4QBBA

Structure of the foot-and-mouth disease virus leader proteinase in complex with inhibitor (n~2~-[(3s)-4-({(2r)-1-[(4-carbamimidamidobutyl)amino]-4-methyl-1-oxopentan-2-yl}amino)-3-hydroxy-4-oxobutanoyl]-l-arginyl-l-prolinamide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNCWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Leader protease
publication title Foot-and-mouth disease virus leader proteinase: Structural insights into the mechanism of intermolecular cleavage.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
total genus 41
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qbbA00
1PIPA 1U9VA 4QRGA 4P6GA 4X6JA 2DCDA 1SNKA 4FK5A 1NPZA 3KX1A 1BP4A 4PP1A 4BS6A 3V6EA 1TLOA 5EF4A 2NQIA 2ATOA 4N4ZA 3HHIA 3QJ3A 1QOLA 3IOQA 2DCAA 1EF7A 2NQAA 2OULA 3DF0A 3S3QA 4K7CA 2DC7A 1F2BA 2FQ9A 3P5XA 4CDEB 3LXSA 1KFUL 4ZUXU 1PPOA 1ZIVA 1AU0A 2DCBA 3OF9A 1M6DA 1QXPA 1PADA 3OISA 2DZYA 3PDFA 1KHPA 2FRAA 4YYUA 1CQDA 3F5VA 3ERVA 2DJFB 3IV2A 2DZZA 4BS5A 2E00A 4XUIA 2HH5A 3M99A 4I05A 2YJ8A 1PXVA 2G8JA 2NQDB 3K9MA 2AIMA 1AYWA 4BQVA 3H8BA 1ITOA 3E1ZB 1GMYA 4PI3A 3MHSA 1CV8A 2FT2A 1U9XA 1CVZA 1ME3A 3O1GA 2DC6A 5CVOB 1PE6A 1U9WA 3P5UA 3K8UA 1XKGA 1CPJA 5K16A 3LFYA 4N79A 2G7YA 4N8WA 2NQGA 3BPMA 4CZWA 3O0UA 1KFXL 2JQFR 2GFOA 1MEMA 1EWLA 3V6CA 5CVMA 3MTNA 4MSXA 4DMYA 1F2CA 1YT7A 2R9CA 2XU3A 4BSQA 2F7DA 4Q8GA 1U5IA 2FTDA 4AXLA 1VSNA 3P5VA 4CDFB 1AYUA 1MHWA 2YJBA 1Y4HA 2DJGB 4YV8A 4PP2E 3USVA 4W4UA 3H6SA 3N3GA 4YYWA 1O0EA 5J94A 2AVWA 1CB5A 1CSBB 1PCIA 3IHPA 2AUXA 1YK8A 1DF0A 2XU5A 4OEMA 4W5BA 1YALA 3HHAA 1JQPA 2E02A 2HD5A 3OF8A 2OP3A 2YJ2A 3KW9A 3S3RA 2G6DA 1ICFA 2AYOA 4I04A 1PPDA 2YJ9A 1ZCMA 1SP4B 1U9QX 1F2AA 2FYEA 1Q6KA 4AXMA 1BGOA 1AIMA 1YK7A 2P7UA 1AU3A 2IPPB 3PNRA 3ZUAA 1EWOA 4RY2A 3QSDA 4X6IA 2YJCA 1GECE 3AI8A 3WXEA 2AU1A 2FO5A 3BC3A 1CJLA 1MEGA 2VHSA 2PNSA 3OVXA 3RVXA 4YYRA 2BDLA 3C9EA 4G54A 4CDCB 4XR7A 4HWYA 1YVBA 2C0YA 1KXRA 2R6NA 2WBFX 2HXZA 4W5CA 2H7JA 3KWBX 3WXFA 3MHHA 3NHEA 4YYVA 3CH2X 2R9MA 1NQCA 2DC8A 3QT4A 4DMXA 2ACTA 5A24A 3KSEA 3P5WA 1EWPA 2XU4A 3GCBA 1THEA 3N4CA 1EWMA 3I06A 2DC9A 3RVVA 1AYVA 3BPFA 2HHNA 1STFE 1K3BB 1AECA 2B1MA 5CVNB 1BY8A 3MORA 4YYSA 2R9NA 2Y5BA 3BCNA 2P86A 3RVWA 2OZ2A 1VJVA 1ME4A 4KLBA 3IUTA 5F02A 2AS8A 4BPVA 1CTEA 3IMAA 3CBJA 4MZSA 4QH6A 3PW3A 4QRVA 1MS6A 1CS8A 3H89A 3CH3X 1PPNA 5FPWA 2PBHA 3CBKA 2XU1A 1PPPA 1AU2A 3PBHA 4WA6A 2E03A 4QBBA 1IWDA 1Y08A 4X6HA 2P0RA 3F75A 1TU6A 7PCKA 5CHVA 2FUDA 4YYQA 2R9FA 3KFQA 3KWZA 1GLOA 2CIOA 4FJCA 1NLJA 2AYNA 1MIRA 3D6SA 5JH3A 1FH0A 2VHFA 1POPA 1AU4A 1X9YA 4PADA 3BOWA 6PADA 5CHTA 2GHUA 1BQIA 1S4VA 3K24A 1ATKA 2F1GA 3B79A 2CB5A 2Y6EA 1KHQA 1A6RA 2AUZA 2DCCA 2PADA 3H8CA 3IEJA 8PCHA 1QDQA 2JQGR 4QRXA 9PAPA 1MDWA 2ARYA 1PBHA 2E01A 4OELA 3HWNA 2G8EA 1NB3A 1HUCB 3I3TA 1F29A 4Q8HA 1DEUA 3TNXA 1NB5A 3H7DA 2PREA 3OVZA 3KKUA 3N3KA 3WXGA 4P6EA 2FRQA 5EGWA 5JA7A 1GCBA 1QMYA 2O6XA 1TL9A 3HD3A 4I07A 2IBIA 5PADA 3U8EA 2B1NA 4YVAA 1NL6A 4CDDB 2BDZA 4MZOA 3BWKA 4FIPA 2R9OA
chains in the Genus database with same CATH superfamily
2AGAA 1PIPA 1U9VA 4QRGA 4P6GA 4X6JA 2DCDA 1SNKA 4FK5A 1NPZA 4IP3A 3KX1A 1BP4A 4PP1A 4BS6A 3V6EA 1TLOA 5EF4A 2NQIA 2ATOA 4N4ZA 4RNAA 3HHIA 4OW0A 3QJ3A 1QOLA 4D8BA 3IOQA 2DCAA 3BY4A 1EF7A 3PHUA 2NQAA 2OULA 3C0RA 3DF0A 3S3QA 4K7CA 2DC7A 3MTVA 1F2BA 2FQ9A 3P5XA 4CDEB 1DKIA 3LXSA 1KFUL 4ZUXU 1PPOA 1ZIVA 5JZEA 4D8EA 1AU0A 4D8IA 2DCBA 3OF9A 1M6DA 1QXPA 1PADA 3TRKA 4OVZB 3OISA 2DZYA 3PDFA 1KHPA 4OVZA 2FRAA 4YYUA 1CQDA 3F5VA 3ERVA 2DJFB 3IV2A 2DZZA 2BTWB 4BS5A 5E6JA 2E00A 3TMPA 4XUIA 2HH5A 3M99A 3BBAA 4I05A 2YJ8A 1PXVA 2G8JA 2NQDB 3K9MA 2AIMA 1AYWA 4BQVA 3H8BA 1ITOA 1UKFA 3E1ZB 1GMYA 4PI3A 3MHSA 1CV8A 2FT2A 1U9XA 1CVZA 1ME3A 3O1GA 2DC6A 5CVOB 1PE6A 1U9WA 3P5UA 3K8UA 1XKGA 1CPJA 5K16A 3LFYA 4N79A 2G7YA 4N8WA 2HWKA 2NQGA 3BPMA 4CZWA 3E9SA 3O0UA 1KFXL 2JQFR 2GFOA 3PRPA 1MEMA 1EWLA 1YZBA 3V6CA 5CVMA 3MJ5A 3MTNA 4MSXA 4DMYA 1F2CA 1YT7A 2R9CA 2XU3A 4BSQA 2F7DA 4Q8GA 2JRIA 1U5IA 2FTDA 4AXLA 4RF0A 1VSNA 3P5VA 4CDFB 1AYUA 2J7QA 1MHWA 2YJBA 1Y4HA 2BU3A 2DJGB 4YV8A 4PP2E 3USVA 4IUMA 4W4UA 3H6SA 3N3GA 4YYWA 1O0EA 4ZTBA 5J94A 2AVWA 1CB5A 1CSBB 4M0WA 1PCIA 3W31A 4MM3B 2UZJA 3IHPA 2AUXA 1YK8A 1DF0A 2XU5A 4OEMA 4W5BA 1YALA 4RF1A 3HHAA 1JQPA 2E02A 2HD5A 3OF8A 2OP3A 2YJ2A 3KW9A 3S3RA 3PHWA 4BOZA 2G6DA 1ICFA 2AYOA 4I04A 1PPDA 2YJ9A 1ZCMA 1SP4B 1U9QX 3PRMA 1F2AA 2FYEA 4REZA 1Q6KA 4AXMA 1BGOA 1AIMA 1YK7A 2P7UA 4XZXA 1AU3A 2IPPB 3PNRA 3ZUAA 1EWOA 4RY2A 2BTWA 3QSDA 4X6IA 2YJCA 1GECE 3AI8A 2DOSA 2AU1A 2FO5A 3BC3A 3WXEA 1PVJA 1CJLA 4P16A 1MEGA 2VHSA 2PNSA 3OVXA 3RVXA 4YYRA 2BDLA 3C9EA 4G54A 4CDCB 4XR7A 4HWYA 1YVBA 2C0YA 4RKXA 1KXRA 2R6NA 2WBFX 2HXZA 4W5CA 2H7JA 4PT5A 3KWBX 3WXFA 2J7QC 3MHHA 3NHEA 4YYVA 3CH2X 4WURA 2R9MA 1NQCA 2DC8A 2Z84A 3QT4A 2JTCA 4BOSA 4DMXA 2ACTA 5A24A 3KSEA 4MI7A 3P5WA 1EWPA 2XU4A 3GCBA 1THEA 4R3DA 3N4CA 1EWMA 3I06A 2DC9A 2FE8A 3RVVA 1AYVA 3BPFA 2HHNA 1STFE 3PT2A 1K3BB 1AECA 2B1MA 3BB7A 5CVNB 1BY8A 3MORA 4YYSA 2R9NA 2Y5BA 3BCNA 2P86A 3RVWA 2OZ2A 1VJVA 1ME4A 4KLBA 3IUTA 5F02A 2AS8A 4BPVA 1CTEA 3IMAA 3CBJA 4MZSA 4QH6A 3PW3A 4QRVA 1MS6A 1CS8A 3H89A 3CH3X 1PPNA 5FPWA 2PBHA 3CBKA 2XU1A 1PPPA 1AU2A 5EZQA 3PBHA 4WA6A 2E03A 4QBBA 1IWDA 1Y08A 3B21A 4X6HA 2P0RA 3F75A 1TU6A 7PCKA 5CHVA 2FUDA 4YYQA 2R9FA 3KFQA 3KWZA 1GLOA 2CIOA 3MP2A 4FJCA 1NLJA 2AYNA 1MIRA 3D6SA 5JH3A 1FH0A 2VHFA 3PHXA 1POPA 1AU4A 1X9YA 4PADA 3BOWA 6PADA 5CHTA 2GHUA 1BQIA 1S4VA 3K24A 1ATKA 2F1GA 3B79A 5EZSA 4A5UA 2CB5A 2Y6EA 1KHQA 1A6RA 2AUZA 2DCCA 2PADA 3O65A 3H8CA 3IEJA 8PCHA 1QDQA 2JQGR 4QRXA 9PAPA 1MDWA 2ARYA 1PBHA 2E01A 5KO3A 4OELA 3HWNA 3OQCA 2G8EA 1NB3A 1HUCB 3I3TA 1F29A 3IFUA 4Q8HA 4BOPA 1DEUA 4BOUA 3TNXA 1NB5A 3ZNHA 3RNVA 3H7DA 2PREA 3W30A 3OVZA 3KKUA 3N3KA 3WXGA 4GUAA 4P6EA 2FRQA 5EGWA 5JA7A 1GCBA 1QMYA 2O6XA 1TL9A 3HD3A 4I07A 2IBIA 5PADA 3U8EA 2B1NA 4YVAA 1NL6A 4CDDB 2BDZA 3PSEA 4MZOA 4BOQA 4HXDB 3BWKA 4FIPA 2R9OA
chains in the Genus database with same CATH topology
1PIPA 1U9VA 4QRGA 4P6GA 4X6JA 2DCDA 1SNKA 4FK5A 1NPZA 3KX1A 1BP4A 4PP1A 4BS6A 3V6EA 1TLOA 5EF4A 2NQIA 2ATOA 4N4ZA 3HHIA 4NV7A 3QJ3A 1QOLA 3IOQA 2DCAA 1EF7A 2NQAA 2OULA 3DF0A 3S3QA 4K7CA 2DC7A 1F2BA 2FQ9A 3P5XA 4CDEB 3LXSA 1KFUL 4ZUXU 1PPOA 1ZIVA 1AU0A 2DCBA 3OF9A 1M6DA 1QXPA 1PADA 3OISA 2DZYA 3PDFA 1KHPA 2FRAA 4YYUA 1CQDA 3F5VA 3ERVA 2DJFB 3IV2A 2DZZA 4BS5A 2E00A 4XUIA 2HH5A 3M99A 4I05A 2YJ8A 1PXVA 2G8JA 2NQDB 3K9MA 2AIMA 1AYWA 4BQVA 3H8BA 1ITOA 3E1ZB 1GMYA 4PI3A 3MHSA 1CV8A 2FT2A 1U9XA 1CVZA 1ME3A 3O1GA 2DC6A 5CVOB 1PE6A 1U9WA 3P5UA 3K8UA 1XKGA 1CPJA 5K16A 3LFYA 4N79A 2G7YA 4N8WA 2NQGA 3BPMA 4CZWA 3O0UA 1KFXL 2JQFR 1GX3A 2GFOA 1MEMA 1EWLA 3V6CA 5CVMA 3MTNA 4MSXA 4DMYA 1F2CA 1YT7A 2R9CA 2XU3A 4BSQA 2F7DA 4Q8GA 1U5IA 2FTDA 4AXLA 1E2TA 1VSNA 3P5VA 4CDFB 1AYUA 1MHWA 2YJBA 1Y4HA 2DJGB 4YV8A 4PP2E 3USVA 4W4UA 3H6SA 3N3GA 4YYWA 1O0EA 5J94A 2AVWA 1CB5A 1CSBB 1PCIA 3IHPA 2AUXA 1YK8A 1DF0A 2XU5A 4OEMA 4W5BA 1YALA 3HHAA 1JQPA 2E02A 2HD5A 3OF8A 2OP3A 2YJ2A 3KW9A 3S3RA 2G6DA 3D9WA 1ICFA 2AYOA 4I04A 1PPDA 2YJ9A 1ZCMA 1SP4B 1U9QX 1F2AA 2FYEA 1Q6KA 4AXMA 1BGOA 1AIMA 1YK7A 2P7UA 1AU3A 2IPPB 3PNRA 3ZUAA 1EWOA 4RY2A 3QSDA 4X6IA 2YJCA 1GECE 3AI8A 3WXEA 2AU1A 2FO5A 2VFCA 3BC3A 1CJLA 1MEGA 2VHSA 2PNSA 3OVXA 3RVXA 4YYRA 2BDLA 3C9EA 4G54A 4CDCB 4XR7A 4HWYA 1YVBA 2C0YA 1KXRA 2R6NA 2WBFX 2HXZA 4W5CA 2H7JA 3KWBX 3WXFA 3MHHA 3NHEA 4YYVA 3CH2X 2R9MA 1NQCA 2DC8A 3QT4A 4DMXA 4B55A 2ACTA 5A24A 3KSEA 3P5WA 1EWPA 2XU4A 3GCBA 1THEA 3N4CA 1EWMA 3I06A 2DC9A 3RVVA 1AYVA 3BPFA 2HHNA 2VFBA 1STFE 1K3BB 1AECA 2B1MA 3LTWA 5CVNB 1BY8A 3MORA 4YYSA 2R9NA 2Y5BA 3BCNA 2P86A 3RVWA 2OZ2A 1VJVA 1ME4A 4KLBA 3IUTA 5F02A 2AS8A 4BPVA 1CTEA 3IMAA 3CBJA 4MZSA 4QH6A 3PW3A 4BGFA 4QRVA 1MS6A 1CS8A 3H89A 3CH3X 1PPNA 5FPWA 2PBHA 3CBKA 2XU1A 1PPPA 1AU2A 3PBHA 4WA6A 2E03A 4QBBA 1IWDA 1Y08A 4X6HA 2P0RA 3F75A 1TU6A 7PCKA 5CHVA 2FUDA 4YYQA 2R9FA 3KFQA 3KWZA 1GLOA 2CIOA 4FJCA 1NLJA 2AYNA 1MIRA 3D6SA 5JH3A 1FH0A 2VHFA 1W5RA 1POPA 1AU4A 1X9YA 4PADA 1W6FA 3BOWA 6PADA 5CHTA 2GHUA 1BQIA 1S4VA 3K24A 1ATKA 2F1GA 3B79A 2CB5A 2Y6EA 1KHQA 1A6RA 2AUZA 2BSZA 2DCCA 2PADA 3H8CA 3IEJA 8PCHA 1QDQA 2JQGR 4QRXA 9PAPA 1MDWA 2ARYA 1PBHA 2E01A 4OELA 1W4TA 3HWNA 4GUZA 2G8EA 1NB3A 1HUCB 3I3TA 1F29A 4Q8HA 1DEUA 3TNXA 1NB5A 3H7DA 2PREA 4C5PA 3OVZA 3KKUA 3N3KA 3WXGA 4P6EA 2FRQA 5EGWA 5JA7A 1GCBA 1QMYA 2O6XA 1TL9A 3HD3A 4I07A 2IBIA 5PADA 3U8EA 2B1NA 4YVAA 1NL6A 4CDDB 2BDZA 4MZOA 3BWKA 4FIPA 2R9OA 4NV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIP A;  1U9V A;  4QRG A;  4P6G A;  4X6J A;  2DCD A;  1SNK A;  4FK5 A;  1NPZ A;  3KX1 A;  1BP4 A;  4PP1 A;  4BS6 A;  3V6E A;  1TLO A;  5EF4 A;  2NQI A;  2ATO A;  4N4Z A;  3HHI A;  3QJ3 A;  1QOL A;  3IOQ A;  2DCA A;  1EF7 A;  2NQA A;  2OUL A;  3DF0 A;  3S3Q A;  4K7C A;  2DC7 A;  1F2B A;  2FQ9 A;  3P5X A;  4CDE B;  3LXS A;  1KFU L;  4ZUX U;  1PPO A;  1ZIV A;  1AU0 A;  2DCB A;  3OF9 A;  1M6D A;  1QXP A;  1PAD A;  3OIS A;  2DZY A;  3PDF A;  1KHP A;  2FRA A;  4YYU A;  1CQD A;  3F5V A;  3ERV A;  2DJF B;  3IV2 A;  2DZZ A;  4BS5 A;  2E00 A;  4XUI A;  2HH5 A;  3M99 A;  4I05 A;  2YJ8 A;  1PXV A;  2G8J A;  2NQD B;  3K9M A;  2AIM A;  1AYW A;  4BQV A;  3H8B A;  1ITO A;  3E1Z B;  1GMY A;  4PI3 A;  3MHS A;  1CV8 A;  2FT2 A;  1U9X A;  1CVZ A;  1ME3 A;  3O1G A;  2DC6 A;  5CVO B;  1PE6 A;  1U9W A;  3P5U A;  3K8U A;  1XKG A;  1CPJ A;  5K16 A;  3LFY A;  4N79 A;  2G7Y A;  4N8W A;  2NQG A;  3BPM A;  4CZW A;  3O0U A;  1KFX L;  2JQF R;  2GFO A;  1MEM A;  1EWL A;  3V6C A;  5CVM A;  3MTN A;  4MSX A;  4DMY A;  1F2C A;  1YT7 A;  2R9C A;  2XU3 A;  4BSQ A;  2F7D A;  4Q8G A;  1U5I A;  2FTD A;  4AXL A;  1VSN A;  3P5V A;  4CDF B;  1AYU A;  1MHW A;  2YJB A;  1Y4H A;  2DJG B;  4YV8 A;  4PP2 E;  3USV A;  4W4U A;  3H6S A;  3N3G A;  4YYW A;  1O0E A;  5J94 A;  2AVW A;  1CB5 A;  1CSB B;  1PCI A;  3IHP A;  2AUX A;  1YK8 A;  1DF0 A;  2XU5 A;  4OEM A;  4W5B A;  1YAL A;  3HHA A;  1JQP A;  2E02 A;  2HD5 A;  3OF8 A;  2OP3 A;  2YJ2 A;  3KW9 A;  3S3R A;  2G6D A;  1ICF A;  2AYO A;  4I04 A;  1PPD A;  2YJ9 A;  1ZCM A;  1SP4 B;  1U9Q X;  1F2A A;  2FYE A;  1Q6K A;  4AXM A;  1BGO A;  1AIM A;  1YK7 A;  2P7U A;  1AU3 A;  2IPP B;  3PNR A;  3ZUA A;  1EWO A;  4RY2 A;  3QSD A;  4X6I A;  2YJC A;  1GEC E;  3AI8 A;  3WXE A;  2AU1 A;  2FO5 A;  3BC3 A;  1CJL A;  1MEG A;  2VHS A;  2PNS A;  3OVX A;  3RVX A;  4YYR A;  2BDL A;  3C9E A;  4G54 A;  4CDC B;  4XR7 A;  4HWY A;  1YVB A;  2C0Y A;  1KXR A;  2R6N A;  2WBF X;  2HXZ A;  4W5C A;  2H7J A;  3KWB X;  3WXF A;  3MHH A;  3NHE A;  4YYV A;  3CH2 X;  2R9M A;  1NQC A;  2DC8 A;  3QT4 A;  4DMX A;  2ACT A;  5A24 A;  3KSE A;  3P5W A;  1EWP A;  2XU4 A;  3GCB A;  1THE A;  3N4C A;  1EWM A;  3I06 A;  2DC9 A;  3RVV A;  1AYV A;  3BPF A;  2HHN A;  1STF E;  1K3B B;  1AEC A;  2B1M A;  5CVN B;  1BY8 A;  3MOR A;  4YYS A;  2R9N A;  2Y5B A;  3BCN A;  2P86 A;  3RVW A;  2OZ2 A;  1VJV A;  1ME4 A;  4KLB A;  3IUT A;  5F02 A;  2AS8 A;  4BPV A;  1CTE A;  3IMA A;  3CBJ A;  4MZS A;  4QH6 A;  3PW3 A;  4QRV A;  1MS6 A;  1CS8 A;  3H89 A;  3CH3 X;  1PPN A;  5FPW A;  2PBH A;  3CBK A;  2XU1 A;  1PPP A;  1AU2 A;  3PBH A;  4WA6 A;  2E03 A;  4QBB A;  1IWD A;  1Y08 A;  4X6H A;  2P0R A;  3F75 A;  1TU6 A;  7PCK A;  5CHV A;  2FUD A;  4YYQ A;  2R9F A;  3KFQ A;  3KWZ A;  1GLO A;  2CIO A;  4FJC A;  1NLJ A;  2AYN A;  1MIR A;  3D6S A;  5JH3 A;  1FH0 A;  2VHF A;  1POP A;  1AU4 A;  1X9Y A;  4PAD A;  3BOW A;  6PAD A;  5CHT A;  2GHU A;  1BQI A;  1S4V A;  3K24 A;  1ATK A;  2F1G A;  3B79 A;  2CB5 A;  2Y6E A;  1KHQ A;  1A6R A;  2AUZ A;  2DCC A;  2PAD A;  3H8C A;  3IEJ A;  8PCH A;  1QDQ A;  2JQG R;  4QRX A;  9PAP A;  1MDW A;  2ARY A;  1PBH A;  2E01 A;  4OEL A;  3HWN A;  2G8E A;  1NB3 A;  1HUC B;  3I3T A;  1F29 A;  4Q8H A;  1DEU A;  3TNX A;  1NB5 A;  3H7D A;  2PRE A;  3OVZ A;  3KKU A;  3N3K A;  3WXG A;  4P6E A;  2FRQ A;  5EGW A;  5JA7 A;  1GCB A;  1QMY A;  2O6X A;  1TL9 A;  3HD3 A;  4I07 A;  2IBI A;  5PAD A;  3U8E A;  2B1N A;  4YVA A;  1NL6 A;  4CDD B;  2BDZ A;  4MZO A;  3BWK A;  4FIP A;  2R9O A; 
#chains in the Genus database with same CATH topology
 2AGA A;  1PIP A;  1U9V A;  4QRG A;  4P6G A;  4X6J A;  2DCD A;  1SNK A;  4FK5 A;  1NPZ A;  4IP3 A;  3KX1 A;  1BP4 A;  4PP1 A;  4BS6 A;  3V6E A;  1TLO A;  5EF4 A;  2NQI A;  2ATO A;  4N4Z A;  4RNA A;  3HHI A;  4OW0 A;  3QJ3 A;  1QOL A;  4D8B A;  3IOQ A;  2DCA A;  3BY4 A;  1EF7 A;  3PHU A;  2NQA A;  2OUL A;  3C0R A;  3DF0 A;  3S3Q A;  4K7C A;  2DC7 A;  3MTV A;  1F2B A;  2FQ9 A;  3P5X A;  4CDE B;  1DKI A;  3LXS A;  1KFU L;  4ZUX U;  1PPO A;  1ZIV A;  5JZE A;  4D8E A;  1AU0 A;  4D8I A;  2DCB A;  3OF9 A;  1M6D A;  1QXP A;  1PAD A;  3TRK A;  4OVZ B;  3OIS A;  2DZY A;  3PDF A;  1KHP A;  4OVZ A;  2FRA A;  4YYU A;  1CQD A;  3F5V A;  3ERV A;  2DJF B;  3IV2 A;  2DZZ A;  2BTW B;  4BS5 A;  5E6J A;  2E00 A;  3TMP A;  4XUI A;  2HH5 A;  3M99 A;  3BBA A;  4I05 A;  2YJ8 A;  1PXV A;  2G8J A;  2NQD B;  3K9M A;  2AIM A;  1AYW A;  4BQV A;  3H8B A;  1ITO A;  1UKF A;  3E1Z B;  1GMY A;  4PI3 A;  3MHS A;  1CV8 A;  2FT2 A;  1U9X A;  1CVZ A;  1ME3 A;  3O1G A;  2DC6 A;  5CVO B;  1PE6 A;  1U9W A;  3P5U A;  3K8U A;  1XKG A;  1CPJ A;  5K16 A;  3LFY A;  4N79 A;  2G7Y A;  4N8W A;  2HWK A;  2NQG A;  3BPM A;  4CZW A;  3E9S A;  3O0U A;  1KFX L;  2JQF R;  2GFO A;  3PRP A;  1MEM A;  1EWL A;  1YZB A;  3V6C A;  5CVM A;  3MJ5 A;  3MTN A;  4MSX A;  4DMY A;  1F2C A;  1YT7 A;  2R9C A;  2XU3 A;  4BSQ A;  2F7D A;  4Q8G A;  2JRI A;  1U5I A;  2FTD A;  4AXL A;  4RF0 A;  1VSN A;  3P5V A;  4CDF B;  1AYU A;  2J7Q A;  1MHW A;  2YJB A;  1Y4H A;  2BU3 A;  2DJG B;  4YV8 A;  4PP2 E;  3USV A;  4IUM A;  4W4U A;  3H6S A;  3N3G A;  4YYW A;  1O0E A;  4ZTB A;  5J94 A;  2AVW A;  1CB5 A;  1CSB B;  4M0W A;  1PCI A;  3W31 A;  4MM3 B;  2UZJ A;  3IHP A;  2AUX A;  1YK8 A;  1DF0 A;  2XU5 A;  4OEM A;  4W5B A;  1YAL A;  4RF1 A;  3HHA A;  1JQP A;  2E02 A;  2HD5 A;  3OF8 A;  2OP3 A;  2YJ2 A;  3KW9 A;  3S3R A;  3PHW A;  4BOZ A;  2G6D A;  1ICF A;  2AYO A;  4I04 A;  1PPD A;  2YJ9 A;  1ZCM A;  1SP4 B;  1U9Q X;  3PRM A;  1F2A A;  2FYE A;  4REZ A;  1Q6K A;  4AXM A;  1BGO A;  1AIM A;  1YK7 A;  2P7U A;  4XZX A;  1AU3 A;  2IPP B;  3PNR A;  3ZUA A;  1EWO A;  4RY2 A;  2BTW A;  3QSD A;  4X6I A;  2YJC A;  1GEC E;  3AI8 A;  2DOS A;  2AU1 A;  2FO5 A;  3BC3 A;  3WXE A;  1PVJ A;  1CJL A;  4P16 A;  1MEG A;  2VHS A;  2PNS A;  3OVX A;  3RVX A;  4YYR A;  2BDL A;  3C9E A;  4G54 A;  4CDC B;  4XR7 A;  4HWY A;  1YVB A;  2C0Y A;  4RKX A;  1KXR A;  2R6N A;  2WBF X;  2HXZ A;  4W5C A;  2H7J A;  4PT5 A;  3KWB X;  3WXF A;  2J7Q C;  3MHH A;  3NHE A;  4YYV A;  3CH2 X;  4WUR A;  2R9M A;  1NQC A;  2DC8 A;  2Z84 A;  3QT4 A;  2JTC A;  4BOS A;  4DMX A;  2ACT A;  5A24 A;  3KSE A;  4MI7 A;  3P5W A;  1EWP A;  2XU4 A;  3GCB A;  1THE A;  4R3D A;  3N4C A;  1EWM A;  3I06 A;  2DC9 A;  2FE8 A;  3RVV A;  1AYV A;  3BPF A;  2HHN A;  1STF E;  3PT2 A;  1K3B B;  1AEC A;  2B1M A;  3BB7 A;  5CVN B;  1BY8 A;  3MOR A;  4YYS A;  2R9N A;  2Y5B A;  3BCN A;  2P86 A;  3RVW A;  2OZ2 A;  1VJV A;  1ME4 A;  4KLB A;  3IUT A;  5F02 A;  2AS8 A;  4BPV A;  1CTE A;  3IMA A;  3CBJ A;  4MZS A;  4QH6 A;  3PW3 A;  4QRV A;  1MS6 A;  1CS8 A;  3H89 A;  3CH3 X;  1PPN A;  5FPW A;  2PBH A;  3CBK A;  2XU1 A;  1PPP A;  1AU2 A;  5EZQ A;  3PBH A;  4WA6 A;  2E03 A;  4QBB A;  1IWD A;  1Y08 A;  3B21 A;  4X6H A;  2P0R A;  3F75 A;  1TU6 A;  7PCK A;  5CHV A;  2FUD A;  4YYQ A;  2R9F A;  3KFQ A;  3KWZ A;  1GLO A;  2CIO A;  3MP2 A;  4FJC A;  1NLJ A;  2AYN A;  1MIR A;  3D6S A;  5JH3 A;  1FH0 A;  2VHF A;  3PHX A;  1POP A;  1AU4 A;  1X9Y A;  4PAD A;  3BOW A;  6PAD A;  5CHT A;  2GHU A;  1BQI A;  1S4V A;  3K24 A;  1ATK A;  2F1G A;  3B79 A;  5EZS A;  4A5U A;  2CB5 A;  2Y6E A;  1KHQ A;  1A6R A;  2AUZ A;  2DCC A;  2PAD A;  3O65 A;  3H8C A;  3IEJ A;  8PCH A;  1QDQ A;  2JQG R;  4QRX A;  9PAP A;  1MDW A;  2ARY A;  1PBH A;  2E01 A;  5KO3 A;  4OEL A;  3HWN A;  3OQC A;  2G8E A;  1NB3 A;  1HUC B;  3I3T A;  1F29 A;  3IFU A;  4Q8H A;  4BOP A;  1DEU A;  4BOU A;  3TNX A;  1NB5 A;  3ZNH A;  3RNV A;  3H7D A;  2PRE A;  3W30 A;  3OVZ A;  3KKU A;  3N3K A;  3WXG A;  4GUA A;  4P6E A;  2FRQ A;  5EGW A;  5JA7 A;  1GCB A;  1QMY A;  2O6X A;  1TL9 A;  3HD3 A;  4I07 A;  2IBI A;  5PAD A;  3U8E A;  2B1N A;  4YVA A;  1NL6 A;  4CDD B;  2BDZ A;  3PSE A;  4MZO A;  4BOQ A;  4HXD B;  3BWK A;  4FIP A;  2R9O A; 
#chains in the Genus database with same CATH homology
 1PIP A;  1U9V A;  4QRG A;  4P6G A;  4X6J A;  2DCD A;  1SNK A;  4FK5 A;  1NPZ A;  3KX1 A;  1BP4 A;  4PP1 A;  4BS6 A;  3V6E A;  1TLO A;  5EF4 A;  2NQI A;  2ATO A;  4N4Z A;  3HHI A;  4NV7 A;  3QJ3 A;  1QOL A;  3IOQ A;  2DCA A;  1EF7 A;  2NQA A;  2OUL A;  3DF0 A;  3S3Q A;  4K7C A;  2DC7 A;  1F2B A;  2FQ9 A;  3P5X A;  4CDE B;  3LXS A;  1KFU L;  4ZUX U;  1PPO A;  1ZIV A;  1AU0 A;  2DCB A;  3OF9 A;  1M6D A;  1QXP A;  1PAD A;  3OIS A;  2DZY A;  3PDF A;  1KHP A;  2FRA A;  4YYU A;  1CQD A;  3F5V A;  3ERV A;  2DJF B;  3IV2 A;  2DZZ A;  4BS5 A;  2E00 A;  4XUI A;  2HH5 A;  3M99 A;  4I05 A;  2YJ8 A;  1PXV A;  2G8J A;  2NQD B;  3K9M A;  2AIM A;  1AYW A;  4BQV A;  3H8B A;  1ITO A;  3E1Z B;  1GMY A;  4PI3 A;  3MHS A;  1CV8 A;  2FT2 A;  1U9X A;  1CVZ A;  1ME3 A;  3O1G A;  2DC6 A;  5CVO B;  1PE6 A;  1U9W A;  3P5U A;  3K8U A;  1XKG A;  1CPJ A;  5K16 A;  3LFY A;  4N79 A;  2G7Y A;  4N8W A;  2NQG A;  3BPM A;  4CZW A;  3O0U A;  1KFX L;  2JQF R;  1GX3 A;  2GFO A;  1MEM A;  1EWL A;  3V6C A;  5CVM A;  3MTN A;  4MSX A;  4DMY A;  1F2C A;  1YT7 A;  2R9C A;  2XU3 A;  4BSQ A;  2F7D A;  4Q8G A;  1U5I A;  2FTD A;  4AXL A;  1E2T A;  1VSN A;  3P5V A;  4CDF B;  1AYU A;  1MHW A;  2YJB A;  1Y4H A;  2DJG B;  4YV8 A;  4PP2 E;  3USV A;  4W4U A;  3H6S A;  3N3G A;  4YYW A;  1O0E A;  5J94 A;  2AVW A;  1CB5 A;  1CSB B;  1PCI A;  3IHP A;  2AUX A;  1YK8 A;  1DF0 A;  2XU5 A;  4OEM A;  4W5B A;  1YAL A;  3HHA A;  1JQP A;  2E02 A;  2HD5 A;  3OF8 A;  2OP3 A;  2YJ2 A;  3KW9 A;  3S3R A;  2G6D A;  3D9W A;  1ICF A;  2AYO A;  4I04 A;  1PPD A;  2YJ9 A;  1ZCM A;  1SP4 B;  1U9Q X;  1F2A A;  2FYE A;  1Q6K A;  4AXM A;  1BGO A;  1AIM A;  1YK7 A;  2P7U A;  1AU3 A;  2IPP B;  3PNR A;  3ZUA A;  1EWO A;  4RY2 A;  3QSD A;  4X6I A;  2YJC A;  1GEC E;  3AI8 A;  3WXE A;  2AU1 A;  2FO5 A;  2VFC A;  3BC3 A;  1CJL A;  1MEG A;  2VHS A;  2PNS A;  3OVX A;  3RVX A;  4YYR A;  2BDL A;  3C9E A;  4G54 A;  4CDC B;  4XR7 A;  4HWY A;  1YVB A;  2C0Y A;  1KXR A;  2R6N A;  2WBF X;  2HXZ A;  4W5C A;  2H7J A;  3KWB X;  3WXF A;  3MHH A;  3NHE A;  4YYV A;  3CH2 X;  2R9M A;  1NQC A;  2DC8 A;  3QT4 A;  4DMX A;  4B55 A;  2ACT A;  5A24 A;  3KSE A;  3P5W A;  1EWP A;  2XU4 A;  3GCB A;  1THE A;  3N4C A;  1EWM A;  3I06 A;  2DC9 A;  3RVV A;  1AYV A;  3BPF A;  2HHN A;  2VFB A;  1STF E;  1K3B B;  1AEC A;  2B1M A;  3LTW A;  5CVN B;  1BY8 A;  3MOR A;  4YYS A;  2R9N A;  2Y5B A;  3BCN A;  2P86 A;  3RVW A;  2OZ2 A;  1VJV A;  1ME4 A;  4KLB A;  3IUT A;  5F02 A;  2AS8 A;  4BPV A;  1CTE A;  3IMA A;  3CBJ A;  4MZS A;  4QH6 A;  3PW3 A;  4BGF A;  4QRV A;  1MS6 A;  1CS8 A;  3H89 A;  3CH3 X;  1PPN A;  5FPW A;  2PBH A;  3CBK A;  2XU1 A;  1PPP A;  1AU2 A;  3PBH A;  4WA6 A;  2E03 A;  4QBB A;  1IWD A;  1Y08 A;  4X6H A;  2P0R A;  3F75 A;  1TU6 A;  7PCK A;  5CHV A;  2FUD A;  4YYQ A;  2R9F A;  3KFQ A;  3KWZ A;  1GLO A;  2CIO A;  4FJC A;  1NLJ A;  2AYN A;  1MIR A;  3D6S A;  5JH3 A;  1FH0 A;  2VHF A;  1W5R A;  1POP A;  1AU4 A;  1X9Y A;  4PAD A;  1W6F A;  3BOW A;  6PAD A;  5CHT A;  2GHU A;  1BQI A;  1S4V A;  3K24 A;  1ATK A;  2F1G A;  3B79 A;  2CB5 A;  2Y6E A;  1KHQ A;  1A6R A;  2AUZ A;  2BSZ A;  2DCC A;  2PAD A;  3H8C A;  3IEJ A;  8PCH A;  1QDQ A;  2JQG R;  4QRX A;  9PAP A;  1MDW A;  2ARY A;  1PBH A;  2E01 A;  4OEL A;  1W4T A;  3HWN A;  4GUZ A;  2G8E A;  1NB3 A;  1HUC B;  3I3T A;  1F29 A;  4Q8H A;  1DEU A;  3TNX A;  1NB5 A;  3H7D A;  2PRE A;  4C5P A;  3OVZ A;  3KKU A;  3N3K A;  3WXG A;  4P6E A;  2FRQ A;  5EGW A;  5JA7 A;  1GCB A;  1QMY A;  2O6X A;  1TL9 A;  3HD3 A;  4I07 A;  2IBI A;  5PAD A;  3U8E A;  2B1N A;  4YVA A;  1NL6 A;  4CDD B;  2BDZ A;  4MZO A;  3BWK A;  4FIP A;  2R9O A;  4NV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...