1PPNA

Structure of monoclinic papain at 1.60 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Structure of Monoclinic Papain at 1.60 Angstroms Resolution
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
total genus 70
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1991-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppnA00
1YVBA 3OF8A 1NQCA 4QRGA 1DF0A 1CPJA 1MDWA 4X6IA 1SP4B 3BWKA 3MTNA 2BDLA 1AU2A 1STFE 1ME3A 2PADA 1GLOA 8PCHA 3OF9A 2VHSA 1EWOA 1MIRA 2OULA 4WA6A 4QRVA 2NQIA 3KKUA 4W5BA 3HD3A 4YYRA 2R9FA 4I07A 1AYWA 1AYUA 1U9VA 1MEGA 2DC6A 4AXLA 3K24A 3KW9A 3K8UA 5JH3A 2DC9A 2AU1A 3WXEA 1Y4HA 3MHSA 1PPDA 3I3TA 3H8CA 4DMYA 2R9OA 4AXMA 4BS5A 1F2CA 1U9QX 2CB5A 3OVZA 2NQGA 2DJGB 2AUXA 2DCCA 5PADA 1BQIA 2NQAA 2FRAA 4YYSA 3IMAA 2P7UA 3KSEA 4YYVA 4Q8HA 2JQFR 3AI8A 3O0UA 3KWBX 1BP4A 5CVOB 1EWMA 1PBHA 3P5UA 1U9WA 5EGWA 3H6SA 1BY8A 2E02A 2VHFA 4CDEB 2YJ2A 2WBFX 1ATKA 3BC3A 1AECA 2AVWA 3O1GA 4XR7A 2HD5A 5CHVA 2G6DA 1SNKA 2PBHA 5K16A 5A24A 1PXVA 3F5VA 2YJBA 2HHNA 2AYNA 5FPWA 2H7JA 1GECE 1NPZA 3RVVA 2YJ9A 3ZUAA 1YALA 3HHIA 1CVZA 3KX1A 3QT4A 3D6SA 1MEMA 3P5WA 2ACTA 4QH6A 3RVWA 1AU0A 4I05A 3P5VA 4BPVA 1PCIA 5CVNB 2G8JA 2B1NA 2B1MA 2NQDB 1Q6KA 4MZSA 3BPMA 3QJ3A 1M6DA 2FO5A 4QBBA 4X6HA 2FYEA 4P6EA 2AS8A 3V6CA 2G8EA 1CB5A 2HXZA 3M99A 4I04A 1GMYA 1KXRA 3B79A 1U9XA 3C9EA 2Y6EA 3K9MA 1YT7A 4YYWA 3MORA 1QOLA 2GHUA 6PADA 4PP2E 4X6JA 3U8EA 1PADA 7PCKA 2DCBA 2HH5A 4K7CA 3IOQA 3BOWA 1ICFA 1PPNA 3RVXA 1EWPA 1IWDA 1QDQA 5F02A 1TL9A 1GCBA 1PPOA 2FRQA 3IV2A 1KHPA 1XKGA 1PIPA 2JQGR 2R9CA 4PI3A 1X9YA 3N3KA 4FK5A 4QRXA 4YYQA 2XU1A 3LFYA 1K3BB 1KHQA 2XU4A 3OVXA 1PE6A 5J94A 1QMYA 2YJCA 2OP3A 4OEMA 3CH2X 1U5IA 3KFQA 2E00A 3PBHA 1QXPA 4CDDB 1TLOA 1FH0A 2R9NA 4PP1A 2P86A 1JQPA 1F2AA 4P6GA 3WXFA 1PPPA 2IBIA 3IHPA 1NB3A 1BGOA 3OISA 4ZUXU 2AUZA 4CZWA 2AYOA 2GFOA 3S3QA 4YVAA 1MS6A 3NHEA 4XUIA 4N8WA 4BSQA 1POPA 2O6XA 5JA7A 3KWZA 2G7YA 2DJFB 5CHTA 3H7DA 9PAPA 2PREA 1EF7A 3BCNA 3HHAA 3MHHA 1NLJA 4FIPA 1THEA 1AYVA 2XU3A 4KLBA 2E03A 1ITOA 1YK8A 3S3RA 1CJLA 2DC7A 1ME4A 2DCAA 3PNRA 3HWNA 3IEJA 3ERVA 3CH3X 4BQVA 1F29A 4W4UA 1NL6A 1CSBB 3BPFA 2ATOA 2E01A 3IUTA 1KFXL 2C0YA 2DC8A 1A6RA 1F2BA 1AU4A 1Y08A 5CVMA 3V6EA 3WXGA 4BS6A 2OZ2A 3PDFA 3PW3A 2FUDA 4PADA 3I06A 1AIMA 2FTDA 1KFUL 2XU5A 3P5XA 2FT2A 1NB5A 2BDZA 2AIMA 2DCDA 3TNXA 1CS8A 3F75A 2DZYA 1CTEA 3CBJA 4CDFB 1AU3A 1HUCB 4FJCA 2PNSA 3DF0A 1ZIVA 4G54A 4YYUA 3H8BA 3H89A 1ZCMA 3N3GA 2F7DA 2IPPB 3GCBA 4OELA 2P0RA 3CBKA 4DMXA 2Y5BA 4RY2A 5EF4A 1MHWA 3N4CA 2F1GA 4MSXA 4HWYA 4W5CA 4CDCB 4Q8GA 2FQ9A 2R6NA 1DEUA 4N79A 1YK7A 4MZOA 2DZZA 4N4ZA 1TU6A 3LXSA 1VSNA 1VJVA 2R9MA 1CV8A 1O0EA 1EWLA 2YJ8A 1S4VA 3USVA 3E1ZB 2ARYA 2CIOA 3QSDA 4YV8A 1CQDA
chains in the Genus database with same CATH superfamily
1YVBA 3B21A 3OF8A 1NQCA 4QRGA 1DF0A 1CPJA 1MDWA 4X6IA 1SP4B 3BWKA 3MTNA 2BDLA 1AU2A 3PHXA 1STFE 1ME3A 2PADA 1GLOA 8PCHA 3OF9A 4D8EA 2VHSA 1EWOA 4REZA 1MIRA 2OULA 4PT5A 4WA6A 4HXDB 4QRVA 4RKXA 2NQIA 3KKUA 4W5BA 3HD3A 4YYRA 2R9FA 4I07A 1AYWA 1AYUA 1U9VA 1MEGA 2DC6A 4AXLA 3K24A 3KW9A 3K8UA 5JH3A 2DC9A 2AU1A 4OVZA 3WXEA 1Y4HA 3MHSA 1PPDA 3I3TA 3H8CA 4DMYA 2R9OA 4AXMA 3RNVA 4BS5A 1F2CA 1U9QX 2CB5A 3OVZA 2NQGA 2DJGB 2AUXA 2DCCA 5PADA 1BQIA 2NQAA 2J7QC 2FRAA 4YYSA 3IMAA 2P7UA 3KSEA 4IUMA 4OW0A 4YYVA 4Q8HA 2BTWB 2JQFR 3AI8A 3O0UA 3KWBX 1BP4A 2UZJA 5CVOB 1EWMA 1PBHA 3P5UA 1U9WA 5EGWA 3H6SA 1BY8A 2E02A 2VHFA 4CDEB 2YJ2A 2WBFX 1ATKA 3BC3A 1AECA 2AVWA 3O1GA 4XR7A 2HD5A 5CHVA 2G6DA 5E6JA 3IFUA 1SNKA 2PBHA 5K16A 5A24A 1PXVA 3F5VA 2YJBA 2FE8A 2HHNA 2AYNA 5FPWA 2H7JA 1GECE 1NPZA 3RVVA 3O65A 3TRKA 3OQCA 2YJ9A 3ZUAA 1YALA 3HHIA 1CVZA 4BOUA 3KX1A 3QT4A 3D6SA 1MEMA 3P5WA 2ACTA 4QH6A 3RVWA 1AU0A 4I05A 3P5VA 4BPVA 1PCIA 5CVNB 1DKIA 2DOSA 2G8JA 2B1NA 2B1MA 3MP2A 2NQDB 1PVJA 1Q6KA 4MZSA 3BPMA 3QJ3A 1M6DA 2FO5A 4QBBA 4X6HA 2FYEA 1YZBA 2AGAA 3BB7A 4P6EA 3E9SA 2AS8A 3V6CA 2G8EA 1CB5A 2HXZA 4ZTBA 3M99A 4I04A 1GMYA 1KXRA 3B79A 1U9XA 3C9EA 2Y6EA 3K9MA 1YT7A 4YYWA 3MORA 3PHUA 1QOLA 2GHUA 6PADA 4RF1A 4PP2E 4X6JA 3U8EA 3W30A 1PADA 5EZSA 7PCKA 2DCBA 2HH5A 4K7CA 3IOQA 3BOWA 1ICFA 1PPNA 3RVXA 1EWPA 1IWDA 1QDQA 4R3DA 5F02A 1TL9A 4D8BA 1GCBA 1PPOA 2FRQA 3IV2A 1KHPA 1XKGA 1PIPA 2JQGR 2R9CA 4P16A 4PI3A 1X9YA 3N3KA 4FK5A 5KO3A 4QRXA 4YYQA 2XU1A 3LFYA 1K3BB 1KHQA 2XU4A 3BY4A 3OVXA 1PE6A 5J94A 1QMYA 2YJCA 2OP3A 4OEMA 3CH2X 1U5IA 4M0WA 3KFQA 2E00A 3PBHA 1QXPA 4CDDB 3MTVA 2JRIA 5JZEA 1TLOA 1FH0A 2R9NA 4PP1A 3W31A 2BTWA 2P86A 1JQPA 2BU3A 1F2AA 4BOSA 4P6GA 3WXFA 1PPPA 2IBIA 3IHPA 1NB3A 1BGOA 4MM3B 3TMPA 3OISA 4ZUXU 2AUZA 4CZWA 2AYOA 2GFOA 3S3QA 4YVAA 1MS6A 2J7QA 3NHEA 4WURA 4XUIA 4N8WA 4BSQA 1POPA 2O6XA 5JA7A 3KWZA 2G7YA 3PRPA 2DJFB 5CHTA 3H7DA 9PAPA 2PREA 1EF7A 3BCNA 3HHAA 3MHHA 1NLJA 4OVZB 4FIPA 1THEA 1AYVA 2XU3A 4KLBA 2E03A 1ITOA 1YK8A 3S3RA 1CJLA 2DC7A 1ME4A 2DCAA 3PNRA 3HWNA 3IEJA 3ERVA 5EZQA 3CH3X 4BQVA 1F29A 4W4UA 1NL6A 1CSBB 3BPFA 2ATOA 3BBAA 2E01A 3IUTA 2JTCA 1KFXL 2C0YA 2DC8A 4GUAA 1A6RA 1F2BA 1AU4A 1Y08A 5CVMA 3V6EA 3WXGA 4BS6A 2OZ2A 3PDFA 3PW3A 2FUDA 4PADA 3I06A 1AIMA 2FTDA 1KFUL 2XU5A 3P5XA 2FT2A 1NB5A 3ZNHA 2BDZA 2AIMA 2DCDA 3TNXA 4D8IA 1CS8A 3F75A 2DZYA 1CTEA 4BOZA 2HWKA 3CBJA 4CDFB 1AU3A 1HUCB 4FJCA 4IP3A 4RNAA 2PNSA 3DF0A 1UKFA 1ZIVA 4G54A 4YYUA 3H8BA 3H89A 1ZCMA 3N3GA 2F7DA 2IPPB 3GCBA 4A5UA 2Z84A 4OELA 2P0RA 4BOQA 3CBKA 4DMXA 2Y5BA 4RY2A 5EF4A 1MHWA 3N4CA 3PSEA 2F1GA 4MSXA 4HWYA 4W5CA 4CDCB 4Q8GA 2FQ9A 4XZXA 2R6NA 1DEUA 3PRMA 4N79A 3C0RA 1YK7A 3PHWA 4MI7A 4MZOA 4BOPA 2DZZA 4N4ZA 3PT2A 1TU6A 3LXSA 1VSNA 4RF0A 1VJVA 2R9MA 1CV8A 1O0EA 1EWLA 2YJ8A 1S4VA 3USVA 3E1ZB 2ARYA 2CIOA 3MJ5A 3QSDA 4YV8A 1CQDA
chains in the Genus database with same CATH topology
1YVBA 3OF8A 1NQCA 4QRGA 1DF0A 1CPJA 1MDWA 4X6IA 1SP4B 3BWKA 4GUZA 3MTNA 2BDLA 1AU2A 1STFE 1ME3A 2PADA 1GLOA 8PCHA 3OF9A 2VHSA 1EWOA 1MIRA 2VFBA 2OULA 4WA6A 4QRVA 2NQIA 3KKUA 4W5BA 3HD3A 4YYRA 2R9FA 4I07A 1AYWA 1AYUA 1U9VA 1MEGA 2DC6A 4AXLA 3K24A 3KW9A 3K8UA 5JH3A 2DC9A 2AU1A 3WXEA 1Y4HA 3MHSA 1PPDA 3I3TA 3H8CA 4DMYA 2R9OA 4AXMA 4BS5A 1F2CA 1U9QX 2CB5A 3OVZA 2NQGA 2DJGB 2AUXA 2DCCA 3LTWA 5PADA 1BQIA 2NQAA 2FRAA 4YYSA 3IMAA 2P7UA 3KSEA 4YYVA 4Q8HA 2JQFR 3AI8A 3O0UA 3KWBX 1BP4A 5CVOB 1EWMA 1PBHA 3P5UA 1U9WA 5EGWA 3H6SA 1BY8A 2E02A 2VHFA 4CDEB 2YJ2A 2WBFX 1ATKA 3BC3A 1AECA 2AVWA 3O1GA 4XR7A 2HD5A 5CHVA 2G6DA 1SNKA 2PBHA 5K16A 5A24A 1PXVA 3F5VA 2YJBA 2HHNA 2AYNA 5FPWA 2H7JA 1GECE 1NPZA 3RVVA 2YJ9A 3ZUAA 1YALA 3HHIA 1CVZA 3KX1A 3QT4A 3D6SA 1MEMA 3P5WA 2ACTA 4QH6A 3RVWA 1AU0A 4I05A 3P5VA 4BPVA 1PCIA 5CVNB 2G8JA 2B1NA 2B1MA 2NQDB 1Q6KA 4MZSA 3BPMA 3QJ3A 1M6DA 2FO5A 4QBBA 4X6HA 2FYEA 4P6EA 2AS8A 3V6CA 2G8EA 1CB5A 2HXZA 3M99A 4I04A 1W5RA 1GMYA 1KXRA 3B79A 1U9XA 3C9EA 1GX3A 2Y6EA 3K9MA 1YT7A 4YYWA 3MORA 4BGFA 1QOLA 2GHUA 6PADA 4PP2E 4X6JA 3U8EA 1PADA 7PCKA 2DCBA 2HH5A 4K7CA 3IOQA 3BOWA 1ICFA 1PPNA 3RVXA 1EWPA 1E2TA 1IWDA 1QDQA 5F02A 1W4TA 1TL9A 1GCBA 1PPOA 2FRQA 3IV2A 1KHPA 1XKGA 1PIPA 2JQGR 2R9CA 4PI3A 1X9YA 3N3KA 4FK5A 4QRXA 4YYQA 2XU1A 3LFYA 1K3BB 1KHQA 2XU4A 3OVXA 4NV8A 1PE6A 5J94A 1QMYA 2YJCA 2OP3A 4OEMA 3CH2X 1U5IA 3KFQA 2E00A 3PBHA 1QXPA 4CDDB 1TLOA 1FH0A 2R9NA 4PP1A 2P86A 1JQPA 1F2AA 4P6GA 3WXFA 1PPPA 2IBIA 3IHPA 1NB3A 1BGOA 3OISA 4ZUXU 2AUZA 4CZWA 2AYOA 2GFOA 3S3QA 4YVAA 1MS6A 3NHEA 4XUIA 4N8WA 4BSQA 1POPA 2O6XA 5JA7A 3KWZA 2G7YA 2DJFB 5CHTA 3H7DA 9PAPA 2PREA 1EF7A 3BCNA 3HHAA 3MHHA 1NLJA 4FIPA 1THEA 1AYVA 2XU3A 4KLBA 2E03A 1ITOA 1YK8A 3S3RA 1CJLA 2DC7A 1ME4A 3D9WA 2DCAA 3PNRA 3HWNA 3IEJA 3ERVA 3CH3X 4BQVA 1F29A 4W4UA 1NL6A 1CSBB 2VFCA 3BPFA 2ATOA 2E01A 3IUTA 1KFXL 2C0YA 2DC8A 1A6RA 1F2BA 1AU4A 1Y08A 4NV7A 5CVMA 3V6EA 4B55A 3WXGA 4BS6A 2OZ2A 3PDFA 3PW3A 2FUDA 4PADA 3I06A 1AIMA 2FTDA 1KFUL 2XU5A 3P5XA 1W6FA 2FT2A 1NB5A 2BDZA 2AIMA 2DCDA 3TNXA 1CS8A 3F75A 2DZYA 1CTEA 3CBJA 4CDFB 1AU3A 1HUCB 4FJCA 2PNSA 3DF0A 1ZIVA 4G54A 4YYUA 3H8BA 3H89A 1ZCMA 3N3GA 2F7DA 2IPPB 3GCBA 4OELA 2BSZA 2P0RA 3CBKA 4DMXA 2Y5BA 4RY2A 5EF4A 1MHWA 3N4CA 2F1GA 4MSXA 4HWYA 4W5CA 4CDCB 4Q8GA 2FQ9A 2R6NA 1DEUA 4C5PA 4N79A 1YK7A 4MZOA 2DZZA 4N4ZA 1TU6A 3LXSA 1VSNA 1VJVA 2R9MA 1CV8A 1O0EA 1EWLA 2YJ8A 1S4VA 3USVA 3E1ZB 2ARYA 2CIOA 3QSDA 4YV8A 1CQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB A;  3OF8 A;  1NQC A;  4QRG A;  1DF0 A;  1CPJ A;  1MDW A;  4X6I A;  1SP4 B;  3BWK A;  3MTN A;  2BDL A;  1AU2 A;  1STF E;  1ME3 A;  2PAD A;  1GLO A;  8PCH A;  3OF9 A;  2VHS A;  1EWO A;  1MIR A;  2OUL A;  4WA6 A;  4QRV A;  2NQI A;  3KKU A;  4W5B A;  3HD3 A;  4YYR A;  2R9F A;  4I07 A;  1AYW A;  1AYU A;  1U9V A;  1MEG A;  2DC6 A;  4AXL A;  3K24 A;  3KW9 A;  3K8U A;  5JH3 A;  2DC9 A;  2AU1 A;  3WXE A;  1Y4H A;  3MHS A;  1PPD A;  3I3T A;  3H8C A;  4DMY A;  2R9O A;  4AXM A;  4BS5 A;  1F2C A;  1U9Q X;  2CB5 A;  3OVZ A;  2NQG A;  2DJG B;  2AUX A;  2DCC A;  5PAD A;  1BQI A;  2NQA A;  2FRA A;  4YYS A;  3IMA A;  2P7U A;  3KSE A;  4YYV A;  4Q8H A;  2JQF R;  3AI8 A;  3O0U A;  3KWB X;  1BP4 A;  5CVO B;  1EWM A;  1PBH A;  3P5U A;  1U9W A;  5EGW A;  3H6S A;  1BY8 A;  2E02 A;  2VHF A;  4CDE B;  2YJ2 A;  2WBF X;  1ATK A;  3BC3 A;  1AEC A;  2AVW A;  3O1G A;  4XR7 A;  2HD5 A;  5CHV A;  2G6D A;  1SNK A;  2PBH A;  5K16 A;  5A24 A;  1PXV A;  3F5V A;  2YJB A;  2HHN A;  2AYN A;  5FPW A;  2H7J A;  1GEC E;  1NPZ A;  3RVV A;  2YJ9 A;  3ZUA A;  1YAL A;  3HHI A;  1CVZ A;  3KX1 A;  3QT4 A;  3D6S A;  1MEM A;  3P5W A;  2ACT A;  4QH6 A;  3RVW A;  1AU0 A;  4I05 A;  3P5V A;  4BPV A;  1PCI A;  5CVN B;  2G8J A;  2B1N A;  2B1M A;  2NQD B;  1Q6K A;  4MZS A;  3BPM A;  3QJ3 A;  1M6D A;  2FO5 A;  4QBB A;  4X6H A;  2FYE A;  4P6E A;  2AS8 A;  3V6C A;  2G8E A;  1CB5 A;  2HXZ A;  3M99 A;  4I04 A;  1GMY A;  1KXR A;  3B79 A;  1U9X A;  3C9E A;  2Y6E A;  3K9M A;  1YT7 A;  4YYW A;  3MOR A;  1QOL A;  2GHU A;  6PAD A;  4PP2 E;  4X6J A;  3U8E A;  1PAD A;  7PCK A;  2DCB A;  2HH5 A;  4K7C A;  3IOQ A;  3BOW A;  1ICF A;  1PPN A;  3RVX A;  1EWP A;  1IWD A;  1QDQ A;  5F02 A;  1TL9 A;  1GCB A;  1PPO A;  2FRQ A;  3IV2 A;  1KHP A;  1XKG A;  1PIP A;  2JQG R;  2R9C A;  4PI3 A;  1X9Y A;  3N3K A;  4FK5 A;  4QRX A;  4YYQ A;  2XU1 A;  3LFY A;  1K3B B;  1KHQ A;  2XU4 A;  3OVX A;  1PE6 A;  5J94 A;  1QMY A;  2YJC A;  2OP3 A;  4OEM A;  3CH2 X;  1U5I A;  3KFQ A;  2E00 A;  3PBH A;  1QXP A;  4CDD B;  1TLO A;  1FH0 A;  2R9N A;  4PP1 A;  2P86 A;  1JQP A;  1F2A A;  4P6G A;  3WXF A;  1PPP A;  2IBI A;  3IHP A;  1NB3 A;  1BGO A;  3OIS A;  4ZUX U;  2AUZ A;  4CZW A;  2AYO A;  2GFO A;  3S3Q A;  4YVA A;  1MS6 A;  3NHE A;  4XUI A;  4N8W A;  4BSQ A;  1POP A;  2O6X A;  5JA7 A;  3KWZ A;  2G7Y A;  2DJF B;  5CHT A;  3H7D A;  9PAP A;  2PRE A;  1EF7 A;  3BCN A;  3HHA A;  3MHH A;  1NLJ A;  4FIP A;  1THE A;  1AYV A;  2XU3 A;  4KLB A;  2E03 A;  1ITO A;  1YK8 A;  3S3R A;  1CJL A;  2DC7 A;  1ME4 A;  2DCA A;  3PNR A;  3HWN A;  3IEJ A;  3ERV A;  3CH3 X;  4BQV A;  1F29 A;  4W4U A;  1NL6 A;  1CSB B;  3BPF A;  2ATO A;  2E01 A;  3IUT A;  1KFX L;  2C0Y A;  2DC8 A;  1A6R A;  1F2B A;  1AU4 A;  1Y08 A;  5CVM A;  3V6E A;  3WXG A;  4BS6 A;  2OZ2 A;  3PDF A;  3PW3 A;  2FUD A;  4PAD A;  3I06 A;  1AIM A;  2FTD A;  1KFU L;  2XU5 A;  3P5X A;  2FT2 A;  1NB5 A;  2BDZ A;  2AIM A;  2DCD A;  3TNX A;  1CS8 A;  3F75 A;  2DZY A;  1CTE A;  3CBJ A;  4CDF B;  1AU3 A;  1HUC B;  4FJC A;  2PNS A;  3DF0 A;  1ZIV A;  4G54 A;  4YYU A;  3H8B A;  3H89 A;  1ZCM A;  3N3G A;  2F7D A;  2IPP B;  3GCB A;  4OEL A;  2P0R A;  3CBK A;  4DMX A;  2Y5B A;  4RY2 A;  5EF4 A;  1MHW A;  3N4C A;  2F1G A;  4MSX A;  4HWY A;  4W5C A;  4CDC B;  4Q8G A;  2FQ9 A;  2R6N A;  1DEU A;  4N79 A;  1YK7 A;  4MZO A;  2DZZ A;  4N4Z A;  1TU6 A;  3LXS A;  1VSN A;  1VJV A;  2R9M A;  1CV8 A;  1O0E A;  1EWL A;  2YJ8 A;  1S4V A;  3USV A;  3E1Z B;  2ARY A;  2CIO A;  3QSD A;  4YV8 A;  1CQD A; 
#chains in the Genus database with same CATH topology
 1YVB A;  3B21 A;  3OF8 A;  1NQC A;  4QRG A;  1DF0 A;  1CPJ A;  1MDW A;  4X6I A;  1SP4 B;  3BWK A;  3MTN A;  2BDL A;  1AU2 A;  3PHX A;  1STF E;  1ME3 A;  2PAD A;  1GLO A;  8PCH A;  3OF9 A;  4D8E A;  2VHS A;  1EWO A;  4REZ A;  1MIR A;  2OUL A;  4PT5 A;  4WA6 A;  4HXD B;  4QRV A;  4RKX A;  2NQI A;  3KKU A;  4W5B A;  3HD3 A;  4YYR A;  2R9F A;  4I07 A;  1AYW A;  1AYU A;  1U9V A;  1MEG A;  2DC6 A;  4AXL A;  3K24 A;  3KW9 A;  3K8U A;  5JH3 A;  2DC9 A;  2AU1 A;  4OVZ A;  3WXE A;  1Y4H A;  3MHS A;  1PPD A;  3I3T A;  3H8C A;  4DMY A;  2R9O A;  4AXM A;  3RNV A;  4BS5 A;  1F2C A;  1U9Q X;  2CB5 A;  3OVZ A;  2NQG A;  2DJG B;  2AUX A;  2DCC A;  5PAD A;  1BQI A;  2NQA A;  2J7Q C;  2FRA A;  4YYS A;  3IMA A;  2P7U A;  3KSE A;  4IUM A;  4OW0 A;  4YYV A;  4Q8H A;  2BTW B;  2JQF R;  3AI8 A;  3O0U A;  3KWB X;  1BP4 A;  2UZJ A;  5CVO B;  1EWM A;  1PBH A;  3P5U A;  1U9W A;  5EGW A;  3H6S A;  1BY8 A;  2E02 A;  2VHF A;  4CDE B;  2YJ2 A;  2WBF X;  1ATK A;  3BC3 A;  1AEC A;  2AVW A;  3O1G A;  4XR7 A;  2HD5 A;  5CHV A;  2G6D A;  5E6J A;  3IFU A;  1SNK A;  2PBH A;  5K16 A;  5A24 A;  1PXV A;  3F5V A;  2YJB A;  2FE8 A;  2HHN A;  2AYN A;  5FPW A;  2H7J A;  1GEC E;  1NPZ A;  3RVV A;  3O65 A;  3TRK A;  3OQC A;  2YJ9 A;  3ZUA A;  1YAL A;  3HHI A;  1CVZ A;  4BOU A;  3KX1 A;  3QT4 A;  3D6S A;  1MEM A;  3P5W A;  2ACT A;  4QH6 A;  3RVW A;  1AU0 A;  4I05 A;  3P5V A;  4BPV A;  1PCI A;  5CVN B;  1DKI A;  2DOS A;  2G8J A;  2B1N A;  2B1M A;  3MP2 A;  2NQD B;  1PVJ A;  1Q6K A;  4MZS A;  3BPM A;  3QJ3 A;  1M6D A;  2FO5 A;  4QBB A;  4X6H A;  2FYE A;  1YZB A;  2AGA A;  3BB7 A;  4P6E A;  3E9S A;  2AS8 A;  3V6C A;  2G8E A;  1CB5 A;  2HXZ A;  4ZTB A;  3M99 A;  4I04 A;  1GMY A;  1KXR A;  3B79 A;  1U9X A;  3C9E A;  2Y6E A;  3K9M A;  1YT7 A;  4YYW A;  3MOR A;  3PHU A;  1QOL A;  2GHU A;  6PAD A;  4RF1 A;  4PP2 E;  4X6J A;  3U8E A;  3W30 A;  1PAD A;  5EZS A;  7PCK A;  2DCB A;  2HH5 A;  4K7C A;  3IOQ A;  3BOW A;  1ICF A;  1PPN A;  3RVX A;  1EWP A;  1IWD A;  1QDQ A;  4R3D A;  5F02 A;  1TL9 A;  4D8B A;  1GCB A;  1PPO A;  2FRQ A;  3IV2 A;  1KHP A;  1XKG A;  1PIP A;  2JQG R;  2R9C A;  4P16 A;  4PI3 A;  1X9Y A;  3N3K A;  4FK5 A;  5KO3 A;  4QRX A;  4YYQ A;  2XU1 A;  3LFY A;  1K3B B;  1KHQ A;  2XU4 A;  3BY4 A;  3OVX A;  1PE6 A;  5J94 A;  1QMY A;  2YJC A;  2OP3 A;  4OEM A;  3CH2 X;  1U5I A;  4M0W A;  3KFQ A;  2E00 A;  3PBH A;  1QXP A;  4CDD B;  3MTV A;  2JRI A;  5JZE A;  1TLO A;  1FH0 A;  2R9N A;  4PP1 A;  3W31 A;  2BTW A;  2P86 A;  1JQP A;  2BU3 A;  1F2A A;  4BOS A;  4P6G A;  3WXF A;  1PPP A;  2IBI A;  3IHP A;  1NB3 A;  1BGO A;  4MM3 B;  3TMP A;  3OIS A;  4ZUX U;  2AUZ A;  4CZW A;  2AYO A;  2GFO A;  3S3Q A;  4YVA A;  1MS6 A;  2J7Q A;  3NHE A;  4WUR A;  4XUI A;  4N8W A;  4BSQ A;  1POP A;  2O6X A;  5JA7 A;  3KWZ A;  2G7Y A;  3PRP A;  2DJF B;  5CHT A;  3H7D A;  9PAP A;  2PRE A;  1EF7 A;  3BCN A;  3HHA A;  3MHH A;  1NLJ A;  4OVZ B;  4FIP A;  1THE A;  1AYV A;  2XU3 A;  4KLB A;  2E03 A;  1ITO A;  1YK8 A;  3S3R A;  1CJL A;  2DC7 A;  1ME4 A;  2DCA A;  3PNR A;  3HWN A;  3IEJ A;  3ERV A;  5EZQ A;  3CH3 X;  4BQV A;  1F29 A;  4W4U A;  1NL6 A;  1CSB B;  3BPF A;  2ATO A;  3BBA A;  2E01 A;  3IUT A;  2JTC A;  1KFX L;  2C0Y A;  2DC8 A;  4GUA A;  1A6R A;  1F2B A;  1AU4 A;  1Y08 A;  5CVM A;  3V6E A;  3WXG A;  4BS6 A;  2OZ2 A;  3PDF A;  3PW3 A;  2FUD A;  4PAD A;  3I06 A;  1AIM A;  2FTD A;  1KFU L;  2XU5 A;  3P5X A;  2FT2 A;  1NB5 A;  3ZNH A;  2BDZ A;  2AIM A;  2DCD A;  3TNX A;  4D8I A;  1CS8 A;  3F75 A;  2DZY A;  1CTE A;  4BOZ A;  2HWK A;  3CBJ A;  4CDF B;  1AU3 A;  1HUC B;  4FJC A;  4IP3 A;  4RNA A;  2PNS A;  3DF0 A;  1UKF A;  1ZIV A;  4G54 A;  4YYU A;  3H8B A;  3H89 A;  1ZCM A;  3N3G A;  2F7D A;  2IPP B;  3GCB A;  4A5U A;  2Z84 A;  4OEL A;  2P0R A;  4BOQ A;  3CBK A;  4DMX A;  2Y5B A;  4RY2 A;  5EF4 A;  1MHW A;  3N4C A;  3PSE A;  2F1G A;  4MSX A;  4HWY A;  4W5C A;  4CDC B;  4Q8G A;  2FQ9 A;  4XZX A;  2R6N A;  1DEU A;  3PRM A;  4N79 A;  3C0R A;  1YK7 A;  3PHW A;  4MI7 A;  4MZO A;  4BOP A;  2DZZ A;  4N4Z A;  3PT2 A;  1TU6 A;  3LXS A;  1VSN A;  4RF0 A;  1VJV A;  2R9M A;  1CV8 A;  1O0E A;  1EWL A;  2YJ8 A;  1S4V A;  3USV A;  3E1Z B;  2ARY A;  2CIO A;  3MJ5 A;  3QSD A;  4YV8 A;  1CQD A; 
#chains in the Genus database with same CATH homology
 1YVB A;  3OF8 A;  1NQC A;  4QRG A;  1DF0 A;  1CPJ A;  1MDW A;  4X6I A;  1SP4 B;  3BWK A;  4GUZ A;  3MTN A;  2BDL A;  1AU2 A;  1STF E;  1ME3 A;  2PAD A;  1GLO A;  8PCH A;  3OF9 A;  2VHS A;  1EWO A;  1MIR A;  2VFB A;  2OUL A;  4WA6 A;  4QRV A;  2NQI A;  3KKU A;  4W5B A;  3HD3 A;  4YYR A;  2R9F A;  4I07 A;  1AYW A;  1AYU A;  1U9V A;  1MEG A;  2DC6 A;  4AXL A;  3K24 A;  3KW9 A;  3K8U A;  5JH3 A;  2DC9 A;  2AU1 A;  3WXE A;  1Y4H A;  3MHS A;  1PPD A;  3I3T A;  3H8C A;  4DMY A;  2R9O A;  4AXM A;  4BS5 A;  1F2C A;  1U9Q X;  2CB5 A;  3OVZ A;  2NQG A;  2DJG B;  2AUX A;  2DCC A;  3LTW A;  5PAD A;  1BQI A;  2NQA A;  2FRA A;  4YYS A;  3IMA A;  2P7U A;  3KSE A;  4YYV A;  4Q8H A;  2JQF R;  3AI8 A;  3O0U A;  3KWB X;  1BP4 A;  5CVO B;  1EWM A;  1PBH A;  3P5U A;  1U9W A;  5EGW A;  3H6S A;  1BY8 A;  2E02 A;  2VHF A;  4CDE B;  2YJ2 A;  2WBF X;  1ATK A;  3BC3 A;  1AEC A;  2AVW A;  3O1G A;  4XR7 A;  2HD5 A;  5CHV A;  2G6D A;  1SNK A;  2PBH A;  5K16 A;  5A24 A;  1PXV A;  3F5V A;  2YJB A;  2HHN A;  2AYN A;  5FPW A;  2H7J A;  1GEC E;  1NPZ A;  3RVV A;  2YJ9 A;  3ZUA A;  1YAL A;  3HHI A;  1CVZ A;  3KX1 A;  3QT4 A;  3D6S A;  1MEM A;  3P5W A;  2ACT A;  4QH6 A;  3RVW A;  1AU0 A;  4I05 A;  3P5V A;  4BPV A;  1PCI A;  5CVN B;  2G8J A;  2B1N A;  2B1M A;  2NQD B;  1Q6K A;  4MZS A;  3BPM A;  3QJ3 A;  1M6D A;  2FO5 A;  4QBB A;  4X6H A;  2FYE A;  4P6E A;  2AS8 A;  3V6C A;  2G8E A;  1CB5 A;  2HXZ A;  3M99 A;  4I04 A;  1W5R A;  1GMY A;  1KXR A;  3B79 A;  1U9X A;  3C9E A;  1GX3 A;  2Y6E A;  3K9M A;  1YT7 A;  4YYW A;  3MOR A;  4BGF A;  1QOL A;  2GHU A;  6PAD A;  4PP2 E;  4X6J A;  3U8E A;  1PAD A;  7PCK A;  2DCB A;  2HH5 A;  4K7C A;  3IOQ A;  3BOW A;  1ICF A;  1PPN A;  3RVX A;  1EWP A;  1E2T A;  1IWD A;  1QDQ A;  5F02 A;  1W4T A;  1TL9 A;  1GCB A;  1PPO A;  2FRQ A;  3IV2 A;  1KHP A;  1XKG A;  1PIP A;  2JQG R;  2R9C A;  4PI3 A;  1X9Y A;  3N3K A;  4FK5 A;  4QRX A;  4YYQ A;  2XU1 A;  3LFY A;  1K3B B;  1KHQ A;  2XU4 A;  3OVX A;  4NV8 A;  1PE6 A;  5J94 A;  1QMY A;  2YJC A;  2OP3 A;  4OEM A;  3CH2 X;  1U5I A;  3KFQ A;  2E00 A;  3PBH A;  1QXP A;  4CDD B;  1TLO A;  1FH0 A;  2R9N A;  4PP1 A;  2P86 A;  1JQP A;  1F2A A;  4P6G A;  3WXF A;  1PPP A;  2IBI A;  3IHP A;  1NB3 A;  1BGO A;  3OIS A;  4ZUX U;  2AUZ A;  4CZW A;  2AYO A;  2GFO A;  3S3Q A;  4YVA A;  1MS6 A;  3NHE A;  4XUI A;  4N8W A;  4BSQ A;  1POP A;  2O6X A;  5JA7 A;  3KWZ A;  2G7Y A;  2DJF B;  5CHT A;  3H7D A;  9PAP A;  2PRE A;  1EF7 A;  3BCN A;  3HHA A;  3MHH A;  1NLJ A;  4FIP A;  1THE A;  1AYV A;  2XU3 A;  4KLB A;  2E03 A;  1ITO A;  1YK8 A;  3S3R A;  1CJL A;  2DC7 A;  1ME4 A;  3D9W A;  2DCA A;  3PNR A;  3HWN A;  3IEJ A;  3ERV A;  3CH3 X;  4BQV A;  1F29 A;  4W4U A;  1NL6 A;  1CSB B;  2VFC A;  3BPF A;  2ATO A;  2E01 A;  3IUT A;  1KFX L;  2C0Y A;  2DC8 A;  1A6R A;  1F2B A;  1AU4 A;  1Y08 A;  4NV7 A;  5CVM A;  3V6E A;  4B55 A;  3WXG A;  4BS6 A;  2OZ2 A;  3PDF A;  3PW3 A;  2FUD A;  4PAD A;  3I06 A;  1AIM A;  2FTD A;  1KFU L;  2XU5 A;  3P5X A;  1W6F A;  2FT2 A;  1NB5 A;  2BDZ A;  2AIM A;  2DCD A;  3TNX A;  1CS8 A;  3F75 A;  2DZY A;  1CTE A;  3CBJ A;  4CDF B;  1AU3 A;  1HUC B;  4FJC A;  2PNS A;  3DF0 A;  1ZIV A;  4G54 A;  4YYU A;  3H8B A;  3H89 A;  1ZCM A;  3N3G A;  2F7D A;  2IPP B;  3GCB A;  4OEL A;  2BSZ A;  2P0R A;  3CBK A;  4DMX A;  2Y5B A;  4RY2 A;  5EF4 A;  1MHW A;  3N4C A;  2F1G A;  4MSX A;  4HWY A;  4W5C A;  4CDC B;  4Q8G A;  2FQ9 A;  2R6N A;  1DEU A;  4C5P A;  4N79 A;  1YK7 A;  4MZO A;  2DZZ A;  4N4Z A;  1TU6 A;  3LXS A;  1VSN A;  1VJV A;  2R9M A;  1CV8 A;  1O0E A;  1EWL A;  2YJ8 A;  1S4V A;  3USV A;  3E1Z B;  2ARY A;  2CIO A;  3QSD A;  4YV8 A;  1CQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...