3ERVA 3N3GA 2PREA 2FRAA 3MTNA 2JQFR 3BPFA 1PPPA 1U9XA 1PPOA 1CV8A 4W5BA 3IMAA 1PE6A 2AVWA 4DMYA 2OULA 1CPJA 3S3RA 4PADA 4X6JA 3BOWA 1THEA 2YJBA 5EF4A 4X6IA 1KHPA 4QRGA 3O1GA 3F5VA 4X6HA 2B1MA 2FT2A 1TLOA 4FJCA 4YYSA 3KWZA 1GCBA 8PCHA 1PCIA 1F2CA 3P5XA 3KW9A 4K7CA 5CHTA 3HHIA 1GLOA 1NL6A 1EWLA 4BS6A 4PP1A 2E02A 2AUXA 2XU5A 2NQAA 1EF7A 9PAPA 1AU4A 3BPMA 3QJ3A 4MZOA 2FRQA 4I04A 2CB5A 3KKUA 3C9EA 4PI3A 1Q6KA 2YJ9A 1JQPA 5J94A 2DJGB 4YYQA 5JA7A 3CBJA 1MDWA 1X9YA 4G54A 1YK7A 2DC6A 4RY2A 4MZSA 4QRXA 3H8CA 3N3KA 4N79A 2AIMA 4PP2E 7PCKA 2XU1A 4OEMA 3MORA 2Y5BA 1PXVA 1F2AA 3WXFA 3GCBA 3V6CA 1PBHA 1POPA 1NQCA 2XU3A 4CDEB 4P6GA 1AYVA 2P7UA 3RVWA 3LXSA 2Y6EA 3BC3A 4BPVA 2YJ8A 3BCNA 3P5UA 5EGWA 1AU3A 2FQ9A 1AECA 3OF8A 2DZYA 1SP4B 3H89A 3WXGA 2DJFB 1O0EA 1BQIA 1ME3A 1EWPA 4XUIA 4XR7A 1ITOA 1U9WA 4WA6A 4AXLA 2AUZA 2DCBA 1ICFA 1QXPA 2GHUA 1SNKA 2ACTA 2DCCA 1PPNA 2HD5A 1QOLA 1AYUA 3P5VA 1M6DA 2ARYA 3H7DA 4QH6A 2NQIA 3HWNA 3IUTA 2PBHA 3WXEA 4P6EA 5FPWA 4YYUA 4OELA 4DMXA 4CDCB 2ATOA 2YJ2A 2G8JA 3DF0A 1Y08A 1VJVA 2FTDA 4QBBA 3IHPA 2R9FA 2HXZA 3HHAA 5A24A 2AU1A 5F02A 1QMYA 1U9VA 2AYOA 2DC8A 1AYWA 2P0RA 3BWKA 2HH5A 2P86A 2E00A 2NQGA 5PADA 4CDDB 2DCAA 3S3QA 3PBHA 2G6DA 2WBFX 2R6NA 3OF9A 6PADA 1MHWA 3O0UA 2E03A 3PDFA 3CH2X 3KFQA 5CHVA 3MHSA 3N4CA 1VSNA 3H6SA 2JQGR 5CVMA 1NLJA 2C0YA 1KXRA 4N4ZA 2F7DA 1KFXL 2E01A 3KX1A 4CZWA 1IWDA 4FIPA 1STFE 2HHNA 3RVXA 2VHFA 1MEGA 4W5CA 1NPZA 1S4VA 4BS5A 3CH3X 2GFOA 1GMYA 2H7JA 1U5IA 3RVVA 2DCDA 2OZ2A 1TU6A 1CJLA 3F75A 5K16A 4BQVA 1F29A 4QRVA 1QDQA 1Y4HA 1ATKA 4W4UA 1AIMA 3I3TA 1AU2A 3U8EA 1YK8A 1MS6A 1BP4A
chains in the Genus database with same CATH superfamily
2NQDB 2YJCA 3TRKA 2R9CA 2G8EA 4P16A 5CVOB 3H8BA 2IPPB 3C0RA 2AYNA 1ZCMA 4N8WA 3AI8A 2BDZA 4BOSA 2FUDA 2J7QA 1YALA 4I05A 2PADA 5CVNB 4YYVA 1KFUL 4M0WA 4AXMA 1CSBB 2R9NA 1CS8A 3MP2A 3K8UA 2FO5A 2Z84A 1MEMA 3LFYA 1EWOA 4KLBA 3OVZA 1PADA 1MIRA 1KHQA 2BDLA 2DZZA 3D6SA 3KSEA 1NB5A 3HD3A 3MTVA 1HUCB 3PHXA 4GUAA 1CTEA 3PNRA 3PW3A 1AU0A 1EWMA 1TL9A 1YZBA 1CQDA 2JTCA 2O6XA 2OP3A 3K24A 3K9MA 2AS8A 2R9MA 3TNXA 3E9SA 2PNSA 3CBKA 3IV2A 5JH3A 1ZIVA 3M99A 1CVZA 2F1GA 1NB3A 1F2BA 1PIPA 4BOZA 1U9QX 4YVAA 4HWYA 3USVA 3V6EA 3MJ5A 4YYWA 4Q8GA 4RF1A 3MHHA 2G7YA 3B79A 4I07A 2VHSA 4CDFB 2B1NA 4YV8A 3NHEA 3OVXA 1K3BB 1GECE 1A6RA 1DEUA 1DF0A 1ME4A 4YYRA 1YVBA 4FK5A 4OVZA 1FH0A 3QT4A 2R9OA 1CB5A 3QSDA 2CIOA 4MSXA 2IBIA 4ZUXU 3E1ZB 4Q8HA 1XKGA 1BY8A 1PPDA 2BTWB 2DC9A 3W30A 2DC7A 5EZSA 3I06A 3IOQA 3IEJA 3ZUAA 1YT7A 3P5WA 4D8BA 1BGOA 2FYEA 4BSQA 3OISA 2XU4A 4RKXA 3KWBX 3ERVA 3N3GA 2PREA 2FRAA 3MTNA 2JQFR 3BPFA 1PPPA 1U9XA 1PPOA 1CV8A 2AGAA 4W5BA 3IMAA 3BBAA 1PE6A 2AVWA 4DMYA 2OULA 1CPJA 3S3RA 4A5UA 4PADA 4X6JA 3BOWA 1THEA 2YJBA 5EF4A 2BU3A 4D8EA 4X6IA 1KHPA 4QRGA 4R3DA 3O1GA 3F5VA 4X6HA 2B1MA 2FT2A 1TLOA 4FJCA 4YYSA 3KWZA 1GCBA 8PCHA 1PCIA 1F2CA 3B21A 3P5XA 3KW9A 4K7CA 3RNVA 5CHTA 3HHIA 1GLOA 1NL6A 1EWLA 4BS6A 4PP1A 2E02A 2AUXA 2XU5A 2NQAA 1EF7A 2HWKA 9PAPA 1AU4A 3BPMA 3QJ3A 4MZOA 2FRQA 4I04A 2CB5A 3KKUA 3C9EA 4PI3A 1Q6KA 1UKFA 2YJ9A 1JQPA 5J94A 2DJGB 4YYQA 5JA7A 3CBJA 1MDWA 1X9YA 3PT2A 4G54A 1YK7A 2DC6A 4RY2A 4MZSA 4QRXA 3H8CA 3BB7A 3N3KA 4N79A 2AIMA 4PP2E 7PCKA 2XU1A 4OEMA 3MORA 2Y5BA 1PXVA 1F2AA 3WXFA 3GCBA 3PHUA 3V6CA 1PBHA 1POPA 4ZTBA 1NQCA 2XU3A 4CDEB 4P6GA 1AYVA 2P7UA 3RVWA 3LXSA 2Y6EA 3BC3A 4BPVA 2YJ8A 3BCNA 3P5UA 5EGWA 1AU3A 2FQ9A 1AECA 3OF8A 2DZYA 1SP4B 3H89A 3WXGA 2DJFB 1O0EA 1BQIA 5KO3A 1ME3A 1EWPA 4XUIA 4XR7A 1ITOA 1U9WA 3BY4A 1DKIA 4WA6A 4BOQA 4AXLA 2AUZA 2DCBA 1ICFA 1QXPA 3OQCA 2GHUA 1SNKA 2ACTA 2DCCA 1PPNA 2HD5A 1QOLA 1AYUA 5EZQA 3P5VA 2BTWA 1M6DA 2ARYA 3H7DA 4QH6A 2NQIA 3HWNA 3IUTA 4PT5A 2PBHA 3WXEA 4P6EA 5FPWA 4YYUA 4IUMA 4OELA 4DMXA 4CDCB 2ATOA 2YJ2A 4RF0A 2DOSA 2G8JA 3DF0A 4IP3A 5E6JA 1PVJA 1Y08A 1VJVA 2FTDA 4QBBA 3IHPA 2R9FA 3PSEA 2HXZA 3HHAA 5A24A 2AU1A 5F02A 1QMYA 1U9VA 2AYOA 2DC8A 1AYWA 2P0RA 3BWKA 2HH5A 2P86A 2E00A 2NQGA 5PADA 4CDDB 2DCAA 3S3QA 2J7QC 3PBHA 2G6DA 2WBFX 4OVZB 4D8IA 2R6NA 3OF9A 6PADA 1MHWA 4MI7A 3O0UA 2E03A 3PDFA 3CH2X 3PRMA 3KFQA 2JRIA 5CHVA 3MHSA 2FE8A 4REZA 3N4CA 4HXDB 1VSNA 3H6SA 4BOUA 3O65A 5JZEA 4XZXA 2JQGR 5CVMA 1NLJA 2C0YA 1KXRA 4N4ZA 4RNAA 2F7DA 1KFXL 2E01A 3KX1A 4CZWA 1IWDA 3IFUA 4FIPA 1STFE 2HHNA 3RVXA 2VHFA 4MM3B 4OW0A 3W31A 1MEGA 4W5CA 1NPZA 3PHWA 1S4VA 4BS5A 3ZNHA 3CH3X 2GFOA 1GMYA 3PRPA 2H7JA 1U5IA 3RVVA 2DCDA 2OZ2A 4BOPA 1TU6A 1CJLA 3F75A 5K16A 3TMPA 4BQVA 1F29A 4QRVA 1QDQA 1Y4HA 2UZJA 1ATKA 4W4UA 1AIMA 4WURA 3I3TA 1AU2A 3U8EA 1YK8A 1MS6A 1BP4A
chains in the Genus database with same CATH topology
2NQDB 2YJCA 2R9CA 2G8EA 5CVOB 3H8BA 2IPPB 2AYNA 1ZCMA 4N8WA 3AI8A 2BDZA 2FUDA 1YALA 4I05A 2PADA 5CVNB 4YYVA 1KFUL 4AXMA 1CSBB 2R9NA 1CS8A 3K8UA 2FO5A 1MEMA 3LFYA 1EWOA 4KLBA 3OVZA 1PADA 1MIRA 1KHQA 2BDLA 2DZZA 3D6SA 3KSEA 1NB5A 3HD3A 3LTWA 1HUCB 1CTEA 3PNRA 3PW3A 1AU0A 1EWMA 1TL9A 1CQDA 2O6XA 2OP3A 3K24A 3K9MA 2AS8A 2R9MA 3TNXA 2PNSA 3CBKA 3IV2A 5JH3A 1ZIVA 3M99A 1CVZA 2F1GA 3D9WA 1NB3A 1F2BA 1PIPA 1U9QX 4YVAA 4HWYA 3USVA 3V6EA 4YYWA 4Q8GA 3MHHA 2G7YA 3B79A 4I07A 2VHSA 4CDFB 2B1NA 4YV8A 3NHEA 3OVXA 1K3BB 1GECE 1A6RA 1DEUA 1DF0A 1ME4A 4YYRA 1YVBA 4FK5A 1FH0A 3QT4A 2R9OA 1CB5A 3QSDA 2CIOA 4MSXA 2IBIA 4ZUXU 3E1ZB 4Q8HA 1XKGA 1BY8A 1PPDA 2DC9A 2DC7A 3I06A 3IOQA 3IEJA 3ZUAA 1YT7A 3P5WA 1BGOA 2FYEA 4BSQA 3OISA 2XU4A 3KWBX 3ERVA 3N3GA 2PREA 2FRAA 3MTNA 2JQFR 3BPFA 1PPPA 1U9XA 1PPOA 1CV8A 4W5BA 3IMAA 1PE6A 2AVWA 4DMYA 2OULA 1CPJA 3S3RA 4PADA 4X6JA 3BOWA 1THEA 2YJBA 5EF4A 4X6IA 1KHPA 4QRGA 2BSZA 3O1GA 3F5VA 4X6HA 2B1MA 2FT2A 1TLOA 4FJCA 4C5PA 1W5RA 4YYSA 2VFBA 3KWZA 1GCBA 8PCHA 1PCIA 1F2CA 3P5XA 3KW9A 4K7CA 5CHTA 3HHIA 1GLOA 1NL6A 1EWLA 4BS6A 4PP1A 2E02A 2AUXA 2XU5A 2NQAA 1EF7A 4NV7A 9PAPA 1E2TA 1AU4A 3BPMA 3QJ3A 4MZOA 2FRQA 4I04A 2CB5A 3KKUA 3C9EA 4PI3A 1Q6KA 2YJ9A 1JQPA 5J94A 2DJGB 4YYQA 5JA7A 3CBJA 1MDWA 1X9YA 4G54A 1YK7A 2DC6A 4RY2A 4MZSA 4QRXA 3H8CA 3N3KA 4N79A 2AIMA 4PP2E 7PCKA 2XU1A 4OEMA 3MORA 2Y5BA 1PXVA 1F2AA 3WXFA 3GCBA 3V6CA 1PBHA 1POPA 1NQCA 2XU3A 4CDEB 4P6GA 1AYVA 4NV8A 2P7UA 3RVWA 3LXSA 2Y6EA 4GUZA 3BC3A 4BPVA 2YJ8A 3BCNA 3P5UA 5EGWA 1AU3A 2FQ9A 1AECA 3OF8A 4BGFA 2DZYA 1SP4B 3H89A 3WXGA 2DJFB 1O0EA 1W4TA 1BQIA 1ME3A 1EWPA 4XUIA 4XR7A 1ITOA 1U9WA 2VFCA 4WA6A 4AXLA 2AUZA 2DCBA 1ICFA 1QXPA 2GHUA 1SNKA 2ACTA 2DCCA 1PPNA 2HD5A 1QOLA 1AYUA 3P5VA 1M6DA 2ARYA 3H7DA 4QH6A 2NQIA 3HWNA 3IUTA 2PBHA 1GX3A 3WXEA 4P6EA 5FPWA 4YYUA 4OELA 4DMXA 4CDCB 2ATOA 2YJ2A 2G8JA 3DF0A 1Y08A 1VJVA 2FTDA 4QBBA 3IHPA 2R9FA 2HXZA 3HHAA 5A24A 2AU1A 5F02A 1QMYA 1U9VA 2AYOA 2DC8A 1AYWA 2P0RA 3BWKA 2HH5A 2P86A 2E00A 2NQGA 5PADA 4CDDB 2DCAA 3S3QA 3PBHA 2G6DA 2WBFX 1W6FA 2R6NA 3OF9A 6PADA 1MHWA 3O0UA 2E03A 3PDFA 4B55A 3CH2X 3KFQA 5CHVA 3MHSA 3N4CA 1VSNA 3H6SA 2JQGR 5CVMA 1NLJA 2C0YA 1KXRA 4N4ZA 2F7DA 1KFXL 2E01A 3KX1A 4CZWA 1IWDA 4FIPA 1STFE 2HHNA 3RVXA 2VHFA 1MEGA 4W5CA 1NPZA 1S4VA 4BS5A 3CH3X 2GFOA 1GMYA 2H7JA 1U5IA 3RVVA 2DCDA 2OZ2A 1TU6A 1CJLA 3F75A 5K16A 4BQVA 1F29A 4QRVA 1QDQA 1Y4HA 1ATKA 4W4UA 1AIMA 3I3TA 1AU2A 3U8EA 1YK8A 1MS6A 1BP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQD B;  2YJC A;  2R9C A;  2G8E A;  5CVO B;  3H8B A;  2IPP B;  2AYN A;  1ZCM A;  4N8W A;  3AI8 A;  2BDZ A;  2FUD A;  1YAL A;  4I05 A;  2PAD A;  5CVN B;  4YYV A;  1KFU L;  4AXM A;  1CSB B;  2R9N A;  1CS8 A;  3K8U A;  2FO5 A;  1MEM A;  3LFY A;  1EWO A;  4KLB A;  3OVZ A;  1PAD A;  1MIR A;  1KHQ A;  2BDL A;  2DZZ A;  3D6S A;  3KSE A;  1NB5 A;  3HD3 A;  1HUC B;  1CTE A;  3PNR A;  3PW3 A;  1AU0 A;  1EWM A;  1TL9 A;  1CQD A;  2O6X A;  2OP3 A;  3K24 A;  3K9M A;  2AS8 A;  2R9M A;  3TNX A;  2PNS A;  3CBK A;  3IV2 A;  5JH3 A;  1ZIV A;  3M99 A;  1CVZ A;  2F1G A;  1NB3 A;  1F2B A;  1PIP A;  1U9Q X;  4YVA A;  4HWY A;  3USV A;  3V6E A;  4YYW A;  4Q8G A;  3MHH A;  2G7Y A;  3B79 A;  4I07 A;  2VHS A;  4CDF B;  2B1N A;  4YV8 A;  3NHE A;  3OVX A;  1K3B B;  1GEC E;  1A6R A;  1DEU A;  1DF0 A;  1ME4 A;  4YYR A;  1YVB A;  4FK5 A;  1FH0 A;  3QT4 A;  2R9O A;  1CB5 A;  3QSD A;  2CIO A;  4MSX A;  2IBI A;  4ZUX U;  3E1Z B;  4Q8H A;  1XKG A;  1BY8 A;  1PPD A;  2DC9 A;  2DC7 A;  3I06 A;  3IOQ A;  3IEJ A;  3ZUA A;  1YT7 A;  3P5W A;  1BGO A;  2FYE A;  4BSQ A;  3OIS A;  2XU4 A;  3KWB X;  3ERV A;  3N3G A;  2PRE A;  2FRA A;  3MTN A;  2JQF R;  3BPF A;  1PPP A;  1U9X A;  1PPO A;  1CV8 A;  4W5B A;  3IMA A;  1PE6 A;  2AVW A;  4DMY A;  2OUL A;  1CPJ A;  3S3R A;  4PAD A;  4X6J A;  3BOW A;  1THE A;  2YJB A;  5EF4 A;  4X6I A;  1KHP A;  4QRG A;  3O1G A;  3F5V A;  4X6H A;  2B1M A;  2FT2 A;  1TLO A;  4FJC A;  4YYS A;  3KWZ A;  1GCB A;  8PCH A;  1PCI A;  1F2C A;  3P5X A;  3KW9 A;  4K7C A;  5CHT A;  3HHI A;  1GLO A;  1NL6 A;  1EWL A;  4BS6 A;  4PP1 A;  2E02 A;  2AUX A;  2XU5 A;  2NQA A;  1EF7 A;  9PAP A;  1AU4 A;  3BPM A;  3QJ3 A;  4MZO A;  2FRQ A;  4I04 A;  2CB5 A;  3KKU A;  3C9E A;  4PI3 A;  1Q6K A;  2YJ9 A;  1JQP A;  5J94 A;  2DJG B;  4YYQ A;  5JA7 A;  3CBJ A;  1MDW A;  1X9Y A;  4G54 A;  1YK7 A;  2DC6 A;  4RY2 A;  4MZS A;  4QRX A;  3H8C A;  3N3K A;  4N79 A;  2AIM A;  4PP2 E;  7PCK A;  2XU1 A;  4OEM A;  3MOR A;  2Y5B A;  1PXV A;  1F2A A;  3WXF A;  3GCB A;  3V6C A;  1PBH A;  1POP A;  1NQC A;  2XU3 A;  4CDE B;  4P6G A;  1AYV A;  2P7U A;  3RVW A;  3LXS A;  2Y6E A;  3BC3 A;  4BPV A;  2YJ8 A;  3BCN A;  3P5U A;  5EGW A;  1AU3 A;  2FQ9 A;  1AEC A;  3OF8 A;  2DZY A;  1SP4 B;  3H89 A;  3WXG A;  2DJF B;  1O0E A;  1BQI A;  1ME3 A;  1EWP A;  4XUI A;  4XR7 A;  1ITO A;  1U9W A;  4WA6 A;  4AXL A;  2AUZ A;  2DCB A;  1ICF A;  1QXP A;  2GHU A;  1SNK A;  2ACT A;  2DCC A;  1PPN A;  2HD5 A;  1QOL A;  1AYU A;  3P5V A;  1M6D A;  2ARY A;  3H7D A;  4QH6 A;  2NQI A;  3HWN A;  3IUT A;  2PBH A;  3WXE A;  4P6E A;  5FPW A;  4YYU A;  4OEL A;  4DMX A;  4CDC B;  2ATO A;  2YJ2 A;  2G8J A;  3DF0 A;  1Y08 A;  1VJV A;  2FTD A;  4QBB A;  3IHP A;  2R9F A;  2HXZ A;  3HHA A;  5A24 A;  2AU1 A;  5F02 A;  1QMY A;  1U9V A;  2AYO A;  2DC8 A;  1AYW A;  2P0R A;  3BWK A;  2HH5 A;  2P86 A;  2E00 A;  2NQG A;  5PAD A;  4CDD B;  2DCA A;  3S3Q A;  3PBH A;  2G6D A;  2WBF X;  2R6N A;  3OF9 A;  6PAD A;  1MHW A;  3O0U A;  2E03 A;  3PDF A;  3CH2 X;  3KFQ A;  5CHV A;  3MHS A;  3N4C A;  1VSN A;  3H6S A;  2JQG R;  5CVM A;  1NLJ A;  2C0Y A;  1KXR A;  4N4Z A;  2F7D A;  1KFX L;  2E01 A;  3KX1 A;  4CZW A;  1IWD A;  4FIP A;  1STF E;  2HHN A;  3RVX A;  2VHF A;  1MEG A;  4W5C A;  1NPZ A;  1S4V A;  4BS5 A;  3CH3 X;  2GFO A;  1GMY A;  2H7J A;  1U5I A;  3RVV A;  2DCD A;  2OZ2 A;  1TU6 A;  1CJL A;  3F75 A;  5K16 A;  4BQV A;  1F29 A;  4QRV A;  1QDQ A;  1Y4H A;  1ATK A;  4W4U A;  1AIM A;  3I3T A;  1AU2 A;  3U8E A;  1YK8 A;  1MS6 A;  1BP4 A; 
#chains in the Genus database with same CATH topology
 2NQD B;  2YJC A;  3TRK A;  2R9C A;  2G8E A;  4P16 A;  5CVO B;  3H8B A;  2IPP B;  3C0R A;  2AYN A;  1ZCM A;  4N8W A;  3AI8 A;  2BDZ A;  4BOS A;  2FUD A;  2J7Q A;  1YAL A;  4I05 A;  2PAD A;  5CVN B;  4YYV A;  1KFU L;  4M0W A;  4AXM A;  1CSB B;  2R9N A;  1CS8 A;  3MP2 A;  3K8U A;  2FO5 A;  2Z84 A;  1MEM A;  3LFY A;  1EWO A;  4KLB A;  3OVZ A;  1PAD A;  1MIR A;  1KHQ A;  2BDL A;  2DZZ A;  3D6S A;  3KSE A;  1NB5 A;  3HD3 A;  3MTV A;  1HUC B;  3PHX A;  4GUA A;  1CTE A;  3PNR A;  3PW3 A;  1AU0 A;  1EWM A;  1TL9 A;  1YZB A;  1CQD A;  2JTC A;  2O6X A;  2OP3 A;  3K24 A;  3K9M A;  2AS8 A;  2R9M A;  3TNX A;  3E9S A;  2PNS A;  3CBK A;  3IV2 A;  5JH3 A;  1ZIV A;  3M99 A;  1CVZ A;  2F1G A;  1NB3 A;  1F2B A;  1PIP A;  4BOZ A;  1U9Q X;  4YVA A;  4HWY A;  3USV A;  3V6E A;  3MJ5 A;  4YYW A;  4Q8G A;  4RF1 A;  3MHH A;  2G7Y A;  3B79 A;  4I07 A;  2VHS A;  4CDF B;  2B1N A;  4YV8 A;  3NHE A;  3OVX A;  1K3B B;  1GEC E;  1A6R A;  1DEU A;  1DF0 A;  1ME4 A;  4YYR A;  1YVB A;  4FK5 A;  4OVZ A;  1FH0 A;  3QT4 A;  2R9O A;  1CB5 A;  3QSD A;  2CIO A;  4MSX A;  2IBI A;  4ZUX U;  3E1Z B;  4Q8H A;  1XKG A;  1BY8 A;  1PPD A;  2BTW B;  2DC9 A;  3W30 A;  2DC7 A;  5EZS A;  3I06 A;  3IOQ A;  3IEJ A;  3ZUA A;  1YT7 A;  3P5W A;  4D8B A;  1BGO A;  2FYE A;  4BSQ A;  3OIS A;  2XU4 A;  4RKX A;  3KWB X;  3ERV A;  3N3G A;  2PRE A;  2FRA A;  3MTN A;  2JQF R;  3BPF A;  1PPP A;  1U9X A;  1PPO A;  1CV8 A;  2AGA A;  4W5B A;  3IMA A;  3BBA A;  1PE6 A;  2AVW A;  4DMY A;  2OUL A;  1CPJ A;  3S3R A;  4A5U A;  4PAD A;  4X6J A;  3BOW A;  1THE A;  2YJB A;  5EF4 A;  2BU3 A;  4D8E A;  4X6I A;  1KHP A;  4QRG A;  4R3D A;  3O1G A;  3F5V A;  4X6H A;  2B1M A;  2FT2 A;  1TLO A;  4FJC A;  4YYS A;  3KWZ A;  1GCB A;  8PCH A;  1PCI A;  1F2C A;  3B21 A;  3P5X A;  3KW9 A;  4K7C A;  3RNV A;  5CHT A;  3HHI A;  1GLO A;  1NL6 A;  1EWL A;  4BS6 A;  4PP1 A;  2E02 A;  2AUX A;  2XU5 A;  2NQA A;  1EF7 A;  2HWK A;  9PAP A;  1AU4 A;  3BPM A;  3QJ3 A;  4MZO A;  2FRQ A;  4I04 A;  2CB5 A;  3KKU A;  3C9E A;  4PI3 A;  1Q6K A;  1UKF A;  2YJ9 A;  1JQP A;  5J94 A;  2DJG B;  4YYQ A;  5JA7 A;  3CBJ A;  1MDW A;  1X9Y A;  3PT2 A;  4G54 A;  1YK7 A;  2DC6 A;  4RY2 A;  4MZS A;  4QRX A;  3H8C A;  3BB7 A;  3N3K A;  4N79 A;  2AIM A;  4PP2 E;  7PCK A;  2XU1 A;  4OEM A;  3MOR A;  2Y5B A;  1PXV A;  1F2A A;  3WXF A;  3GCB A;  3PHU A;  3V6C A;  1PBH A;  1POP A;  4ZTB A;  1NQC A;  2XU3 A;  4CDE B;  4P6G A;  1AYV A;  2P7U A;  3RVW A;  3LXS A;  2Y6E A;  3BC3 A;  4BPV A;  2YJ8 A;  3BCN A;  3P5U A;  5EGW A;  1AU3 A;  2FQ9 A;  1AEC A;  3OF8 A;  2DZY A;  1SP4 B;  3H89 A;  3WXG A;  2DJF B;  1O0E A;  1BQI A;  5KO3 A;  1ME3 A;  1EWP A;  4XUI A;  4XR7 A;  1ITO A;  1U9W A;  3BY4 A;  1DKI A;  4WA6 A;  4BOQ A;  4AXL A;  2AUZ A;  2DCB A;  1ICF A;  1QXP A;  3OQC A;  2GHU A;  1SNK A;  2ACT A;  2DCC A;  1PPN A;  2HD5 A;  1QOL A;  1AYU A;  5EZQ A;  3P5V A;  2BTW A;  1M6D A;  2ARY A;  3H7D A;  4QH6 A;  2NQI A;  3HWN A;  3IUT A;  4PT5 A;  2PBH A;  3WXE A;  4P6E A;  5FPW A;  4YYU A;  4IUM A;  4OEL A;  4DMX A;  4CDC B;  2ATO A;  2YJ2 A;  4RF0 A;  2DOS A;  2G8J A;  3DF0 A;  4IP3 A;  5E6J A;  1PVJ A;  1Y08 A;  1VJV A;  2FTD A;  4QBB A;  3IHP A;  2R9F A;  3PSE A;  2HXZ A;  3HHA A;  5A24 A;  2AU1 A;  5F02 A;  1QMY A;  1U9V A;  2AYO A;  2DC8 A;  1AYW A;  2P0R A;  3BWK A;  2HH5 A;  2P86 A;  2E00 A;  2NQG A;  5PAD A;  4CDD B;  2DCA A;  3S3Q A;  2J7Q C;  3PBH A;  2G6D A;  2WBF X;  4OVZ B;  4D8I A;  2R6N A;  3OF9 A;  6PAD A;  1MHW A;  4MI7 A;  3O0U A;  2E03 A;  3PDF A;  3CH2 X;  3PRM A;  3KFQ A;  2JRI A;  5CHV A;  3MHS A;  2FE8 A;  4REZ A;  3N4C A;  4HXD B;  1VSN A;  3H6S A;  4BOU A;  3O65 A;  5JZE A;  4XZX A;  2JQG R;  5CVM A;  1NLJ A;  2C0Y A;  1KXR A;  4N4Z A;  4RNA A;  2F7D A;  1KFX L;  2E01 A;  3KX1 A;  4CZW A;  1IWD A;  3IFU A;  4FIP A;  1STF E;  2HHN A;  3RVX A;  2VHF A;  4MM3 B;  4OW0 A;  3W31 A;  1MEG A;  4W5C A;  1NPZ A;  3PHW A;  1S4V A;  4BS5 A;  3ZNH A;  3CH3 X;  2GFO A;  1GMY A;  3PRP A;  2H7J A;  1U5I A;  3RVV A;  2DCD A;  2OZ2 A;  4BOP A;  1TU6 A;  1CJL A;  3F75 A;  5K16 A;  3TMP A;  4BQV A;  1F29 A;  4QRV A;  1QDQ A;  1Y4H A;  2UZJ A;  1ATK A;  4W4U A;  1AIM A;  4WUR A;  3I3T A;  1AU2 A;  3U8E A;  1YK8 A;  1MS6 A;  1BP4 A; 
#chains in the Genus database with same CATH homology
 2NQD B;  2YJC A;  2R9C A;  2G8E A;  5CVO B;  3H8B A;  2IPP B;  2AYN A;  1ZCM A;  4N8W A;  3AI8 A;  2BDZ A;  2FUD A;  1YAL A;  4I05 A;  2PAD A;  5CVN B;  4YYV A;  1KFU L;  4AXM A;  1CSB B;  2R9N A;  1CS8 A;  3K8U A;  2FO5 A;  1MEM A;  3LFY A;  1EWO A;  4KLB A;  3OVZ A;  1PAD A;  1MIR A;  1KHQ A;  2BDL A;  2DZZ A;  3D6S A;  3KSE A;  1NB5 A;  3HD3 A;  3LTW A;  1HUC B;  1CTE A;  3PNR A;  3PW3 A;  1AU0 A;  1EWM A;  1TL9 A;  1CQD A;  2O6X A;  2OP3 A;  3K24 A;  3K9M A;  2AS8 A;  2R9M A;  3TNX A;  2PNS A;  3CBK A;  3IV2 A;  5JH3 A;  1ZIV A;  3M99 A;  1CVZ A;  2F1G A;  3D9W A;  1NB3 A;  1F2B A;  1PIP A;  1U9Q X;  4YVA A;  4HWY A;  3USV A;  3V6E A;  4YYW A;  4Q8G A;  3MHH A;  2G7Y A;  3B79 A;  4I07 A;  2VHS A;  4CDF B;  2B1N A;  4YV8 A;  3NHE A;  3OVX A;  1K3B B;  1GEC E;  1A6R A;  1DEU A;  1DF0 A;  1ME4 A;  4YYR A;  1YVB A;  4FK5 A;  1FH0 A;  3QT4 A;  2R9O A;  1CB5 A;  3QSD A;  2CIO A;  4MSX A;  2IBI A;  4ZUX U;  3E1Z B;  4Q8H A;  1XKG A;  1BY8 A;  1PPD A;  2DC9 A;  2DC7 A;  3I06 A;  3IOQ A;  3IEJ A;  3ZUA A;  1YT7 A;  3P5W A;  1BGO A;  2FYE A;  4BSQ A;  3OIS A;  2XU4 A;  3KWB X;  3ERV A;  3N3G A;  2PRE A;  2FRA A;  3MTN A;  2JQF R;  3BPF A;  1PPP A;  1U9X A;  1PPO A;  1CV8 A;  4W5B A;  3IMA A;  1PE6 A;  2AVW A;  4DMY A;  2OUL A;  1CPJ A;  3S3R A;  4PAD A;  4X6J A;  3BOW A;  1THE A;  2YJB A;  5EF4 A;  4X6I A;  1KHP A;  4QRG A;  2BSZ A;  3O1G A;  3F5V A;  4X6H A;  2B1M A;  2FT2 A;  1TLO A;  4FJC A;  4C5P A;  1W5R A;  4YYS A;  2VFB A;  3KWZ A;  1GCB A;  8PCH A;  1PCI A;  1F2C A;  3P5X A;  3KW9 A;  4K7C A;  5CHT A;  3HHI A;  1GLO A;  1NL6 A;  1EWL A;  4BS6 A;  4PP1 A;  2E02 A;  2AUX A;  2XU5 A;  2NQA A;  1EF7 A;  4NV7 A;  9PAP A;  1E2T A;  1AU4 A;  3BPM A;  3QJ3 A;  4MZO A;  2FRQ A;  4I04 A;  2CB5 A;  3KKU A;  3C9E A;  4PI3 A;  1Q6K A;  2YJ9 A;  1JQP A;  5J94 A;  2DJG B;  4YYQ A;  5JA7 A;  3CBJ A;  1MDW A;  1X9Y A;  4G54 A;  1YK7 A;  2DC6 A;  4RY2 A;  4MZS A;  4QRX A;  3H8C A;  3N3K A;  4N79 A;  2AIM A;  4PP2 E;  7PCK A;  2XU1 A;  4OEM A;  3MOR A;  2Y5B A;  1PXV A;  1F2A A;  3WXF A;  3GCB A;  3V6C A;  1PBH A;  1POP A;  1NQC A;  2XU3 A;  4CDE B;  4P6G A;  1AYV A;  4NV8 A;  2P7U A;  3RVW A;  3LXS A;  2Y6E A;  4GUZ A;  3BC3 A;  4BPV A;  2YJ8 A;  3BCN A;  3P5U A;  5EGW A;  1AU3 A;  2FQ9 A;  1AEC A;  3OF8 A;  4BGF A;  2DZY A;  1SP4 B;  3H89 A;  3WXG A;  2DJF B;  1O0E A;  1W4T A;  1BQI A;  1ME3 A;  1EWP A;  4XUI A;  4XR7 A;  1ITO A;  1U9W A;  2VFC A;  4WA6 A;  4AXL A;  2AUZ A;  2DCB A;  1ICF A;  1QXP A;  2GHU A;  1SNK A;  2ACT A;  2DCC A;  1PPN A;  2HD5 A;  1QOL A;  1AYU A;  3P5V A;  1M6D A;  2ARY A;  3H7D A;  4QH6 A;  2NQI A;  3HWN A;  3IUT A;  2PBH A;  1GX3 A;  3WXE A;  4P6E A;  5FPW A;  4YYU A;  4OEL A;  4DMX A;  4CDC B;  2ATO A;  2YJ2 A;  2G8J A;  3DF0 A;  1Y08 A;  1VJV A;  2FTD A;  4QBB A;  3IHP A;  2R9F A;  2HXZ A;  3HHA A;  5A24 A;  2AU1 A;  5F02 A;  1QMY A;  1U9V A;  2AYO A;  2DC8 A;  1AYW A;  2P0R A;  3BWK A;  2HH5 A;  2P86 A;  2E00 A;  2NQG A;  5PAD A;  4CDD B;  2DCA A;  3S3Q A;  3PBH A;  2G6D A;  2WBF X;  1W6F A;  2R6N A;  3OF9 A;  6PAD A;  1MHW A;  3O0U A;  2E03 A;  3PDF A;  4B55 A;  3CH2 X;  3KFQ A;  5CHV A;  3MHS A;  3N4C A;  1VSN A;  3H6S A;  2JQG R;  5CVM A;  1NLJ A;  2C0Y A;  1KXR A;  4N4Z A;  2F7D A;  1KFX L;  2E01 A;  3KX1 A;  4CZW A;  1IWD A;  4FIP A;  1STF E;  2HHN A;  3RVX A;  2VHF A;  1MEG A;  4W5C A;  1NPZ A;  1S4V A;  4BS5 A;  3CH3 X;  2GFO A;  1GMY A;  2H7J A;  1U5I A;  3RVV A;  2DCD A;  2OZ2 A;  1TU6 A;  1CJL A;  3F75 A;  5K16 A;  4BQV A;  1F29 A;  4QRV A;  1QDQ A;  1Y4H A;  1ATK A;  4W4U A;  1AIM A;  3I3T A;  1AU2 A;  3U8E A;  1YK8 A;  1MS6 A;  1BP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...