1PPNA

Structure of monoclinic papain at 1.60 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Structure of Monoclinic Papain at 1.60 Angstroms Resolution
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
total genus 70
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1991-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppnA00
3OF9A 1AU0A 1Q6KA 2DZZA 4CDEB 4BQVA 2GHUA 3RVXA 1AU4A 2DJGB 1IWDA 2HD5A 4K7CA 2YJ2A 3KFQA 1U9QX 4BS5A 1X9YA 1AU3A 1FH0A 1F2AA 3P5VA 3F75A 3BCNA 2B1NA 5EF4A 3OISA 4HWYA 2FTDA 2NQDB 4PADA 1F2BA 3U8EA 2DZYA 2F1GA 2P7UA 2YJCA 1BY8A 4YYQA 1AYVA 2BDZA 2F7DA 1KFXL 4W5CA 4WA6A 2DC6A 3MHSA 1PADA 1O0EA 4X6JA 2AS8A 4YYWA 1CQDA 1TLOA 3N3KA 3ERVA 4MZSA 1CPJA 1SP4B 2HH5A 1CS8A 1SNKA 4G54A 5JA7A 1EF7A 2VHFA 3IEJA 1ZIVA 2AVWA 4Q8GA 1U9WA 1U9XA 3CBJA 2DCBA 5CVOB 1PBHA 3V6CA 4XUIA 3C9EA 3MORA 3O1GA 2XU4A 3H89A 1M6DA 4N4ZA 1HUCB 3M99A 5EGWA 2AYOA 2E03A 1CB5A 2AUZA 4FK5A 2ARYA 4W5BA 2FO5A 1NB5A 2JQGR 4DMYA 8PCHA 1PPNA 1YK8A 3CH2X 2DC8A 1PPOA 4FIPA 1XKGA 2JQFR 1PPDA 3WXFA 3H8CA 5CVMA 1YVBA 4XR7A 5CHTA 1F29A 2DJFB 1ICFA 1AYUA 3S3RA 2XU3A 4MSXA 3CH3X 2DC7A 3P5UA 4P6EA 1Y4HA 2H7JA 2YJ8A 4CDDB 5J94A 2NQGA 3P5XA 3H7DA 4QRVA 2AIMA 1QDQA 1BGOA 4YVAA 4QRXA 1CV8A 4X6HA 4N79A 4PP1A 2HHNA 3I3TA 3PW3A 4DMXA 4I07A 1KHQA 1NLJA 3IHPA 3IUTA 1Y08A 3OF8A 9PAPA 2XU5A 3TNXA 1KHPA 2FRQA 1QOLA 3AI8A 1QMYA 4BS6A 1CVZA 3I06A 3P5WA 1EWMA 3O0UA 4QRGA 2R6NA 1GCBA 4BPVA 3HHAA 2CIOA 3N4CA 2AUXA 3DF0A 4AXLA 2P86A 3K24A 2C0YA 2OP3A 1ZCMA 2CB5A 5PADA 1EWOA 3D6SA 5K16A 3WXEA 2ATOA 2PNSA 2BDLA 2G8JA 3BPMA 1KXRA 1YALA 3IOQA 3WXGA 3BC3A 3IMAA 3IV2A 2R9MA 3V6EA 1PIPA 3OVXA 1NPZA 2PADA 1ATKA 4Q8HA 1BQIA 1NL6A 3HHIA 4OEMA 4YV8A 2Y5BA 4CZWA 1PXVA 3KW9A 3S3QA 1PCIA 2E00A 3BWKA 3GCBA 1MS6A 2Y6EA 5CVNB 1POPA 2P0RA 1TL9A 4QBBA 3PBHA 4YYVA 2PREA 2G6DA 1VJVA 4AXMA 3USVA 3E1ZB 3K9MA 3MHHA 1A6RA 3QJ3A 4OELA 1ME4A 4RY2A 1GECE 1PE6A 2VHSA 3N3GA 1AU2A 6PADA 4ZUXU 1TU6A 1AECA 4N8WA 1DEUA 1CJLA 2R9OA 1MDWA 1CTEA 2NQAA 1K3BB 2R9NA 4FJCA 1THEA 4I04A 4YYRA 2AYNA 2AU1A 3BOWA 4CDFB 3KWBX 1AYWA 1ITOA 2NQIA 1VSNA 5FPWA 4QH6A 1MIRA 3PNRA 4YYUA 1CSBB 3F5VA 2E01A 3ZUAA 1NQCA 3KWZA 2IPPB 2B1MA 2YJBA 1ME3A 1GLOA 2DCAA 3H6SA 2DCCA 1YK7A 2FUDA 3KX1A 2OZ2A 1JQPA 4CDCB 1U5IA 3NHEA 2R9FA 3HWNA 4I05A 1S4VA 2PBHA 2G8EA 4YYSA 1KFUL 2HXZA 4W4UA 2GFOA 4P6GA 3HD3A 3KSEA 2FQ9A 1MHWA 3QT4A 3OVZA 3K8UA 3KKUA 5JH3A 2ACTA 1EWLA 2WBFX 2FYEA 1U9VA 1DF0A 3MTNA 2DC9A 1F2CA 4MZOA 2R9CA 4PI3A 2XU1A 3QSDA 1QXPA 5A24A 2FT2A 3H8BA 4BSQA 1MEGA 3B79A 4PP2E 3LXSA 1YT7A 3LFYA 2DCDA 1STFE 5F02A 2E02A 4X6IA 3RVVA 2G7YA 2FRAA 2IBIA 2YJ9A 3BPFA 1GMYA 2OULA 3PDFA 1AIMA 1MEMA 1NB3A 7PCKA 1BP4A 5CHVA 3RVWA 1EWPA 3CBKA 4KLBA 1PPPA 2O6XA
chains in the Genus database with same CATH superfamily
3OF9A 1AU0A 1Q6KA 3IFUA 2DZZA 4CDEB 4BQVA 2GHUA 3RVXA 1AU4A 2DJGB 1IWDA 3W30A 2HD5A 4K7CA 2YJ2A 3KFQA 1U9QX 4BS5A 1X9YA 1AU3A 1FH0A 1F2AA 3P5VA 3F75A 3BCNA 2B1NA 5EF4A 3OISA 4HWYA 3MTVA 2FTDA 2JTCA 2NQDB 4PADA 1F2BA 3U8EA 2DZYA 2F1GA 2P7UA 2YJCA 1BY8A 4YYQA 1AYVA 2BDZA 2F7DA 1KFXL 4ZTBA 4W5CA 4WA6A 2DC6A 3MHSA 4RF0A 1PADA 1O0EA 2BU3A 4X6JA 2AS8A 4YYWA 1CQDA 1TLOA 3N3KA 4BOSA 3ERVA 4MZSA 4P16A 1CPJA 1SP4B 2HH5A 1CS8A 1SNKA 4G54A 5JA7A 1EF7A 3OQCA 2VHFA 3IEJA 3PHWA 1ZIVA 2AVWA 4Q8GA 4BOZA 1U9WA 1U9XA 3CBJA 2DCBA 5CVOB 1PBHA 4OVZB 4MI7A 3V6CA 4XUIA 3C9EA 3MORA 3O1GA 3TMPA 2XU4A 3H89A 1M6DA 4N4ZA 1HUCB 3M99A 5EGWA 2AYOA 2E03A 1CB5A 2AUZA 4FK5A 4BOQA 2BTWA 2ARYA 4W5BA 2FO5A 1NB5A 2JQGR 4DMYA 8PCHA 1PPNA 1YK8A 3CH2X 2DC8A 1PPOA 4FIPA 1XKGA 2JQFR 1PPDA 3WXFA 3H8CA 3TRKA 5CVMA 1UKFA 1PVJA 1YVBA 4XR7A 5CHTA 1F29A 2DJFB 1ICFA 1AYUA 3BY4A 3S3RA 2XU3A 4MSXA 3CH3X 2DC7A 3P5UA 4P6EA 1Y4HA 2H7JA 2YJ8A 5EZQA 4BOUA 4CDDB 5J94A 2NQGA 3P5XA 3H7DA 4QRVA 2AIMA 1QDQA 4M0WA 1BGOA 4YVAA 4QRXA 1CV8A 4X6HA 4N79A 4PP1A 2HHNA 2Z84A 3I3TA 3PW3A 4DMXA 4I07A 1KHQA 3W31A 2AGAA 4MM3B 1NLJA 3IHPA 3IUTA 1Y08A 3OF8A 5E6JA 9PAPA 3PHUA 2XU5A 3TNXA 1KHPA 4REZA 2FRQA 1QOLA 3AI8A 4D8EA 1QMYA 4BS6A 1CVZA 3I06A 3P5WA 1EWMA 3O0UA 4QRGA 2R6NA 1GCBA 3PSEA 4IP3A 4BPVA 3HHAA 2CIOA 3N4CA 2AUXA 3DF0A 4AXLA 2P86A 3K24A 2C0YA 4RNAA 2OP3A 1ZCMA 2CB5A 3BB7A 5PADA 2UZJA 1EWOA 4PT5A 3D6SA 5K16A 4GUAA 3WXEA 2ATOA 2PNSA 2BDLA 2G8JA 3BPMA 1KXRA 1YALA 3IOQA 3WXGA 3BC3A 3IMAA 3IV2A 2R9MA 3V6EA 1PIPA 3OVXA 1NPZA 2PADA 1ATKA 2BTWB 4Q8HA 1BQIA 1NL6A 3HHIA 4OEMA 4YV8A 2Y5BA 4CZWA 1PXVA 3KW9A 3S3QA 1PCIA 2E00A 3BWKA 3GCBA 1MS6A 2Y6EA 4RKXA 5CVNB 1POPA 2P0RA 1TL9A 4QBBA 2DOSA 3PBHA 4YYVA 2PREA 2G6DA 4R3DA 1VJVA 4AXMA 3USVA 2HWKA 3E1ZB 3K9MA 3MHHA 3PT2A 4HXDB 1A6RA 3QJ3A 4OELA 1ME4A 4RY2A 1DKIA 1GECE 1PE6A 2VHSA 3N3GA 1AU2A 6PADA 4ZUXU 1TU6A 1AECA 4N8WA 3BBAA 2FE8A 1DEUA 1CJLA 2R9OA 1MDWA 1CTEA 4OW0A 2NQAA 1K3BB 4IUMA 2R9NA 3MP2A 4FJCA 1THEA 4I04A 4YYRA 2AYNA 2AU1A 3BOWA 4CDFB 3KWBX 1AYWA 1ITOA 2NQIA 1VSNA 5FPWA 4QH6A 1MIRA 3PNRA 4YYUA 3E9SA 2J7QC 1CSBB 2JRIA 3F5VA 2E01A 3ZUAA 1NQCA 3KWZA 2IPPB 2B1MA 4D8BA 2YJBA 1ME3A 1GLOA 2DCAA 3H6SA 5JZEA 2DCCA 5KO3A 1YK7A 4WURA 2FUDA 3PRMA 2J7QA 3KX1A 2OZ2A 1JQPA 4CDCB 1U5IA 1YZBA 3NHEA 4XZXA 3C0RA 2R9FA 3HWNA 3B21A 4I05A 1S4VA 2PBHA 2G8EA 4YYSA 1KFUL 2HXZA 4W4UA 2GFOA 4P6GA 3HD3A 3KSEA 2FQ9A 4D8IA 1MHWA 3QT4A 3OVZA 3K8UA 3RNVA 3KKUA 5JH3A 2ACTA 3PHXA 1EWLA 2WBFX 2FYEA 4RF1A 1U9VA 1DF0A 3MTNA 2DC9A 1F2CA 5EZSA 4MZOA 2R9CA 4PI3A 2XU1A 4OVZA 3QSDA 1QXPA 5A24A 2FT2A 3H8BA 3PRPA 4BOPA 4A5UA 4BSQA 3ZNHA 1MEGA 3B79A 4PP2E 3LXSA 1YT7A 3LFYA 2DCDA 1STFE 5F02A 2E02A 4X6IA 3O65A 3RVVA 2G7YA 2FRAA 2IBIA 2YJ9A 3BPFA 1GMYA 2OULA 3PDFA 1AIMA 1MEMA 1NB3A 7PCKA 1BP4A 5CHVA 3RVWA 1EWPA 3MJ5A 3CBKA 4KLBA 1PPPA 2O6XA
chains in the Genus database with same CATH topology
3OF9A 1AU0A 1Q6KA 2DZZA 4CDEB 4BQVA 2GHUA 3RVXA 1AU4A 2DJGB 4NV8A 1IWDA 2HD5A 4K7CA 2YJ2A 3KFQA 1U9QX 4BS5A 1X9YA 1AU3A 1FH0A 1F2AA 3P5VA 3F75A 3BCNA 2B1NA 5EF4A 3OISA 4HWYA 2FTDA 2NQDB 4PADA 1F2BA 3U8EA 2DZYA 2F1GA 2P7UA 4NV7A 2YJCA 1BY8A 4YYQA 1AYVA 2BDZA 2F7DA 1KFXL 4W5CA 4WA6A 2DC6A 3MHSA 1PADA 1O0EA 4X6JA 4B55A 2AS8A 1W6FA 4YYWA 1CQDA 1TLOA 3N3KA 3ERVA 4MZSA 1CPJA 1SP4B 2HH5A 1CS8A 4GUZA 1SNKA 4G54A 5JA7A 1EF7A 2VHFA 3IEJA 1W4TA 1ZIVA 2AVWA 4Q8GA 1U9WA 1U9XA 3CBJA 2DCBA 5CVOB 1PBHA 3V6CA 3D9WA 4XUIA 3C9EA 3MORA 4C5PA 3O1GA 2XU4A 3H89A 1M6DA 4N4ZA 1HUCB 3M99A 5EGWA 2AYOA 2E03A 1CB5A 2AUZA 4FK5A 2ARYA 4W5BA 2FO5A 1NB5A 2BSZA 2JQGR 4DMYA 8PCHA 1W5RA 1PPNA 1YK8A 3CH2X 2DC8A 1PPOA 4FIPA 1XKGA 2JQFR 1PPDA 3WXFA 3H8CA 5CVMA 1YVBA 4XR7A 5CHTA 1F29A 2DJFB 1ICFA 1AYUA 3S3RA 2XU3A 4MSXA 3CH3X 2DC7A 3P5UA 4P6EA 1Y4HA 2H7JA 2YJ8A 4CDDB 5J94A 2NQGA 3P5XA 3H7DA 4QRVA 2AIMA 1QDQA 1BGOA 4YVAA 4QRXA 1CV8A 4X6HA 4N79A 4PP1A 2HHNA 3I3TA 3PW3A 4DMXA 4I07A 3LTWA 1KHQA 1NLJA 3IHPA 3IUTA 4BGFA 1Y08A 3OF8A 9PAPA 2XU5A 2VFBA 3TNXA 1KHPA 2FRQA 1QOLA 3AI8A 1QMYA 4BS6A 1CVZA 3I06A 3P5WA 1EWMA 3O0UA 4QRGA 2R6NA 1GCBA 4BPVA 3HHAA 2CIOA 3N4CA 2AUXA 3DF0A 4AXLA 2P86A 3K24A 2C0YA 2OP3A 1ZCMA 2CB5A 1E2TA 5PADA 1EWOA 3D6SA 5K16A 3WXEA 2ATOA 2PNSA 2BDLA 2G8JA 3BPMA 1KXRA 1YALA 3IOQA 3WXGA 3BC3A 3IMAA 3IV2A 2R9MA 3V6EA 1PIPA 3OVXA 1NPZA 2PADA 1ATKA 4Q8HA 1BQIA 1NL6A 3HHIA 4OEMA 4YV8A 2Y5BA 4CZWA 1PXVA 2VFCA 3KW9A 3S3QA 1PCIA 2E00A 3BWKA 3GCBA 1MS6A 2Y6EA 5CVNB 1POPA 2P0RA 1TL9A 4QBBA 3PBHA 4YYVA 2PREA 2G6DA 1VJVA 4AXMA 3USVA 3E1ZB 3K9MA 3MHHA 1A6RA 3QJ3A 4OELA 1ME4A 4RY2A 1GECE 1PE6A 2VHSA 3N3GA 1AU2A 6PADA 4ZUXU 1TU6A 1AECA 4N8WA 1DEUA 1CJLA 2R9OA 1MDWA 1CTEA 2NQAA 1K3BB 2R9NA 4FJCA 1THEA 4I04A 4YYRA 2AYNA 2AU1A 3BOWA 4CDFB 3KWBX 1AYWA 1ITOA 2NQIA 1VSNA 5FPWA 4QH6A 1MIRA 3PNRA 4YYUA 1CSBB 3F5VA 2E01A 3ZUAA 1NQCA 3KWZA 2IPPB 2B1MA 2YJBA 1ME3A 1GLOA 2DCAA 3H6SA 2DCCA 1YK7A 2FUDA 3KX1A 2OZ2A 1JQPA 4CDCB 1U5IA 3NHEA 2R9FA 3HWNA 4I05A 1S4VA 2PBHA 2G8EA 4YYSA 1KFUL 2HXZA 4W4UA 2GFOA 4P6GA 3HD3A 3KSEA 2FQ9A 1MHWA 3QT4A 3OVZA 3K8UA 3KKUA 5JH3A 2ACTA 1EWLA 2WBFX 2FYEA 1U9VA 1DF0A 3MTNA 2DC9A 1F2CA 4MZOA 2R9CA 4PI3A 2XU1A 3QSDA 1QXPA 5A24A 2FT2A 3H8BA 4BSQA 1MEGA 3B79A 4PP2E 3LXSA 1YT7A 3LFYA 2DCDA 1STFE 5F02A 1GX3A 2E02A 4X6IA 3RVVA 2G7YA 2FRAA 2IBIA 2YJ9A 3BPFA 1GMYA 2OULA 3PDFA 1AIMA 1MEMA 1NB3A 7PCKA 1BP4A 5CHVA 3RVWA 1EWPA 3CBKA 4KLBA 1PPPA 2O6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF9 A;  1AU0 A;  1Q6K A;  2DZZ A;  4CDE B;  4BQV A;  2GHU A;  3RVX A;  1AU4 A;  2DJG B;  1IWD A;  2HD5 A;  4K7C A;  2YJ2 A;  3KFQ A;  1U9Q X;  4BS5 A;  1X9Y A;  1AU3 A;  1FH0 A;  1F2A A;  3P5V A;  3F75 A;  3BCN A;  2B1N A;  5EF4 A;  3OIS A;  4HWY A;  2FTD A;  2NQD B;  4PAD A;  1F2B A;  3U8E A;  2DZY A;  2F1G A;  2P7U A;  2YJC A;  1BY8 A;  4YYQ A;  1AYV A;  2BDZ A;  2F7D A;  1KFX L;  4W5C A;  4WA6 A;  2DC6 A;  3MHS A;  1PAD A;  1O0E A;  4X6J A;  2AS8 A;  4YYW A;  1CQD A;  1TLO A;  3N3K A;  3ERV A;  4MZS A;  1CPJ A;  1SP4 B;  2HH5 A;  1CS8 A;  1SNK A;  4G54 A;  5JA7 A;  1EF7 A;  2VHF A;  3IEJ A;  1ZIV A;  2AVW A;  4Q8G A;  1U9W A;  1U9X A;  3CBJ A;  2DCB A;  5CVO B;  1PBH A;  3V6C A;  4XUI A;  3C9E A;  3MOR A;  3O1G A;  2XU4 A;  3H89 A;  1M6D A;  4N4Z A;  1HUC B;  3M99 A;  5EGW A;  2AYO A;  2E03 A;  1CB5 A;  2AUZ A;  4FK5 A;  2ARY A;  4W5B A;  2FO5 A;  1NB5 A;  2JQG R;  4DMY A;  8PCH A;  1PPN A;  1YK8 A;  3CH2 X;  2DC8 A;  1PPO A;  4FIP A;  1XKG A;  2JQF R;  1PPD A;  3WXF A;  3H8C A;  5CVM A;  1YVB A;  4XR7 A;  5CHT A;  1F29 A;  2DJF B;  1ICF A;  1AYU A;  3S3R A;  2XU3 A;  4MSX A;  3CH3 X;  2DC7 A;  3P5U A;  4P6E A;  1Y4H A;  2H7J A;  2YJ8 A;  4CDD B;  5J94 A;  2NQG A;  3P5X A;  3H7D A;  4QRV A;  2AIM A;  1QDQ A;  1BGO A;  4YVA A;  4QRX A;  1CV8 A;  4X6H A;  4N79 A;  4PP1 A;  2HHN A;  3I3T A;  3PW3 A;  4DMX A;  4I07 A;  1KHQ A;  1NLJ A;  3IHP A;  3IUT A;  1Y08 A;  3OF8 A;  9PAP A;  2XU5 A;  3TNX A;  1KHP A;  2FRQ A;  1QOL A;  3AI8 A;  1QMY A;  4BS6 A;  1CVZ A;  3I06 A;  3P5W A;  1EWM A;  3O0U A;  4QRG A;  2R6N A;  1GCB A;  4BPV A;  3HHA A;  2CIO A;  3N4C A;  2AUX A;  3DF0 A;  4AXL A;  2P86 A;  3K24 A;  2C0Y A;  2OP3 A;  1ZCM A;  2CB5 A;  5PAD A;  1EWO A;  3D6S A;  5K16 A;  3WXE A;  2ATO A;  2PNS A;  2BDL A;  2G8J A;  3BPM A;  1KXR A;  1YAL A;  3IOQ A;  3WXG A;  3BC3 A;  3IMA A;  3IV2 A;  2R9M A;  3V6E A;  1PIP A;  3OVX A;  1NPZ A;  2PAD A;  1ATK A;  4Q8H A;  1BQI A;  1NL6 A;  3HHI A;  4OEM A;  4YV8 A;  2Y5B A;  4CZW A;  1PXV A;  3KW9 A;  3S3Q A;  1PCI A;  2E00 A;  3BWK A;  3GCB A;  1MS6 A;  2Y6E A;  5CVN B;  1POP A;  2P0R A;  1TL9 A;  4QBB A;  3PBH A;  4YYV A;  2PRE A;  2G6D A;  1VJV A;  4AXM A;  3USV A;  3E1Z B;  3K9M A;  3MHH A;  1A6R A;  3QJ3 A;  4OEL A;  1ME4 A;  4RY2 A;  1GEC E;  1PE6 A;  2VHS A;  3N3G A;  1AU2 A;  6PAD A;  4ZUX U;  1TU6 A;  1AEC A;  4N8W A;  1DEU A;  1CJL A;  2R9O A;  1MDW A;  1CTE A;  2NQA A;  1K3B B;  2R9N A;  4FJC A;  1THE A;  4I04 A;  4YYR A;  2AYN A;  2AU1 A;  3BOW A;  4CDF B;  3KWB X;  1AYW A;  1ITO A;  2NQI A;  1VSN A;  5FPW A;  4QH6 A;  1MIR A;  3PNR A;  4YYU A;  1CSB B;  3F5V A;  2E01 A;  3ZUA A;  1NQC A;  3KWZ A;  2IPP B;  2B1M A;  2YJB A;  1ME3 A;  1GLO A;  2DCA A;  3H6S A;  2DCC A;  1YK7 A;  2FUD A;  3KX1 A;  2OZ2 A;  1JQP A;  4CDC B;  1U5I A;  3NHE A;  2R9F A;  3HWN A;  4I05 A;  1S4V A;  2PBH A;  2G8E A;  4YYS A;  1KFU L;  2HXZ A;  4W4U A;  2GFO A;  4P6G A;  3HD3 A;  3KSE A;  2FQ9 A;  1MHW A;  3QT4 A;  3OVZ A;  3K8U A;  3KKU A;  5JH3 A;  2ACT A;  1EWL A;  2WBF X;  2FYE A;  1U9V A;  1DF0 A;  3MTN A;  2DC9 A;  1F2C A;  4MZO A;  2R9C A;  4PI3 A;  2XU1 A;  3QSD A;  1QXP A;  5A24 A;  2FT2 A;  3H8B A;  4BSQ A;  1MEG A;  3B79 A;  4PP2 E;  3LXS A;  1YT7 A;  3LFY A;  2DCD A;  1STF E;  5F02 A;  2E02 A;  4X6I A;  3RVV A;  2G7Y A;  2FRA A;  2IBI A;  2YJ9 A;  3BPF A;  1GMY A;  2OUL A;  3PDF A;  1AIM A;  1MEM A;  1NB3 A;  7PCK A;  1BP4 A;  5CHV A;  3RVW A;  1EWP A;  3CBK A;  4KLB A;  1PPP A;  2O6X A; 
#chains in the Genus database with same CATH topology
 3OF9 A;  1AU0 A;  1Q6K A;  3IFU A;  2DZZ A;  4CDE B;  4BQV A;  2GHU A;  3RVX A;  1AU4 A;  2DJG B;  1IWD A;  3W30 A;  2HD5 A;  4K7C A;  2YJ2 A;  3KFQ A;  1U9Q X;  4BS5 A;  1X9Y A;  1AU3 A;  1FH0 A;  1F2A A;  3P5V A;  3F75 A;  3BCN A;  2B1N A;  5EF4 A;  3OIS A;  4HWY A;  3MTV A;  2FTD A;  2JTC A;  2NQD B;  4PAD A;  1F2B A;  3U8E A;  2DZY A;  2F1G A;  2P7U A;  2YJC A;  1BY8 A;  4YYQ A;  1AYV A;  2BDZ A;  2F7D A;  1KFX L;  4ZTB A;  4W5C A;  4WA6 A;  2DC6 A;  3MHS A;  4RF0 A;  1PAD A;  1O0E A;  2BU3 A;  4X6J A;  2AS8 A;  4YYW A;  1CQD A;  1TLO A;  3N3K A;  4BOS A;  3ERV A;  4MZS A;  4P16 A;  1CPJ A;  1SP4 B;  2HH5 A;  1CS8 A;  1SNK A;  4G54 A;  5JA7 A;  1EF7 A;  3OQC A;  2VHF A;  3IEJ A;  3PHW A;  1ZIV A;  2AVW A;  4Q8G A;  4BOZ A;  1U9W A;  1U9X A;  3CBJ A;  2DCB A;  5CVO B;  1PBH A;  4OVZ B;  4MI7 A;  3V6C A;  4XUI A;  3C9E A;  3MOR A;  3O1G A;  3TMP A;  2XU4 A;  3H89 A;  1M6D A;  4N4Z A;  1HUC B;  3M99 A;  5EGW A;  2AYO A;  2E03 A;  1CB5 A;  2AUZ A;  4FK5 A;  4BOQ A;  2BTW A;  2ARY A;  4W5B A;  2FO5 A;  1NB5 A;  2JQG R;  4DMY A;  8PCH A;  1PPN A;  1YK8 A;  3CH2 X;  2DC8 A;  1PPO A;  4FIP A;  1XKG A;  2JQF R;  1PPD A;  3WXF A;  3H8C A;  3TRK A;  5CVM A;  1UKF A;  1PVJ A;  1YVB A;  4XR7 A;  5CHT A;  1F29 A;  2DJF B;  1ICF A;  1AYU A;  3BY4 A;  3S3R A;  2XU3 A;  4MSX A;  3CH3 X;  2DC7 A;  3P5U A;  4P6E A;  1Y4H A;  2H7J A;  2YJ8 A;  5EZQ A;  4BOU A;  4CDD B;  5J94 A;  2NQG A;  3P5X A;  3H7D A;  4QRV A;  2AIM A;  1QDQ A;  4M0W A;  1BGO A;  4YVA A;  4QRX A;  1CV8 A;  4X6H A;  4N79 A;  4PP1 A;  2HHN A;  2Z84 A;  3I3T A;  3PW3 A;  4DMX A;  4I07 A;  1KHQ A;  3W31 A;  2AGA A;  4MM3 B;  1NLJ A;  3IHP A;  3IUT A;  1Y08 A;  3OF8 A;  5E6J A;  9PAP A;  3PHU A;  2XU5 A;  3TNX A;  1KHP A;  4REZ A;  2FRQ A;  1QOL A;  3AI8 A;  4D8E A;  1QMY A;  4BS6 A;  1CVZ A;  3I06 A;  3P5W A;  1EWM A;  3O0U A;  4QRG A;  2R6N A;  1GCB A;  3PSE A;  4IP3 A;  4BPV A;  3HHA A;  2CIO A;  3N4C A;  2AUX A;  3DF0 A;  4AXL A;  2P86 A;  3K24 A;  2C0Y A;  4RNA A;  2OP3 A;  1ZCM A;  2CB5 A;  3BB7 A;  5PAD A;  2UZJ A;  1EWO A;  4PT5 A;  3D6S A;  5K16 A;  4GUA A;  3WXE A;  2ATO A;  2PNS A;  2BDL A;  2G8J A;  3BPM A;  1KXR A;  1YAL A;  3IOQ A;  3WXG A;  3BC3 A;  3IMA A;  3IV2 A;  2R9M A;  3V6E A;  1PIP A;  3OVX A;  1NPZ A;  2PAD A;  1ATK A;  2BTW B;  4Q8H A;  1BQI A;  1NL6 A;  3HHI A;  4OEM A;  4YV8 A;  2Y5B A;  4CZW A;  1PXV A;  3KW9 A;  3S3Q A;  1PCI A;  2E00 A;  3BWK A;  3GCB A;  1MS6 A;  2Y6E A;  4RKX A;  5CVN B;  1POP A;  2P0R A;  1TL9 A;  4QBB A;  2DOS A;  3PBH A;  4YYV A;  2PRE A;  2G6D A;  4R3D A;  1VJV A;  4AXM A;  3USV A;  2HWK A;  3E1Z B;  3K9M A;  3MHH A;  3PT2 A;  4HXD B;  1A6R A;  3QJ3 A;  4OEL A;  1ME4 A;  4RY2 A;  1DKI A;  1GEC E;  1PE6 A;  2VHS A;  3N3G A;  1AU2 A;  6PAD A;  4ZUX U;  1TU6 A;  1AEC A;  4N8W A;  3BBA A;  2FE8 A;  1DEU A;  1CJL A;  2R9O A;  1MDW A;  1CTE A;  4OW0 A;  2NQA A;  1K3B B;  4IUM A;  2R9N A;  3MP2 A;  4FJC A;  1THE A;  4I04 A;  4YYR A;  2AYN A;  2AU1 A;  3BOW A;  4CDF B;  3KWB X;  1AYW A;  1ITO A;  2NQI A;  1VSN A;  5FPW A;  4QH6 A;  1MIR A;  3PNR A;  4YYU A;  3E9S A;  2J7Q C;  1CSB B;  2JRI A;  3F5V A;  2E01 A;  3ZUA A;  1NQC A;  3KWZ A;  2IPP B;  2B1M A;  4D8B A;  2YJB A;  1ME3 A;  1GLO A;  2DCA A;  3H6S A;  5JZE A;  2DCC A;  5KO3 A;  1YK7 A;  4WUR A;  2FUD A;  3PRM A;  2J7Q A;  3KX1 A;  2OZ2 A;  1JQP A;  4CDC B;  1U5I A;  1YZB A;  3NHE A;  4XZX A;  3C0R A;  2R9F A;  3HWN A;  3B21 A;  4I05 A;  1S4V A;  2PBH A;  2G8E A;  4YYS A;  1KFU L;  2HXZ A;  4W4U A;  2GFO A;  4P6G A;  3HD3 A;  3KSE A;  2FQ9 A;  4D8I A;  1MHW A;  3QT4 A;  3OVZ A;  3K8U A;  3RNV A;  3KKU A;  5JH3 A;  2ACT A;  3PHX A;  1EWL A;  2WBF X;  2FYE A;  4RF1 A;  1U9V A;  1DF0 A;  3MTN A;  2DC9 A;  1F2C A;  5EZS A;  4MZO A;  2R9C A;  4PI3 A;  2XU1 A;  4OVZ A;  3QSD A;  1QXP A;  5A24 A;  2FT2 A;  3H8B A;  3PRP A;  4BOP A;  4A5U A;  4BSQ A;  3ZNH A;  1MEG A;  3B79 A;  4PP2 E;  3LXS A;  1YT7 A;  3LFY A;  2DCD A;  1STF E;  5F02 A;  2E02 A;  4X6I A;  3O65 A;  3RVV A;  2G7Y A;  2FRA A;  2IBI A;  2YJ9 A;  3BPF A;  1GMY A;  2OUL A;  3PDF A;  1AIM A;  1MEM A;  1NB3 A;  7PCK A;  1BP4 A;  5CHV A;  3RVW A;  1EWP A;  3MJ5 A;  3CBK A;  4KLB A;  1PPP A;  2O6X A; 
#chains in the Genus database with same CATH homology
 3OF9 A;  1AU0 A;  1Q6K A;  2DZZ A;  4CDE B;  4BQV A;  2GHU A;  3RVX A;  1AU4 A;  2DJG B;  4NV8 A;  1IWD A;  2HD5 A;  4K7C A;  2YJ2 A;  3KFQ A;  1U9Q X;  4BS5 A;  1X9Y A;  1AU3 A;  1FH0 A;  1F2A A;  3P5V A;  3F75 A;  3BCN A;  2B1N A;  5EF4 A;  3OIS A;  4HWY A;  2FTD A;  2NQD B;  4PAD A;  1F2B A;  3U8E A;  2DZY A;  2F1G A;  2P7U A;  4NV7 A;  2YJC A;  1BY8 A;  4YYQ A;  1AYV A;  2BDZ A;  2F7D A;  1KFX L;  4W5C A;  4WA6 A;  2DC6 A;  3MHS A;  1PAD A;  1O0E A;  4X6J A;  4B55 A;  2AS8 A;  1W6F A;  4YYW A;  1CQD A;  1TLO A;  3N3K A;  3ERV A;  4MZS A;  1CPJ A;  1SP4 B;  2HH5 A;  1CS8 A;  4GUZ A;  1SNK A;  4G54 A;  5JA7 A;  1EF7 A;  2VHF A;  3IEJ A;  1W4T A;  1ZIV A;  2AVW A;  4Q8G A;  1U9W A;  1U9X A;  3CBJ A;  2DCB A;  5CVO B;  1PBH A;  3V6C A;  3D9W A;  4XUI A;  3C9E A;  3MOR A;  4C5P A;  3O1G A;  2XU4 A;  3H89 A;  1M6D A;  4N4Z A;  1HUC B;  3M99 A;  5EGW A;  2AYO A;  2E03 A;  1CB5 A;  2AUZ A;  4FK5 A;  2ARY A;  4W5B A;  2FO5 A;  1NB5 A;  2BSZ A;  2JQG R;  4DMY A;  8PCH A;  1W5R A;  1PPN A;  1YK8 A;  3CH2 X;  2DC8 A;  1PPO A;  4FIP A;  1XKG A;  2JQF R;  1PPD A;  3WXF A;  3H8C A;  5CVM A;  1YVB A;  4XR7 A;  5CHT A;  1F29 A;  2DJF B;  1ICF A;  1AYU A;  3S3R A;  2XU3 A;  4MSX A;  3CH3 X;  2DC7 A;  3P5U A;  4P6E A;  1Y4H A;  2H7J A;  2YJ8 A;  4CDD B;  5J94 A;  2NQG A;  3P5X A;  3H7D A;  4QRV A;  2AIM A;  1QDQ A;  1BGO A;  4YVA A;  4QRX A;  1CV8 A;  4X6H A;  4N79 A;  4PP1 A;  2HHN A;  3I3T A;  3PW3 A;  4DMX A;  4I07 A;  3LTW A;  1KHQ A;  1NLJ A;  3IHP A;  3IUT A;  4BGF A;  1Y08 A;  3OF8 A;  9PAP A;  2XU5 A;  2VFB A;  3TNX A;  1KHP A;  2FRQ A;  1QOL A;  3AI8 A;  1QMY A;  4BS6 A;  1CVZ A;  3I06 A;  3P5W A;  1EWM A;  3O0U A;  4QRG A;  2R6N A;  1GCB A;  4BPV A;  3HHA A;  2CIO A;  3N4C A;  2AUX A;  3DF0 A;  4AXL A;  2P86 A;  3K24 A;  2C0Y A;  2OP3 A;  1ZCM A;  2CB5 A;  1E2T A;  5PAD A;  1EWO A;  3D6S A;  5K16 A;  3WXE A;  2ATO A;  2PNS A;  2BDL A;  2G8J A;  3BPM A;  1KXR A;  1YAL A;  3IOQ A;  3WXG A;  3BC3 A;  3IMA A;  3IV2 A;  2R9M A;  3V6E A;  1PIP A;  3OVX A;  1NPZ A;  2PAD A;  1ATK A;  4Q8H A;  1BQI A;  1NL6 A;  3HHI A;  4OEM A;  4YV8 A;  2Y5B A;  4CZW A;  1PXV A;  2VFC A;  3KW9 A;  3S3Q A;  1PCI A;  2E00 A;  3BWK A;  3GCB A;  1MS6 A;  2Y6E A;  5CVN B;  1POP A;  2P0R A;  1TL9 A;  4QBB A;  3PBH A;  4YYV A;  2PRE A;  2G6D A;  1VJV A;  4AXM A;  3USV A;  3E1Z B;  3K9M A;  3MHH A;  1A6R A;  3QJ3 A;  4OEL A;  1ME4 A;  4RY2 A;  1GEC E;  1PE6 A;  2VHS A;  3N3G A;  1AU2 A;  6PAD A;  4ZUX U;  1TU6 A;  1AEC A;  4N8W A;  1DEU A;  1CJL A;  2R9O A;  1MDW A;  1CTE A;  2NQA A;  1K3B B;  2R9N A;  4FJC A;  1THE A;  4I04 A;  4YYR A;  2AYN A;  2AU1 A;  3BOW A;  4CDF B;  3KWB X;  1AYW A;  1ITO A;  2NQI A;  1VSN A;  5FPW A;  4QH6 A;  1MIR A;  3PNR A;  4YYU A;  1CSB B;  3F5V A;  2E01 A;  3ZUA A;  1NQC A;  3KWZ A;  2IPP B;  2B1M A;  2YJB A;  1ME3 A;  1GLO A;  2DCA A;  3H6S A;  2DCC A;  1YK7 A;  2FUD A;  3KX1 A;  2OZ2 A;  1JQP A;  4CDC B;  1U5I A;  3NHE A;  2R9F A;  3HWN A;  4I05 A;  1S4V A;  2PBH A;  2G8E A;  4YYS A;  1KFU L;  2HXZ A;  4W4U A;  2GFO A;  4P6G A;  3HD3 A;  3KSE A;  2FQ9 A;  1MHW A;  3QT4 A;  3OVZ A;  3K8U A;  3KKU A;  5JH3 A;  2ACT A;  1EWL A;  2WBF X;  2FYE A;  1U9V A;  1DF0 A;  3MTN A;  2DC9 A;  1F2C A;  4MZO A;  2R9C A;  4PI3 A;  2XU1 A;  3QSD A;  1QXP A;  5A24 A;  2FT2 A;  3H8B A;  4BSQ A;  1MEG A;  3B79 A;  4PP2 E;  3LXS A;  1YT7 A;  3LFY A;  2DCD A;  1STF E;  5F02 A;  1GX3 A;  2E02 A;  4X6I A;  3RVV A;  2G7Y A;  2FRA A;  2IBI A;  2YJ9 A;  3BPF A;  1GMY A;  2OUL A;  3PDF A;  1AIM A;  1MEM A;  1NB3 A;  7PCK A;  1BP4 A;  5CHV A;  3RVW A;  1EWP A;  3CBK A;  4KLB A;  1PPP A;  2O6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...