1PPNA

Structure of monoclinic papain at 1.60 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(sulfhydryl proteinase)
molecule keywords PAPAIN
publication title Structure of Monoclinic Papain at 1.60 Angstroms Resolution
pubmed rcsb
source organism Carica papaya
total genus 70
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1991-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppnA00
3BOWA 5K16A 3OVZA 2HH5A 1YK8A 4XUIA 1S4VA 5JH3A 1DF0A 2YJCA 3I06A 5CVNB 2DC6A 2AYOA 1CS8A 2P86A 4CZWA 4N8WA 3P5WA 2NQGA 4FK5A 3C9EA 3PW3A 1NLJA 1CPJA 3D6SA 4YV8A 3I3TA 2E03A 2R9MA 4K7CA 2FQ9A 1F2BA 1KXRA 1DEUA 2VHFA 4Q8GA 4PI3A 1TU6A 2B1NA 2FRQA 1BY8A 3BCNA 2JQGR 2Y5BA 1GCBA 1KHQA 4YVAA 1PPPA 2YJ2A 1POPA 3K8UA 2DCAA 5CVOB 1QOLA 3H6SA 2FYEA 1TL9A 2AUXA 3CH3X 2JQFR 2AS8A 3IHPA 1U9VA 1GLOA 6PADA 3MHHA 2DCBA 2F7DA 3KFQA 3N3GA 3RVWA 1FH0A 5CHTA 3S3RA 3E1ZB 1MEMA 4QRGA 4QH6A 4X6IA 2B1MA 2DC9A 4I07A 4MZOA 2OZ2A 3RVXA 1EF7A 1KFUL 5PADA 3PBHA 1EWOA 3M99A 4YYUA 1AIMA 2R6NA 3DF0A 1NPZA 3OISA 3OF8A 1GMYA 2AU1A 1ATKA 4YYVA 1SP4B 1AYWA 5F02A 5CHVA 2YJ8A 3NHEA 3O1GA 2G8JA 1Y08A 2ACTA 2DJGB 4BQVA 1IWDA 3WXEA 1KHPA 2PNSA 3KKUA 4PADA 4QBBA 2DCCA 1QMYA 3IEJA 3HWNA 4WA6A 3HHIA 2G7YA 4AXLA 2E02A 1EWMA 2XU4A 4DMYA 5A24A 2HD5A 2HXZA 2FT2A 4YYSA 3KWBX 3H8BA 2F1GA 2YJ9A 3KX1A 4N4ZA 3P5VA 3QJ3A 4OEMA 1YVBA 4BPVA 2R9NA 4X6HA 3HD3A 2ARYA 1X9YA 1ME4A 3O0UA 4CDEB 1AU3A 2GHUA 1ITOA 3IMAA 4RY2A 1K3BB 1U9WA 2VHSA 1PE6A 4AXMA 1ZIVA 2ATOA 1NL6A 3IUTA 2E00A 1CJLA 3H89A 3MTNA 7PCKA 1PPDA 3CBKA 3P5UA 3CBJA 3K24A 2PBHA 1U9QX 1PXVA 2DC7A 2DCDA 3ERVA 4MZSA 2R9CA 1NB5A 2R9FA 1BGOA 4P6EA 2BDZA 3CH2X 3K9MA 2YJBA 3B79A 1GECE 4YYRA 4W5CA 4PP1A 2O6XA 2AVWA 4P6GA 3TNXA 2WBFX 1O0EA 1YALA 1YK7A 3GCBA 3PDFA 2AYNA 3IOQA 1F29A 1Q6KA 3H7DA 1CV8A 2GFOA 1M6DA 2FRAA 1ME3A 2FUDA 2NQAA 4YYQA 1CTEA 3HHAA 4DMXA 1F2CA 3F75A 3P5XA 2R9OA 3U8EA 3V6EA 1KFXL 2AUZA 3QSDA 4X6JA 3PNRA 2XU5A 4QRVA 5J94A 3OF9A 2NQIA 3LFYA 5CVMA 1BP4A 3KW9A 4CDCB 2G8EA 4HWYA 4ZUXU 1MS6A 3N3KA 2OP3A 1XKGA 1BQIA 1CQDA 1YT7A 4KLBA 4W5BA 3BPFA 2BDLA 3IV2A 1QXPA 3USVA 1AU2A 2IBIA 1AECA 2CB5A 1PADA 3ZUAA 2XU1A 2G6DA 4YYWA 2FO5A 1A6RA 1VSNA 2IPPB 1AU4A 4Q8HA 3V6CA 1AYVA 1HUCB 4BSQA 2DC8A 3QT4A 1MDWA 2H7JA 1PPNA 4W4UA 4BS6A 1ICFA 3BWKA 2DZZA 1PCIA 2AIMA 2XU3A 1Y4HA 1TLOA 4FIPA 3OVXA 2C0YA 5JA7A 2NQDB 1JQPA 4OELA 3S3QA 3WXFA 1MHWA 1AYUA 1EWPA 1NB3A 4CDDB 1U5IA 1PPOA 1U9XA 1QDQA 2FTDA 2P0RA 4BS5A 4N79A 1AU0A 2DZYA 4G54A 2Y6EA 3F5VA 1NQCA 3LXSA 3WXGA 1F2AA 1STFE 2OULA 3KSEA 2PADA 2E01A 4PP2E 4QRXA 1MIRA 3AI8A 3N4CA 3BPMA 1CVZA 3BC3A 5EGWA 2DJFB 3MORA 1ZCMA 1PBHA 1THEA 3KWZA 1SNKA 4I05A 1MEGA 8PCHA 1CB5A 1PIPA 2CIOA 4CDFB 4FJCA 3MHSA 2PREA 1VJVA 4XR7A 1CSBB 5EF4A 4MSXA 3RVVA 1EWLA 9PAPA 3H8CA 5FPWA 2HHNA 4I04A 2P7UA
chains in the Genus database with same CATH superfamily
3BOWA 3MP2A 5K16A 3OVZA 2HH5A 1YK8A 4XUIA 1S4VA 5JH3A 1DF0A 2YJCA 3I06A 5CVNB 2DC6A 2AYOA 1CS8A 2P86A 4CZWA 4N8WA 3P5WA 2NQGA 3BY4A 4FK5A 3C9EA 3PW3A 1NLJA 1CPJA 3D6SA 4YV8A 3I3TA 2E03A 5E6JA 2R9MA 4K7CA 2FQ9A 3ZNHA 1F2BA 1KXRA 1DEUA 2VHFA 4Q8GA 4PI3A 1TU6A 2B1NA 2FRQA 4REZA 1BY8A 3BCNA 2HWKA 2JQGR 2Y5BA 1GCBA 1KHQA 4RNAA 4MM3B 4YVAA 3PSEA 1PPPA 2YJ2A 1POPA 3K8UA 5KO3A 2DCAA 3PT2A 5CVOB 1QOLA 4OVZA 3H6SA 3PHUA 2FYEA 1TL9A 2AUXA 3CH3X 2JQFR 2AS8A 3IHPA 1U9VA 1GLOA 6PADA 3MHHA 2DCBA 2F7DA 3KFQA 3N3GA 3RVWA 1FH0A 5CHTA 3S3RA 3E1ZB 1MEMA 4QRGA 4QH6A 4X6IA 2B1MA 2DC9A 4M0WA 4BOPA 4I07A 4MZOA 2OZ2A 3RVXA 1EF7A 1KFUL 5PADA 3PBHA 1EWOA 3M99A 4YYUA 1AIMA 2R6NA 3DF0A 1NPZA 2BTWA 3OISA 3OF8A 1GMYA 2AU1A 1ATKA 4YYVA 1SP4B 1AYWA 5F02A 5CHVA 3W31A 2YJ8A 3NHEA 3O65A 3O1GA 2G8JA 1Y08A 2ACTA 2DJGB 4BQVA 4IP3A 1IWDA 3WXEA 1KHPA 2PNSA 3KKUA 4PADA 4QBBA 2DCCA 1QMYA 4D8EA 3IEJA 3HWNA 4WA6A 3HHIA 2G7YA 3MJ5A 4AXLA 2E02A 4R3DA 1EWMA 4BOZA 1DKIA 2XU4A 4DMYA 5A24A 2HD5A 2HXZA 2FT2A 4OVZB 4YYSA 3KWBX 3H8BA 2F1GA 2YJ9A 3TRKA 3KX1A 3BBAA 4N4ZA 4RKXA 3P5VA 3QJ3A 4OEMA 1YVBA 4BPVA 4OW0A 2R9NA 4X6HA 3HD3A 1UKFA 2ARYA 1X9YA 1ME4A 3PHXA 3O0UA 2J7QA 4CDEB 1AU3A 2GHUA 1ITOA 3IMAA 4RY2A 1K3BB 1U9WA 2VHSA 1PE6A 4AXMA 1ZIVA 4PT5A 2ATOA 1NL6A 3IUTA 1PVJA 2E00A 1CJLA 3H89A 3MTNA 7PCKA 1PPDA 3IFUA 3CBKA 3P5UA 2BTWB 3CBJA 4RF0A 3K24A 2PBHA 5EZSA 1U9QX 1PXVA 2DC7A 2DCDA 3ERVA 4MZSA 4BOQA 2JRIA 2R9CA 1NB5A 2R9FA 1YZBA 1BGOA 4P6EA 2BDZA 3CH2X 4RF1A 3K9MA 2YJBA 3B79A 1GECE 3PRMA 4YYRA 4W5CA 4D8BA 4PP1A 4BOSA 2O6XA 2AVWA 4P6GA 3TNXA 4BOUA 2WBFX 1O0EA 1YALA 1YK7A 3GCBA 3PDFA 2AYNA 3IOQA 1F29A 1Q6KA 3H7DA 1CV8A 2GFOA 1M6DA 2FRAA 1ME3A 2FUDA 3C0RA 2NQAA 4YYQA 1CTEA 3HHAA 4DMXA 1F2CA 3F75A 3P5XA 2R9OA 2DOSA 3U8EA 3V6EA 1KFXL 2J7QC 2AUZA 3QSDA 4ZTBA 4D8IA 3B21A 4X6JA 3W30A 3PNRA 3PHWA 2XU5A 4QRVA 5J94A 3OF9A 2NQIA 3LFYA 5CVMA 1BP4A 3KW9A 3BB7A 4CDCB 2G8EA 4HWYA 4ZUXU 5EZQA 1MS6A 3N3KA 2OP3A 4WURA 1XKGA 1BQIA 1CQDA 1YT7A 3MTVA 4KLBA 4W5BA 3BPFA 2UZJA 2BDLA 3IV2A 1QXPA 4A5UA 3USVA 1AU2A 2IBIA 3PRPA 1AECA 2CB5A 1PADA 3ZUAA 2XU1A 2G6DA 2AGAA 4YYWA 2FO5A 1A6RA 1VSNA 4HXDB 4MI7A 2IPPB 4IUMA 1AU4A 4Q8HA 3V6CA 1AYVA 1HUCB 4BSQA 2DC8A 3QT4A 1MDWA 2H7JA 1PPNA 4W4UA 4BS6A 1ICFA 3BWKA 2DZZA 1PCIA 2AIMA 2XU3A 1Y4HA 1TLOA 4FIPA 2Z84A 3OVXA 2C0YA 5JA7A 2NQDB 5JZEA 1JQPA 4OELA 3S3QA 3WXFA 1MHWA 1AYUA 1EWPA 1NB3A 4CDDB 1U5IA 3RNVA 1PPOA 1U9XA 1QDQA 2FTDA 2P0RA 4BS5A 4N79A 1AU0A 2DZYA 4G54A 2Y6EA 3F5VA 2FE8A 4XZXA 1NQCA 3LXSA 2BU3A 4GUAA 3WXGA 1F2AA 1STFE 3TMPA 2OULA 3KSEA 2PADA 2E01A 4PP2E 3E9SA 4QRXA 1MIRA 3AI8A 3N4CA 3BPMA 1CVZA 3BC3A 5EGWA 2DJFB 3MORA 1ZCMA 1PBHA 1THEA 3KWZA 1SNKA 4I05A 1MEGA 8PCHA 1CB5A 4P16A 2JTCA 1PIPA 2CIOA 3OQCA 4CDFB 4FJCA 3MHSA 2PREA 1VJVA 4XR7A 1CSBB 5EF4A 4MSXA 3RVVA 1EWLA 9PAPA 3H8CA 5FPWA 2HHNA 4I04A 2P7UA
chains in the Genus database with same CATH topology
3BOWA 5K16A 3OVZA 4NV7A 2HH5A 1YK8A 4B55A 4XUIA 1S4VA 5JH3A 1DF0A 2YJCA 2BSZA 3I06A 5CVNB 2DC6A 2AYOA 1CS8A 2P86A 4CZWA 4N8WA 3P5WA 2NQGA 3LTWA 4FK5A 3C9EA 3PW3A 1NLJA 1CPJA 3D6SA 4YV8A 3I3TA 2E03A 2R9MA 4K7CA 2FQ9A 1F2BA 1KXRA 1DEUA 2VHFA 4Q8GA 4PI3A 1TU6A 2B1NA 2FRQA 1BY8A 3BCNA 2JQGR 2Y5BA 1GCBA 1KHQA 4YVAA 1PPPA 2YJ2A 1POPA 3K8UA 2DCAA 5CVOB 1QOLA 3H6SA 2FYEA 1TL9A 2AUXA 3CH3X 2JQFR 2AS8A 3IHPA 1U9VA 3D9WA 1GLOA 6PADA 3MHHA 2DCBA 2F7DA 3KFQA 3N3GA 3RVWA 1FH0A 5CHTA 3S3RA 3E1ZB 1MEMA 4QRGA 1W6FA 4QH6A 1GX3A 4X6IA 2B1MA 2DC9A 4I07A 4MZOA 2OZ2A 3RVXA 1EF7A 1KFUL 5PADA 3PBHA 1EWOA 3M99A 4YYUA 1AIMA 2R6NA 3DF0A 1NPZA 3OISA 1E2TA 3OF8A 1GMYA 2AU1A 1ATKA 2VFCA 4YYVA 1SP4B 1AYWA 5F02A 5CHVA 1W4TA 2YJ8A 3NHEA 3O1GA 2G8JA 1Y08A 2ACTA 2DJGB 4BQVA 1IWDA 3WXEA 1KHPA 2PNSA 3KKUA 4PADA 4QBBA 2DCCA 1QMYA 3IEJA 3HWNA 4WA6A 3HHIA 2G7YA 4AXLA 2E02A 1EWMA 2XU4A 4DMYA 5A24A 2HD5A 2HXZA 2FT2A 4YYSA 3KWBX 3H8BA 2F1GA 2YJ9A 3KX1A 4N4ZA 3P5VA 3QJ3A 4OEMA 1YVBA 2VFBA 4BPVA 2R9NA 4X6HA 3HD3A 2ARYA 1X9YA 1ME4A 3O0UA 4CDEB 1AU3A 2GHUA 1ITOA 3IMAA 4RY2A 1K3BB 1U9WA 2VHSA 1PE6A 4AXMA 1ZIVA 2ATOA 1NL6A 3IUTA 2E00A 1CJLA 3H89A 3MTNA 7PCKA 1PPDA 3CBKA 3P5UA 3CBJA 3K24A 2PBHA 1U9QX 1PXVA 2DC7A 2DCDA 3ERVA 4MZSA 2R9CA 1NB5A 2R9FA 1BGOA 4P6EA 2BDZA 3CH2X 3K9MA 2YJBA 3B79A 1GECE 4YYRA 4W5CA 1W5RA 4PP1A 2O6XA 2AVWA 4P6GA 3TNXA 2WBFX 1O0EA 1YALA 1YK7A 3GCBA 3PDFA 2AYNA 3IOQA 1F29A 1Q6KA 3H7DA 1CV8A 2GFOA 1M6DA 2FRAA 1ME3A 2FUDA 2NQAA 4YYQA 1CTEA 3HHAA 4DMXA 1F2CA 3F75A 3P5XA 2R9OA 3U8EA 3V6EA 1KFXL 2AUZA 3QSDA 4X6JA 3PNRA 2XU5A 4QRVA 4GUZA 5J94A 3OF9A 2NQIA 3LFYA 5CVMA 1BP4A 3KW9A 4BGFA 4CDCB 2G8EA 4HWYA 4ZUXU 1MS6A 4C5PA 3N3KA 2OP3A 1XKGA 1BQIA 1CQDA 1YT7A 4KLBA 4W5BA 3BPFA 2BDLA 3IV2A 4NV8A 1QXPA 3USVA 1AU2A 2IBIA 1AECA 2CB5A 1PADA 3ZUAA 2XU1A 2G6DA 4YYWA 2FO5A 1A6RA 1VSNA 2IPPB 1AU4A 4Q8HA 3V6CA 1AYVA 1HUCB 4BSQA 2DC8A 3QT4A 1MDWA 2H7JA 1PPNA 4W4UA 4BS6A 1ICFA 3BWKA 2DZZA 1PCIA 2AIMA 2XU3A 1Y4HA 1TLOA 4FIPA 3OVXA 2C0YA 5JA7A 2NQDB 1JQPA 4OELA 3S3QA 3WXFA 1MHWA 1AYUA 1EWPA 1NB3A 4CDDB 1U5IA 1PPOA 1U9XA 1QDQA 2FTDA 2P0RA 4BS5A 4N79A 1AU0A 2DZYA 4G54A 2Y6EA 3F5VA 1NQCA 3LXSA 3WXGA 1F2AA 1STFE 2OULA 3KSEA 2PADA 2E01A 4PP2E 4QRXA 1MIRA 3AI8A 3N4CA 3BPMA 1CVZA 3BC3A 5EGWA 2DJFB 3MORA 1ZCMA 1PBHA 1THEA 3KWZA 1SNKA 4I05A 1MEGA 8PCHA 1CB5A 1PIPA 2CIOA 4CDFB 4FJCA 3MHSA 2PREA 1VJVA 4XR7A 1CSBB 5EF4A 4MSXA 3RVVA 1EWLA 9PAPA 3H8CA 5FPWA 2HHNA 4I04A 2P7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BOW A;  5K16 A;  3OVZ A;  2HH5 A;  1YK8 A;  4XUI A;  1S4V A;  5JH3 A;  1DF0 A;  2YJC A;  3I06 A;  5CVN B;  2DC6 A;  2AYO A;  1CS8 A;  2P86 A;  4CZW A;  4N8W A;  3P5W A;  2NQG A;  4FK5 A;  3C9E A;  3PW3 A;  1NLJ A;  1CPJ A;  3D6S A;  4YV8 A;  3I3T A;  2E03 A;  2R9M A;  4K7C A;  2FQ9 A;  1F2B A;  1KXR A;  1DEU A;  2VHF A;  4Q8G A;  4PI3 A;  1TU6 A;  2B1N A;  2FRQ A;  1BY8 A;  3BCN A;  2JQG R;  2Y5B A;  1GCB A;  1KHQ A;  4YVA A;  1PPP A;  2YJ2 A;  1POP A;  3K8U A;  2DCA A;  5CVO B;  1QOL A;  3H6S A;  2FYE A;  1TL9 A;  2AUX A;  3CH3 X;  2JQF R;  2AS8 A;  3IHP A;  1U9V A;  1GLO A;  6PAD A;  3MHH A;  2DCB A;  2F7D A;  3KFQ A;  3N3G A;  3RVW A;  1FH0 A;  5CHT A;  3S3R A;  3E1Z B;  1MEM A;  4QRG A;  4QH6 A;  4X6I A;  2B1M A;  2DC9 A;  4I07 A;  4MZO A;  2OZ2 A;  3RVX A;  1EF7 A;  1KFU L;  5PAD A;  3PBH A;  1EWO A;  3M99 A;  4YYU A;  1AIM A;  2R6N A;  3DF0 A;  1NPZ A;  3OIS A;  3OF8 A;  1GMY A;  2AU1 A;  1ATK A;  4YYV A;  1SP4 B;  1AYW A;  5F02 A;  5CHV A;  2YJ8 A;  3NHE A;  3O1G A;  2G8J A;  1Y08 A;  2ACT A;  2DJG B;  4BQV A;  1IWD A;  3WXE A;  1KHP A;  2PNS A;  3KKU A;  4PAD A;  4QBB A;  2DCC A;  1QMY A;  3IEJ A;  3HWN A;  4WA6 A;  3HHI A;  2G7Y A;  4AXL A;  2E02 A;  1EWM A;  2XU4 A;  4DMY A;  5A24 A;  2HD5 A;  2HXZ A;  2FT2 A;  4YYS A;  3KWB X;  3H8B A;  2F1G A;  2YJ9 A;  3KX1 A;  4N4Z A;  3P5V A;  3QJ3 A;  4OEM A;  1YVB A;  4BPV A;  2R9N A;  4X6H A;  3HD3 A;  2ARY A;  1X9Y A;  1ME4 A;  3O0U A;  4CDE B;  1AU3 A;  2GHU A;  1ITO A;  3IMA A;  4RY2 A;  1K3B B;  1U9W A;  2VHS A;  1PE6 A;  4AXM A;  1ZIV A;  2ATO A;  1NL6 A;  3IUT A;  2E00 A;  1CJL A;  3H89 A;  3MTN A;  7PCK A;  1PPD A;  3CBK A;  3P5U A;  3CBJ A;  3K24 A;  2PBH A;  1U9Q X;  1PXV A;  2DC7 A;  2DCD A;  3ERV A;  4MZS A;  2R9C A;  1NB5 A;  2R9F A;  1BGO A;  4P6E A;  2BDZ A;  3CH2 X;  3K9M A;  2YJB A;  3B79 A;  1GEC E;  4YYR A;  4W5C A;  4PP1 A;  2O6X A;  2AVW A;  4P6G A;  3TNX A;  2WBF X;  1O0E A;  1YAL A;  1YK7 A;  3GCB A;  3PDF A;  2AYN A;  3IOQ A;  1F29 A;  1Q6K A;  3H7D A;  1CV8 A;  2GFO A;  1M6D A;  2FRA A;  1ME3 A;  2FUD A;  2NQA A;  4YYQ A;  1CTE A;  3HHA A;  4DMX A;  1F2C A;  3F75 A;  3P5X A;  2R9O A;  3U8E A;  3V6E A;  1KFX L;  2AUZ A;  3QSD A;  4X6J A;  3PNR A;  2XU5 A;  4QRV A;  5J94 A;  3OF9 A;  2NQI A;  3LFY A;  5CVM A;  1BP4 A;  3KW9 A;  4CDC B;  2G8E A;  4HWY A;  4ZUX U;  1MS6 A;  3N3K A;  2OP3 A;  1XKG A;  1BQI A;  1CQD A;  1YT7 A;  4KLB A;  4W5B A;  3BPF A;  2BDL A;  3IV2 A;  1QXP A;  3USV A;  1AU2 A;  2IBI A;  1AEC A;  2CB5 A;  1PAD A;  3ZUA A;  2XU1 A;  2G6D A;  4YYW A;  2FO5 A;  1A6R A;  1VSN A;  2IPP B;  1AU4 A;  4Q8H A;  3V6C A;  1AYV A;  1HUC B;  4BSQ A;  2DC8 A;  3QT4 A;  1MDW A;  2H7J A;  1PPN A;  4W4U A;  4BS6 A;  1ICF A;  3BWK A;  2DZZ A;  1PCI A;  2AIM A;  2XU3 A;  1Y4H A;  1TLO A;  4FIP A;  3OVX A;  2C0Y A;  5JA7 A;  2NQD B;  1JQP A;  4OEL A;  3S3Q A;  3WXF A;  1MHW A;  1AYU A;  1EWP A;  1NB3 A;  4CDD B;  1U5I A;  1PPO A;  1U9X A;  1QDQ A;  2FTD A;  2P0R A;  4BS5 A;  4N79 A;  1AU0 A;  2DZY A;  4G54 A;  2Y6E A;  3F5V A;  1NQC A;  3LXS A;  3WXG A;  1F2A A;  1STF E;  2OUL A;  3KSE A;  2PAD A;  2E01 A;  4PP2 E;  4QRX A;  1MIR A;  3AI8 A;  3N4C A;  3BPM A;  1CVZ A;  3BC3 A;  5EGW A;  2DJF B;  3MOR A;  1ZCM A;  1PBH A;  1THE A;  3KWZ A;  1SNK A;  4I05 A;  1MEG A;  8PCH A;  1CB5 A;  1PIP A;  2CIO A;  4CDF B;  4FJC A;  3MHS A;  2PRE A;  1VJV A;  4XR7 A;  1CSB B;  5EF4 A;  4MSX A;  3RVV A;  1EWL A;  9PAP A;  3H8C A;  5FPW A;  2HHN A;  4I04 A;  2P7U A; 
#chains in the Genus database with same CATH topology
 3BOW A;  3MP2 A;  5K16 A;  3OVZ A;  2HH5 A;  1YK8 A;  4XUI A;  1S4V A;  5JH3 A;  1DF0 A;  2YJC A;  3I06 A;  5CVN B;  2DC6 A;  2AYO A;  1CS8 A;  2P86 A;  4CZW A;  4N8W A;  3P5W A;  2NQG A;  3BY4 A;  4FK5 A;  3C9E A;  3PW3 A;  1NLJ A;  1CPJ A;  3D6S A;  4YV8 A;  3I3T A;  2E03 A;  5E6J A;  2R9M A;  4K7C A;  2FQ9 A;  3ZNH A;  1F2B A;  1KXR A;  1DEU A;  2VHF A;  4Q8G A;  4PI3 A;  1TU6 A;  2B1N A;  2FRQ A;  4REZ A;  1BY8 A;  3BCN A;  2HWK A;  2JQG R;  2Y5B A;  1GCB A;  1KHQ A;  4RNA A;  4MM3 B;  4YVA A;  3PSE A;  1PPP A;  2YJ2 A;  1POP A;  3K8U A;  5KO3 A;  2DCA A;  3PT2 A;  5CVO B;  1QOL A;  4OVZ A;  3H6S A;  3PHU A;  2FYE A;  1TL9 A;  2AUX A;  3CH3 X;  2JQF R;  2AS8 A;  3IHP A;  1U9V A;  1GLO A;  6PAD A;  3MHH A;  2DCB A;  2F7D A;  3KFQ A;  3N3G A;  3RVW A;  1FH0 A;  5CHT A;  3S3R A;  3E1Z B;  1MEM A;  4QRG A;  4QH6 A;  4X6I A;  2B1M A;  2DC9 A;  4M0W A;  4BOP A;  4I07 A;  4MZO A;  2OZ2 A;  3RVX A;  1EF7 A;  1KFU L;  5PAD A;  3PBH A;  1EWO A;  3M99 A;  4YYU A;  1AIM A;  2R6N A;  3DF0 A;  1NPZ A;  2BTW A;  3OIS A;  3OF8 A;  1GMY A;  2AU1 A;  1ATK A;  4YYV A;  1SP4 B;  1AYW A;  5F02 A;  5CHV A;  3W31 A;  2YJ8 A;  3NHE A;  3O65 A;  3O1G A;  2G8J A;  1Y08 A;  2ACT A;  2DJG B;  4BQV A;  4IP3 A;  1IWD A;  3WXE A;  1KHP A;  2PNS A;  3KKU A;  4PAD A;  4QBB A;  2DCC A;  1QMY A;  4D8E A;  3IEJ A;  3HWN A;  4WA6 A;  3HHI A;  2G7Y A;  3MJ5 A;  4AXL A;  2E02 A;  4R3D A;  1EWM A;  4BOZ A;  1DKI A;  2XU4 A;  4DMY A;  5A24 A;  2HD5 A;  2HXZ A;  2FT2 A;  4OVZ B;  4YYS A;  3KWB X;  3H8B A;  2F1G A;  2YJ9 A;  3TRK A;  3KX1 A;  3BBA A;  4N4Z A;  4RKX A;  3P5V A;  3QJ3 A;  4OEM A;  1YVB A;  4BPV A;  4OW0 A;  2R9N A;  4X6H A;  3HD3 A;  1UKF A;  2ARY A;  1X9Y A;  1ME4 A;  3PHX A;  3O0U A;  2J7Q A;  4CDE B;  1AU3 A;  2GHU A;  1ITO A;  3IMA A;  4RY2 A;  1K3B B;  1U9W A;  2VHS A;  1PE6 A;  4AXM A;  1ZIV A;  4PT5 A;  2ATO A;  1NL6 A;  3IUT A;  1PVJ A;  2E00 A;  1CJL A;  3H89 A;  3MTN A;  7PCK A;  1PPD A;  3IFU A;  3CBK A;  3P5U A;  2BTW B;  3CBJ A;  4RF0 A;  3K24 A;  2PBH A;  5EZS A;  1U9Q X;  1PXV A;  2DC7 A;  2DCD A;  3ERV A;  4MZS A;  4BOQ A;  2JRI A;  2R9C A;  1NB5 A;  2R9F A;  1YZB A;  1BGO A;  4P6E A;  2BDZ A;  3CH2 X;  4RF1 A;  3K9M A;  2YJB A;  3B79 A;  1GEC E;  3PRM A;  4YYR A;  4W5C A;  4D8B A;  4PP1 A;  4BOS A;  2O6X A;  2AVW A;  4P6G A;  3TNX A;  4BOU A;  2WBF X;  1O0E A;  1YAL A;  1YK7 A;  3GCB A;  3PDF A;  2AYN A;  3IOQ A;  1F29 A;  1Q6K A;  3H7D A;  1CV8 A;  2GFO A;  1M6D A;  2FRA A;  1ME3 A;  2FUD A;  3C0R A;  2NQA A;  4YYQ A;  1CTE A;  3HHA A;  4DMX A;  1F2C A;  3F75 A;  3P5X A;  2R9O A;  2DOS A;  3U8E A;  3V6E A;  1KFX L;  2J7Q C;  2AUZ A;  3QSD A;  4ZTB A;  4D8I A;  3B21 A;  4X6J A;  3W30 A;  3PNR A;  3PHW A;  2XU5 A;  4QRV A;  5J94 A;  3OF9 A;  2NQI A;  3LFY A;  5CVM A;  1BP4 A;  3KW9 A;  3BB7 A;  4CDC B;  2G8E A;  4HWY A;  4ZUX U;  5EZQ A;  1MS6 A;  3N3K A;  2OP3 A;  4WUR A;  1XKG A;  1BQI A;  1CQD A;  1YT7 A;  3MTV A;  4KLB A;  4W5B A;  3BPF A;  2UZJ A;  2BDL A;  3IV2 A;  1QXP A;  4A5U A;  3USV A;  1AU2 A;  2IBI A;  3PRP A;  1AEC A;  2CB5 A;  1PAD A;  3ZUA A;  2XU1 A;  2G6D A;  2AGA A;  4YYW A;  2FO5 A;  1A6R A;  1VSN A;  4HXD B;  4MI7 A;  2IPP B;  4IUM A;  1AU4 A;  4Q8H A;  3V6C A;  1AYV A;  1HUC B;  4BSQ A;  2DC8 A;  3QT4 A;  1MDW A;  2H7J A;  1PPN A;  4W4U A;  4BS6 A;  1ICF A;  3BWK A;  2DZZ A;  1PCI A;  2AIM A;  2XU3 A;  1Y4H A;  1TLO A;  4FIP A;  2Z84 A;  3OVX A;  2C0Y A;  5JA7 A;  2NQD B;  5JZE A;  1JQP A;  4OEL A;  3S3Q A;  3WXF A;  1MHW A;  1AYU A;  1EWP A;  1NB3 A;  4CDD B;  1U5I A;  3RNV A;  1PPO A;  1U9X A;  1QDQ A;  2FTD A;  2P0R A;  4BS5 A;  4N79 A;  1AU0 A;  2DZY A;  4G54 A;  2Y6E A;  3F5V A;  2FE8 A;  4XZX A;  1NQC A;  3LXS A;  2BU3 A;  4GUA A;  3WXG A;  1F2A A;  1STF E;  3TMP A;  2OUL A;  3KSE A;  2PAD A;  2E01 A;  4PP2 E;  3E9S A;  4QRX A;  1MIR A;  3AI8 A;  3N4C A;  3BPM A;  1CVZ A;  3BC3 A;  5EGW A;  2DJF B;  3MOR A;  1ZCM A;  1PBH A;  1THE A;  3KWZ A;  1SNK A;  4I05 A;  1MEG A;  8PCH A;  1CB5 A;  4P16 A;  2JTC A;  1PIP A;  2CIO A;  3OQC A;  4CDF B;  4FJC A;  3MHS A;  2PRE A;  1VJV A;  4XR7 A;  1CSB B;  5EF4 A;  4MSX A;  3RVV A;  1EWL A;  9PAP A;  3H8C A;  5FPW A;  2HHN A;  4I04 A;  2P7U A; 
#chains in the Genus database with same CATH homology
 3BOW A;  5K16 A;  3OVZ A;  4NV7 A;  2HH5 A;  1YK8 A;  4B55 A;  4XUI A;  1S4V A;  5JH3 A;  1DF0 A;  2YJC A;  2BSZ A;  3I06 A;  5CVN B;  2DC6 A;  2AYO A;  1CS8 A;  2P86 A;  4CZW A;  4N8W A;  3P5W A;  2NQG A;  3LTW A;  4FK5 A;  3C9E A;  3PW3 A;  1NLJ A;  1CPJ A;  3D6S A;  4YV8 A;  3I3T A;  2E03 A;  2R9M A;  4K7C A;  2FQ9 A;  1F2B A;  1KXR A;  1DEU A;  2VHF A;  4Q8G A;  4PI3 A;  1TU6 A;  2B1N A;  2FRQ A;  1BY8 A;  3BCN A;  2JQG R;  2Y5B A;  1GCB A;  1KHQ A;  4YVA A;  1PPP A;  2YJ2 A;  1POP A;  3K8U A;  2DCA A;  5CVO B;  1QOL A;  3H6S A;  2FYE A;  1TL9 A;  2AUX A;  3CH3 X;  2JQF R;  2AS8 A;  3IHP A;  1U9V A;  3D9W A;  1GLO A;  6PAD A;  3MHH A;  2DCB A;  2F7D A;  3KFQ A;  3N3G A;  3RVW A;  1FH0 A;  5CHT A;  3S3R A;  3E1Z B;  1MEM A;  4QRG A;  1W6F A;  4QH6 A;  1GX3 A;  4X6I A;  2B1M A;  2DC9 A;  4I07 A;  4MZO A;  2OZ2 A;  3RVX A;  1EF7 A;  1KFU L;  5PAD A;  3PBH A;  1EWO A;  3M99 A;  4YYU A;  1AIM A;  2R6N A;  3DF0 A;  1NPZ A;  3OIS A;  1E2T A;  3OF8 A;  1GMY A;  2AU1 A;  1ATK A;  2VFC A;  4YYV A;  1SP4 B;  1AYW A;  5F02 A;  5CHV A;  1W4T A;  2YJ8 A;  3NHE A;  3O1G A;  2G8J A;  1Y08 A;  2ACT A;  2DJG B;  4BQV A;  1IWD A;  3WXE A;  1KHP A;  2PNS A;  3KKU A;  4PAD A;  4QBB A;  2DCC A;  1QMY A;  3IEJ A;  3HWN A;  4WA6 A;  3HHI A;  2G7Y A;  4AXL A;  2E02 A;  1EWM A;  2XU4 A;  4DMY A;  5A24 A;  2HD5 A;  2HXZ A;  2FT2 A;  4YYS A;  3KWB X;  3H8B A;  2F1G A;  2YJ9 A;  3KX1 A;  4N4Z A;  3P5V A;  3QJ3 A;  4OEM A;  1YVB A;  2VFB A;  4BPV A;  2R9N A;  4X6H A;  3HD3 A;  2ARY A;  1X9Y A;  1ME4 A;  3O0U A;  4CDE B;  1AU3 A;  2GHU A;  1ITO A;  3IMA A;  4RY2 A;  1K3B B;  1U9W A;  2VHS A;  1PE6 A;  4AXM A;  1ZIV A;  2ATO A;  1NL6 A;  3IUT A;  2E00 A;  1CJL A;  3H89 A;  3MTN A;  7PCK A;  1PPD A;  3CBK A;  3P5U A;  3CBJ A;  3K24 A;  2PBH A;  1U9Q X;  1PXV A;  2DC7 A;  2DCD A;  3ERV A;  4MZS A;  2R9C A;  1NB5 A;  2R9F A;  1BGO A;  4P6E A;  2BDZ A;  3CH2 X;  3K9M A;  2YJB A;  3B79 A;  1GEC E;  4YYR A;  4W5C A;  1W5R A;  4PP1 A;  2O6X A;  2AVW A;  4P6G A;  3TNX A;  2WBF X;  1O0E A;  1YAL A;  1YK7 A;  3GCB A;  3PDF A;  2AYN A;  3IOQ A;  1F29 A;  1Q6K A;  3H7D A;  1CV8 A;  2GFO A;  1M6D A;  2FRA A;  1ME3 A;  2FUD A;  2NQA A;  4YYQ A;  1CTE A;  3HHA A;  4DMX A;  1F2C A;  3F75 A;  3P5X A;  2R9O A;  3U8E A;  3V6E A;  1KFX L;  2AUZ A;  3QSD A;  4X6J A;  3PNR A;  2XU5 A;  4QRV A;  4GUZ A;  5J94 A;  3OF9 A;  2NQI A;  3LFY A;  5CVM A;  1BP4 A;  3KW9 A;  4BGF A;  4CDC B;  2G8E A;  4HWY A;  4ZUX U;  1MS6 A;  4C5P A;  3N3K A;  2OP3 A;  1XKG A;  1BQI A;  1CQD A;  1YT7 A;  4KLB A;  4W5B A;  3BPF A;  2BDL A;  3IV2 A;  4NV8 A;  1QXP A;  3USV A;  1AU2 A;  2IBI A;  1AEC A;  2CB5 A;  1PAD A;  3ZUA A;  2XU1 A;  2G6D A;  4YYW A;  2FO5 A;  1A6R A;  1VSN A;  2IPP B;  1AU4 A;  4Q8H A;  3V6C A;  1AYV A;  1HUC B;  4BSQ A;  2DC8 A;  3QT4 A;  1MDW A;  2H7J A;  1PPN A;  4W4U A;  4BS6 A;  1ICF A;  3BWK A;  2DZZ A;  1PCI A;  2AIM A;  2XU3 A;  1Y4H A;  1TLO A;  4FIP A;  3OVX A;  2C0Y A;  5JA7 A;  2NQD B;  1JQP A;  4OEL A;  3S3Q A;  3WXF A;  1MHW A;  1AYU A;  1EWP A;  1NB3 A;  4CDD B;  1U5I A;  1PPO A;  1U9X A;  1QDQ A;  2FTD A;  2P0R A;  4BS5 A;  4N79 A;  1AU0 A;  2DZY A;  4G54 A;  2Y6E A;  3F5V A;  1NQC A;  3LXS A;  3WXG A;  1F2A A;  1STF E;  2OUL A;  3KSE A;  2PAD A;  2E01 A;  4PP2 E;  4QRX A;  1MIR A;  3AI8 A;  3N4C A;  3BPM A;  1CVZ A;  3BC3 A;  5EGW A;  2DJF B;  3MOR A;  1ZCM A;  1PBH A;  1THE A;  3KWZ A;  1SNK A;  4I05 A;  1MEG A;  8PCH A;  1CB5 A;  1PIP A;  2CIO A;  4CDF B;  4FJC A;  3MHS A;  2PRE A;  1VJV A;  4XR7 A;  1CSB B;  5EF4 A;  4MSX A;  3RVV A;  1EWL A;  9PAP A;  3H8C A;  5FPW A;  2HHN A;  4I04 A;  2P7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...