3M99A

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
470
structure length
422
Chain Sequence
SICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQDAHEFWQFIINQIHQSYVLDLPNAKNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 111
structure length 422
sequence length 470
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3m99A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3m99A02
3M99A 1X4JA 4UP5A 2YQLA 2YUCA 2MT5A 2PREA 2VNFA 1QDQA 2F6JA 2AYOA 2XU3A 4KLBA 4A0CD 4P6GA 4QBBA 2FRQA 2C2VS 4MSXA 1VSNA 4L58A 4LLBA 1MM2A 2IBIA 2VJFB 2MD7B 2VP7A 3OVXA 2G43A 3KV6A 2OULA 4WA6A 3WXGA 1PPOA 1GCBA 2VJFA 4YYRA 2YJ2A 4K7CA 3P5WA 4UI9B 1YVBA 4AXMA 2RSDA 1EWLA 4W5BA 5B76A 3MHHA 4LADB 5DINA 2G6DA 4YYSA 1QOLA 3ERVA 2NQGA 3B79A 1MM3A 2YREA 5FPWA 1TL9A 4B86C 1WESA 2M3HA 2OXQC 1U9XA 3CBKA 1E4UA 1WEMA 4YYUA 4YBMA 3H8CA 2R9FA 4QRVA 1PPPA 1MDWA 3O35A 2MIQA 2EGPA 2YSJA 2LGKA 2VPEA 3KQIA 3MTNA 4XUIA 3QSDA 1U9WA 2NQAA 2EA6A 3HCUA 3KWZA 2VPBA 3BWKA 2FUIA 3EB5A 1SP4B 3RPGB 3SOUA 1U9VA 2KFTA 3DQVR 1MIRA 2AN6A 3O0UA 5K16A 3CH2X 2YT5A 4CDFB 2EODA 1IYMA 2F42A 4WZ2A 3C6WA 1KHPA 2E6SA 5FB1A 5KH3A 2XB1A 1JQPA 2XU4A 1AYVA 2LGGA 3K24A 1CPJA 3H89A 2CB5A 2LGVA 3QZVA 4PPEA 3EB6A 2DC7A 5J94A 4YVAA 1GMYA 5G04B 1Q6KA 4PI3A 2YHOA 2IPPB 3O70A 1ME3A 3KX1A 1FBVA 5LKXA 2YSMA 1QXPA 1XKGA 2DC8A 2ECGA 4FIPA 4A49A 3PDFA 5H1VA 1WEWA 2E00A 2KWOA 3KNVA 4C9ZA 1K2FA 2OP3A 2KYUA 2PBHA 3BPMA 4BQVA 2VHSA 3PUQA 2ACTA 2WBFX 2AUXA 2R9NA 1AYUA 2K17A 5I3LA 1BP4A 2VJEB 1F2CA 4YC9A 1NB3A 1EF7A 1BY8A 4CDEB 4B7YC 4CZWA 1M6DA 2GHUA 3P5XA 5PADA 2VJEA 2DCAA 4QF3A 3N3GA 5H1TA 2KIZA 2PADA 3BPFA 1NB5A 2H0DA 4YADA 2BAYA 5B79A 3PNRA 1STFE 4MZSA 4QRGA 1WEPA 3GV4A 3O34A 4AUQB 4UP0A 4GNFA 3K8UA 1U5IA 3BOWA 3IOQA 2R9OA 1K3BB 3OF9A 3U5PA 3H8BA 4S3OB 1X4UA 4WZ3B 1YK7A 4GNDA 3DPLR 2ECWA 2CIOA 1DVPA 2R9MA 2P0RA 3GL6A 3N9OA 4QRXA 3KWBX 1WIMA 3IUTA 2LQ6A 3P5VA 4R2YA 1Y4HA 3ZVYA 4BBQA 3FL2A 1GLOA 5LKTA 1S4VA 2L43A 2XU5A 2KREA 1A6RA 2DCCA 4BS5A 2VHFA 1V87A 4FO9A 2ARYA 4AYCA 5TRBA 1T1HA 3SHBA 5JH3A 1ME4A 3CBJA 2AU1A 3BC3A 1THEA 4V3KC 5FB0A 3ZNIA 2HYED 4PADA 3OVZA 5AITA 2K16A 2FT2A 4V3LC 5D1MB 4A4CA 2H7JA 2HHNA 3CH3X 4OELA 3N9PA 4AXLA 1KFUL 5C13A 2ECIA 2C2LA 2YYRA 2AYNA 2B1MA 2G7YA 4G54A 5EF4A 7PCKA 1PCIA 3U5OA 2CSYA 3H6SA 2JRJA 1ICFA 5CVMA 2DC9A 1CSBB 2XU1A 3T6RA 2JQFR 2B1NA 1BGOA 4YV8A 3L1ZB 2YHNA 3KFQA 4YBTA 3KV5A 4YAXA 2FTDA 1PADA 3TNXA 1O0EA 5G0FA 5C11A 3HD3A 1YT7A 3F5VA 3QT4A 1ZIVA 3PW3A 2BDZA 1MHWA 1PPDA 2F6NA 5D1KB 1ZBDB 1RMDA 2G6QA 3PURA 3ZVZB 1EWOA 1QMYA 3V43A 3BCNA 2DCBA 5CHVA 2QICA 4X3GA 1KHQA 3KKUA 2PUYA 4QF2A 5FERA 2HXZA 4CA1A 2LGLA 2QJ0A 1TLOA 2DZYA 4X6HA 1NLJA 3V6CA 3SOXA 1CVZA 3RVXA 2NQIA 3HHIA 4W5CA 1U9QX 4OEMA 1Z60A 3E1ZB 2YJ8A 4GNEA 3S3RA 2F1GA 1JM7B 3ZPV1 2KU3A 4YABA 2GFOA 3IHPA 1IWDA 2VPDA 4GB0A 3AI8A 1WFKA 5A24A 1TU6A 2MNZA 1JM7A 1X4IA 3O37A 2K1JA 1CJLA 2NAAA 2LN0A 2DC6A 4YBSA 3P5UA 9PAPA 4FK5A 1WILA 5LKUA 1DEUA 1NPZA 2E03A 1F62A 2FRAA 2G8EA 4XR7A 4PP1A 1MS6A 2LRIC 3PBHA 6PADA 2D8SA 2H0DB 3N9NA 1ATKA 2R9CA 5LCWB 2FUDA 3IEJA 4I7DA 4BSQA 4Q8HA 3NHEA 5B8DA 4P6EA 3U5NA 4XI1A 4LJNA 3WXEA 1CS8A 2OZ2A 1BORA 2LV9A 3LFYA 1VD4A 3VK6A 3ZPVE 2Y1MA 4FJCA 4YATA 5H9MA 2KWNA 3ZTGA 2R6NA 1XWHA 5AIUA 4X6JA 4N4ZA 5KH9A 3O33A 5J3XA 2FUUA 2ECVA 2JMIA 2MA5A 4CDCB 2VPGA 5B77A 1AU0A 1LDKC 2HDPA 3LXSA 2G8JA 3S3QA 1WGMA 1NL6A 1MEGA 3WXFA 2ECTA 3MHSA 5JG6A 5FEYA 5LKZA 3V6EA 4NN2A 3N3KA 4LK9A 4N79A 3LQJA 3HCTA 3D6SA 2MA6A 4AYCB 1WEQA 2E02A 1ZCMA 1WE9A 2JQGR 2G45A 1LDJB 2LDRA 5G05B 3N9QA 2NQDB 3IV2A 4X6IA 5B78A 2ATOA 1JOCA 4MVTA 1Y08A 2BDLA 2UZGA 2JMJA 3L1XA 1AECA 1CB5A 4O64A 1DF0A 1POPA 1WEOA 2CSZA 1AYWA 3ZUAA 1F2AA 1AIMA 5KH7A 4ZQLA 2KWJA 2C0YA 2HH5A 2PNXA 4HWYA 2KWKA 2YU4A 4RY2A 4L7XA 5B75A 3RPGC 2KGIA 4TKPB 3KW9A 3RTRB 1EWPA 3I2DA 1PBHA 3MORA 3ZYQA 2Y6EA 2CT2A 4F52B 1F2BA 3NG2A 2HD5A 1N87A 2LXPC 4IC2A 4YYWA 2E6RA 5TBNA 3PHDA 5TABA 1EWMA 3LRQA 1HUCB 2FQ9A 5EGWA 4YYVA 2AIMA 3SOWA 3QJ3A 2DCDA 3GCBA 5D1LB 4N8WA 2DJGB 4YYQA 2I50A 1CTEA 1VYXA 1F29A 3O7AA 2DJFB 4PP2E 4AVXA 2O6XA 2Y5BA 4I7CA 1FH0A 3OF8A 5H1UA 3RVWA 2Y43A 3ASLA 2MNYA 3K9MA 3O1GA 3OISA 4R7EA 2L0BA 2L75A 4CCGX 3C5KA 4BPVA 2MD8C 4IC3A 4WZ0A 1VJVA 3KSEA 1FP0A 1VFYA 2AVWA 3HHAA 4Q6FA 3N4CA 1AU3A 4W4UA 2KR4A 2KE1A 2MUMA 3HCSA 5CHTA 4DMXA 1U6GB 1CQDA 1WEUA 4S3OC 1MEMA 2E01A 1HYJA 2YJBA 2CKLB 2Y1NA 2YQMA 4Q8GA 1WEVA 4R8PK 8PCHA 1HYIA 1YK8A 2M1RA 2DZZA 3U8EA 4QH6A 2AUZA 3L11A 2PNSA 3I06A 4LKAA 2YURA 5TDWA 2FO5A 3H7DA 2CKLA 4AP4A 3USVA 5TDRA 3LQHA 4I7BA 4BHWA 3M62A 2ECJA 2XEUA 1PXVA 2P86A 3I3TA 3N9MA 4ZDTA 3U5MA 1GECE 2ZETC 1ITOA 4N3WA 2YJCA 1CV8A 2QIZA 4GNGA 3LQIA 1PE6A 2AS8A 3DF0A 3F75A 5DKAA 1PIPA 5CVOB 4BS6A 3HWNA 2K4DA 1CHCA 3O36A 2F7DA 2LXHC 1Z2QA 3HTKC 2M6MA 3RVVA 4I04A 3IMAA 4N4FA 1BQIA 5F02A 2JMDA 2YW8A 1SNKA 4I05A 4ZUXU 4MZOA 2RI7A 4I07A 2ECNA 4DMYA 3C9EA 2YJ9A 1WEEA 4P5OB 2FSAA 4CDDB 3N9LA 2L5UA 2IDAA 2L80A 3M63A 1NQCA 1AU4A 2P7UA 4A4BA 2KGGA 1KFXL 5JA7A 1PPNA 4PTBA 5EYAF 1Z6UA 3T7LA 1G25A 1YALA 2FYEA 1WENA 2M85A 2DX8A 5CVNB 1AU2A 1X9YA 1KXRA
chains in the Genus database with same CATH superfamily
3M99A 3PT2A 1X4JA 4UP5A 3W30A 1DKIA 4BOZA 2YQLA 2YUCA 2MT5A 2PREA 2VNFA 2KKXA 2F6JA 1QDQA 2AYOA 2XU3A 4KLBA 4A0CD 4P6GA 4QBBA 2FRQA 2C2VS 4MSXA 1VSNA 4L58A 4LLBA 1MM2A 2IBIA 2VJFB 2MD7B 2VP7A 3OVXA 2G43A 3KV6A 2OULA 4WA6A 5JZEA 3WXGA 4RNAA 1PPOA 5K3QA 2VJFA 1GCBA 4YYRA 2YJ2A 4K7CA 4A5UA 3P5WA 4UI9B 1YVBA 4AXMA 2RSDA 1EWLA 1MBMA 5B76A 4W5BA 3MHHA 3O65A 2L7PA 4LADB 5DINA 2G6DA 4YYSA 1QOLA 3ERVA 2NQGA 4ZTBA 3B79A 1MM3A 2YREA 5FPWA 4BOSA 1TL9A 4B86C 1WESA 2M3HA 2OXQC 1U9XA 3CBKA 1E4UA 1WEMA 3PHWA 4GUAA 4YBMA 3H8CA 2R9FA 4YYUA 4QRVA 1PPPA 1MDWA 3O35A 2MIQA 2BTWA 3E9SA 2EGPA 2J7QC 2YSJA 2LGKA 2VPEA 3KQIA 3MTNA 4XUIA 3QSDA 1U9WA 2NQAA 2EA6A 3HCUA 3KWZA 2VPBA 3BWKA 2FUIA 4O62A 3EB5A 1SP4B 3RPGB 3SOUA 1U9VA 2KFTA 3DQVR 1MIRA 2AN6A 3O0UA 5K16A 3CH2X 2YT5A 4CDFB 2EODA 1IYMA 2F42A 4WZ2A 3C6WA 1KHPA 2E6SA 5FB1A 5KH3A 2XB1A 1JQPA 3ZNHA 2XU4A 1AYVA 2LGGA 3K24A 2E61A 1CPJA 3H89A 2CB5A 2LGVA 3BB7A 3QZVA 4PPEA 3EB6A 2DC7A 5J94A 4YVAA 4Z0OA 1GMYA 5G04B 1Q6KA 4PI3A 2YHOA 2IPPB 3O70A 1ME3A 3KX1A 1FBVA 5LKXA 4OVZB 2YSMA 3FAOA 1QXPA 4F1PA 1XKGA 2DC8A 2OWAA 2DJAA 2ECGA 4FIPA 4A49A 3PDFA 5H1VA 1WEWA 2E00A 1YZBA 2KWOA 3KNVA 4Z0RA 1K2FA 4C9ZA 2KYUA 3LJUX 2OP3A 2PBHA 3BPMA 4BQVA 2VHSA 3PUQA 2ACTA 2WBFX 2AUXA 2R9NA 1AYUA 2K17A 5I3LA 1BP4A 2VJEB 1F2CA 4YC9A 1NB3A 1EF7A 1BY8A 4CDEB 4B7YC 4CZWA 3MP2A 4H9DA 2XOYA 1M6DA 2GHUA 2J7QA 3P5XA 5PADA 2FE8A 2VJEA 2DCAA 4QF3A 3N3GA 5H1TA 2KIZA 2PADA 3BPFA 1NB5A 2H0DA 4YADA 2BAYA 5B79A 3PNRA 1STFE 4MZSA 4QRGA 1WEPA 3GV4A 3O34A 4AUQB 4UP0A 4GNFA 3K8UA 2M13A 1U5IA 3BOWA 3IOQA 2R9OA 1K3BB 3OF9A 3U5PA 4Q8HA 3H8BA 2LAUA 4S3OB 5KO3A 4IUMA 1X4UA 4WZ3B 3PLWA 1YK7A 4GNDA 3DPLR 2ECWA 2CIOA 1DVPA 2B0OE 2CRRA 2R9MA 2JTCA 2P0RA 1UKFA 3MJ5A 3GL6A 3N9OA 4QRXA 3KWBX 1WIMA 3IUTA 2LQ6A 3P5VA 4R2YA 1Y4HA 3ZVYA 4BBQA 3FL2A 1GLOA 5LKTA 2KKYA 2L43A 1S4VA 2XU5A 2KREA 1A6RA 2DCCA 4BS5A 2VHFA 1V87A 5EZQA 4FO9A 2ARYA 4AYCA 5SVYA 5TRBA 4D8BA 1T1HA 3SHBA 5JH3A 1ME4A 3CBJA 3FANA 4BOQA 2AU1A 3Q1DA 3BC3A 1THEA 2BU3A 4V3KC 4HXDB 4IP3A 3OQCA 5FB0A 3ZNIA 2HYED 4PADA 3OVZA 3W31A 4BOUA 5AITA 2K16A 2FT2A 4V3LC 5D1MB 4A4CA 2H7JA 3O47A 2HHNA 3CH3X 4OELA 3N9PA 3PSEA 4AXLA 1KFUL 5C13A 2ECIA 2C2LA 2YYRA 2AYNA 2B1MA 2G7YA 3PRMA 4G54A 4RF1A 5EF4A 7PCKA 1PCIA 3U5OA 2CSYA 3H6SA 2JRJA 2BTWB 1ICFA 5CVMA 2DC9A 1CSBB 2JUNA 2XU1A 3T6RA 4RF0A 2JQFR 2B1NA 1BGOA 4YV8A 3L1ZB 2YHNA 3KFQA 4YBTA 3KV5A 4YAXA 4QQ4A 1PADA 2FTDA 1O0EA 3TNXA 4P16A 5G0FA 5C11A 3LVRE 3BY4A 3HD3A 1YT7A 3F5VA 3QT4A 1ZIVA 3PW3A 2BDZA 2JRIA 1MHWA 1PPDA 2F6NA 5D1KB 1ZBDB 1RMDA 2G6QA 3PURA 3ZVZB 1EWOA 1QMYA 3V43A 3BCNA 2DCBA 5CHVA 5EZSA 2QICA 4X3GA 1KHQA 3KKUA 3RNVA 2PUYA 4QF2A 5FERA 2HXZA 3E2DA 4CA1A 2LGLA 2QJ0A 1TLOA 2DZYA 4X6HA 1NLJA 3V6CA 3SOXA 1CVZA 3RVXA 2NQIA 3HHIA 4W5CA 1U9QX 4OEMA 1Z60A 3E1ZB 2YJ8A 4GNEA 3SUBA 3S3RA 2F1GA 1JM7B 3ZPV1 2KU3A 4YABA 2GFOA 3H7HA 3IHPA 1IWDA 4OGCA 2P57A 2VPDA 4GB0A 3AI8A 1WFKA 5A24A 1TU6A 2MNZA 1JM7A 1X4IA 3O37A 2K1JA 3FEHA 1CJLA 2NAAA 2LN0A 2DC6A 4YBSA 3P5UA 9PAPA 4FK5A 1WILA 5LKUA 1DEUA 1NPZA 2E03A 1F62A 2FRAA 2G8EA 4XR7A 4PP1A 1MS6A 2LRIC 3PBHA 6PADA 2D8SA 2H0DB 3N9NA 1ATKA 2R9CA 5LCWB 2FUDA 3IEJA 4I7DA 2UZJA 4BSQA 3NHEA 2CONA 5B8DA 4P6EA 3FM8C 3U5NA 4XI1A 4LJNA 3WXEA 1CS8A 2OZ2A 1BORA 2LV9A 2AGAA 3LFYA 1VD4A 3VK6A 3ZPVE 3LVQE 2Y1MA 4FJCA 3KDEC 4YATA 5H9MA 2KWNA 3ZTGA 2R6NA 1XWHA 5AIUA 4X6JA 4N4ZA 5KH9A 3O33A 5J3XA 4REZA 2FUUA 2ECVA 2JMIA 2MA5A 4CDCB 2VPGA 5B77A 1AU0A 1LDKC 2HDPA 2MKEA 3LXSA 4XZXA 2G8JA 3S3QA 1WGMA 1NL6A 1MEGA 3WXFA 2ECTA 3MHSA 5JG6A 5FEYA 5LKZA 3V6EA 4NN2A 3N3KA 4WURA 4LK9A 4N79A 3LQJA 3HCTA 3D6SA 2MA6A 4AYCB 1WEQA 2E02A 1ZCMA 1WE9A 2JQGR 2G45A 1LDJB 2LDRA 5G05B 3N9QA 2NQDB 3IV2A 3TMPA 4X6IA 5B78A 3T9KA 2ATOA 2FD4A 1JOCA 2CSVA 2RR4A 4MVTA 1Y08A 2UZGA 2JMJA 2BDLA 3L1XA 5SVIA 1AECA 3LDYA 1CB5A 3DWDA 4O64A 1DF0A 1POPA 1WEOA 2CSZA 1AYWA 3ZUAA 1F2AA 1AIMA 5KH7A 4M0WA 4ZQLA 2KWJA 2C0YA 2HH5A 2PNXA 4HWYA 2KWKA 2YU4A 4RY2A 4L7XA 5B75A 2IQJA 2EXUA 3PRPA 3RPGC 2KGIA 4RKXA 4TKPB 3KW9A 3RTRB 1EWPA 3I2DA 1PBHA 4R3DA 2HWKA 3MORA 3ZYQA 2Y6EA 2CT2A 4F52B 1F2BA 3NG2A 3PHUA 2DSMA 5SVXA 2HD5A 5E6JA 2XOCA 1N87A 2LXPC 2CRWA 4IC2A 4YYWA 2E6RA 5TBNA 3PHDA 5TABA 1EWMA 3LRQA 4PT5A 1HUCB 2FQ9A 5EGWA 4YYVA 2AIMA 4D8EA 3MDBC 3SOWA 3QJ3A 2DCDA 3GCBA 5D1LB 4N8WA 2DJGB 3IFUA 4YYQA 2I50A 1CTEA 1VYXA 2XOZA 1F29A 3O7AA 2DJFB 4PP2E 4AVXA 2O6XA 3M7KA 2Z84A 4D8IA 2Y5BA 2YVRA 4I7CA 1FH0A 4OGEA 2FFWA 3OF8A 3BBAA 5H1UA 3RVWA 2Y43A 3ASLA 2MNYA 3K9MA 3O1GA 3OISA 4MI7A 3JUEA 4R7EA 2L0BA 2L75A 4CCGX 3C5KA 4BPVA 2MD8C 3MTVA 4BOPA 4IC3A 4WZ0A 1VJVA 3KSEA 1FP0A 1VFYA 2AVWA 3HHAA 4Q6FA 3C0RA 3N4CA 2D8UA 1AU3A 4W4UA 2KR4A 2KE1A 2MUMA 3HCSA 5CHTA 1DCQA 4DMXA 1U6GB 1CQDA 1WEUA 4S3OC 1MEMA 2E01A 1HYJA 2YJBA 2CKLB 2Y1NA 2YQMA 4Q8GA 1WEVA 4R8PK 8PCHA 1HYIA 1YK8A 2M1RA 2DZZA 3U8EA 4QH6A 2AUZA 3L11A 2PNSA 3I06A 4LKAA 2YURA 5TDWA 2FO5A 3H7DA 2CKLA 4AP4A 3USVA 5TDRA 4OVZA 3LQHA 4I7BA 4BHWA 3M62A 2ECJA 2XEUA 1PXVA 2P86A 3I3TA 3N9MA 2EGMA 3FJUB 4ZDTA 3U5MA 1GECE 3PHXA 2ZETC 1ITOA 4N3WA 2YJCA 1CV8A 2QIZA 4GNGA 3LQIA 1PE6A 2AS8A 3DF0A 3F75A 5DKAA 1PIPA 5CVOB 4BS6A 3HWNA 2K4DA 2XP0A 1CHCA 3O36A 2F7DA 2LXHC 1Z2QA 3HTKC 2M6MA 3DDTA 3RVVA 4I04A 2JM3A 3IMAA 4N4FA 1BQIA 4OW0A 5F02A 2JMDA 2YW8A 1SNKA 4I05A 4ZUXU 4MZOA 2RI7A 4I07A 5SVIB 3TRKA 2ECNA 4DMYA 3C9EA 2YJ9A 1WEEA 1PVJA 4P5OB 2FSAA 4CDDB 3N9LA 2DOSA 2L5UA 2IDAA 2L80A 3M63A 1NQCA 1AU4A 2P7UA 3B21A 4A4BA 2KGGA 1KFXL 4MM3B 5JA7A 1PPNA 4PTBA 5EYAF 1Z6UA 3T7LA 1G25A 1YALA 2FYEA 1WENA 2M85A 2DX8A 5CVNB 1AU2A 1X9YA 1KXRA
chains in the Genus database with same CATH topology
3M99A 1X4JA 4UP5A 2YQLA 2YUCA 2MT5A 2PREA 2VNFA 1QDQA 2F6JA 2AYOA 2XU3A 4KLBA 4A0CD 4P6GA 4QBBA 4C5PA 2FRQA 2C2VS 4MSXA 1VSNA 4L58A 4LLBA 1MM2A 2IBIA 2VJFB 2MD7B 2VP7A 3OVXA 2G43A 3KV6A 2OULA 4WA6A 3WXGA 1PPOA 1GCBA 2VJFA 4YYRA 2YJ2A 4K7CA 4B55A 3P5WA 4UI9B 1YVBA 4AXMA 2RSDA 1EWLA 4W5BA 5B76A 3MHHA 4LADB 5DINA 2G6DA 4YYSA 1QOLA 1GX3A 3ERVA 2NQGA 3B79A 1MM3A 2YREA 5FPWA 1TL9A 4B86C 1WESA 2M3HA 2OXQC 1U9XA 3CBKA 1E4UA 1WEMA 4YYUA 4YBMA 3H8CA 2R9FA 4QRVA 1PPPA 1MDWA 3O35A 2MIQA 2EGPA 2YSJA 2LGKA 2VPEA 3KQIA 3MTNA 4XUIA 3QSDA 1U9WA 2NQAA 2EA6A 3HCUA 3KWZA 2VPBA 3BWKA 2FUIA 3EB5A 1SP4B 3RPGB 3SOUA 1U9VA 2KFTA 3DQVR 1MIRA 2AN6A 3O0UA 5K16A 3CH2X 2YT5A 4CDFB 2EODA 1IYMA 2F42A 4WZ2A 3C6WA 1KHPA 2E6SA 5FB1A 5KH3A 2XB1A 1JQPA 2XU4A 1AYVA 2LGGA 3K24A 1CPJA 3H89A 2CB5A 2LGVA 3QZVA 4PPEA 3EB6A 2DC7A 5J94A 4YVAA 1GMYA 5G04B 1Q6KA 4PI3A 2YHOA 2IPPB 3O70A 1ME3A 3KX1A 1FBVA 5LKXA 2YSMA 1QXPA 1XKGA 2DC8A 2ECGA 4FIPA 4A49A 3PDFA 5H1VA 1WEWA 2E00A 2KWOA 3KNVA 4C9ZA 1K2FA 2OP3A 2KYUA 2PBHA 3BPMA 4BQVA 2VHSA 3PUQA 2ACTA 2WBFX 2AUXA 2R9NA 1AYUA 2K17A 5I3LA 1BP4A 2VJEB 1F2CA 4YC9A 1NB3A 1EF7A 1BY8A 4CDEB 4B7YC 4CZWA 1M6DA 2GHUA 4GUZA 3P5XA 5PADA 2VJEA 2DCAA 4QF3A 3N3GA 5H1TA 2KIZA 2PADA 3BPFA 1NB5A 4BGFA 2H0DA 4YADA 2BAYA 5B79A 3PNRA 1STFE 4MZSA 4QRGA 1WEPA 3GV4A 3O34A 4AUQB 4UP0A 4GNFA 3K8UA 1U5IA 3BOWA 3IOQA 2R9OA 1K3BB 3OF9A 3U5PA 3H8BA 4S3OB 1X4UA 4WZ3B 1YK7A 4GNDA 3DPLR 2ECWA 2CIOA 1DVPA 2R9MA 2P0RA 3GL6A 3N9OA 4QRXA 3KWBX 1WIMA 3IUTA 2LQ6A 3P5VA 4R2YA 1Y4HA 3ZVYA 4BBQA 3FL2A 1GLOA 5LKTA 1S4VA 2L43A 2XU5A 2KREA 1A6RA 2DCCA 4BS5A 2VHFA 1V87A 4FO9A 2ARYA 4AYCA 5TRBA 1T1HA 3SHBA 5JH3A 1ME4A 3CBJA 2AU1A 1E2TA 3BC3A 1THEA 4V3KC 5FB0A 3ZNIA 2HYED 4PADA 3OVZA 5AITA 2K16A 2FT2A 4V3LC 5D1MB 4A4CA 2H7JA 2HHNA 3CH3X 4OELA 3N9PA 4AXLA 1KFUL 5C13A 2ECIA 2C2LA 2YYRA 2AYNA 2B1MA 2G7YA 4G54A 5EF4A 7PCKA 1PCIA 3U5OA 2CSYA 3H6SA 2JRJA 1ICFA 5CVMA 3LTWA 2DC9A 1CSBB 2XU1A 3T6RA 2JQFR 2B1NA 1BGOA 4YV8A 3L1ZB 2YHNA 3KFQA 4YBTA 3KV5A 4YAXA 2FTDA 1PADA 3TNXA 1O0EA 5G0FA 5C11A 3HD3A 1YT7A 3F5VA 3QT4A 1ZIVA 3PW3A 2BDZA 1MHWA 1PPDA 2F6NA 5D1KB 1ZBDB 1RMDA 2G6QA 3PURA 3ZVZB 1EWOA 1QMYA 3V43A 3BCNA 2DCBA 5CHVA 2QICA 4X3GA 1KHQA 3KKUA 2PUYA 4QF2A 5FERA 2HXZA 4CA1A 4NV8A 2LGLA 2QJ0A 1TLOA 2DZYA 4X6HA 1NLJA 3V6CA 3SOXA 1CVZA 3RVXA 2NQIA 3HHIA 4W5CA 1U9QX 4OEMA 1Z60A 3E1ZB 2YJ8A 4GNEA 3S3RA 2F1GA 1JM7B 3ZPV1 2KU3A 4YABA 2GFOA 3IHPA 1IWDA 2VPDA 4GB0A 3AI8A 1WFKA 5A24A 1TU6A 2MNZA 1JM7A 1X4IA 3O37A 2K1JA 1W6FA 1CJLA 2NAAA 2LN0A 2DC6A 4YBSA 3P5UA 9PAPA 4FK5A 1WILA 5LKUA 1DEUA 1NPZA 2E03A 1F62A 2FRAA 2G8EA 4XR7A 4PP1A 1MS6A 2LRIC 3PBHA 6PADA 2D8SA 2H0DB 3N9NA 1ATKA 2R9CA 5LCWB 2FUDA 3IEJA 4I7DA 4BSQA 4Q8HA 3NHEA 5B8DA 4P6EA 3U5NA 4XI1A 4LJNA 3WXEA 1CS8A 2OZ2A 1BORA 2LV9A 3LFYA 1VD4A 3VK6A 3ZPVE 2Y1MA 4FJCA 4YATA 5H9MA 2KWNA 3ZTGA 2R6NA 1XWHA 5AIUA 4X6JA 4N4ZA 5KH9A 3O33A 5J3XA 2FUUA 2ECVA 2JMIA 2MA5A 4CDCB 2VPGA 5B77A 1AU0A 1LDKC 2HDPA 3LXSA 2G8JA 3S3QA 1WGMA 1NL6A 1MEGA 3WXFA 2ECTA 3MHSA 5JG6A 5FEYA 5LKZA 3V6EA 4NN2A 3N3KA 4LK9A 4N79A 3LQJA 3HCTA 3D6SA 2MA6A 4AYCB 1WEQA 2E02A 1ZCMA 1WE9A 2JQGR 2G45A 1LDJB 2LDRA 5G05B 3N9QA 2NQDB 3IV2A 4X6IA 5B78A 2ATOA 1JOCA 4MVTA 1Y08A 2BDLA 2UZGA 2JMJA 3L1XA 1AECA 1CB5A 4O64A 1DF0A 1POPA 1WEOA 2CSZA 1AYWA 3ZUAA 1F2AA 1AIMA 5KH7A 4ZQLA 2KWJA 2C0YA 2HH5A 2PNXA 4HWYA 2KWKA 2YU4A 4RY2A 4L7XA 5B75A 3RPGC 2KGIA 4TKPB 3KW9A 3RTRB 1EWPA 3I2DA 1PBHA 3MORA 3ZYQA 2Y6EA 2CT2A 4F52B 1F2BA 3NG2A 2HD5A 1N87A 2LXPC 4IC2A 4YYWA 2E6RA 5TBNA 3PHDA 5TABA 1EWMA 1W5RA 3LRQA 2BSZA 1HUCB 2FQ9A 5EGWA 4YYVA 2AIMA 3SOWA 3QJ3A 3D9WA 2DCDA 3GCBA 5D1LB 4N8WA 2DJGB 4YYQA 2I50A 1CTEA 1VYXA 1F29A 3O7AA 2DJFB 4PP2E 4AVXA 2O6XA 2Y5BA 4I7CA 1FH0A 3OF8A 5H1UA 3RVWA 2Y43A 3ASLA 2MNYA 3K9MA 3O1GA 3OISA 4R7EA 2L0BA 2L75A 4CCGX 3C5KA 1W4TA 4BPVA 2MD8C 4IC3A 4WZ0A 1VJVA 3KSEA 1FP0A 1VFYA 2AVWA 3HHAA 4Q6FA 3N4CA 1AU3A 4W4UA 2KR4A 2KE1A 2MUMA 3HCSA 5CHTA 4DMXA 1U6GB 1CQDA 1WEUA 4S3OC 1MEMA 2E01A 1HYJA 2YJBA 2CKLB 2Y1NA 2YQMA 4Q8GA 1WEVA 4R8PK 2VFCA 1HYIA 1YK8A 8PCHA 2M1RA 2VFBA 2DZZA 3U8EA 4QH6A 2AUZA 3L11A 2PNSA 3I06A 4LKAA 2YURA 5TDWA 2FO5A 3H7DA 2CKLA 4AP4A 3USVA 5TDRA 3LQHA 4I7BA 4BHWA 3M62A 2ECJA 2XEUA 1PXVA 2P86A 3I3TA 3N9MA 4ZDTA 3U5MA 1GECE 2ZETC 1ITOA 4N3WA 2YJCA 1CV8A 2QIZA 4GNGA 3LQIA 1PE6A 2AS8A 3DF0A 3F75A 5DKAA 1PIPA 5CVOB 4BS6A 3HWNA 2K4DA 1CHCA 3O36A 2F7DA 2LXHC 1Z2QA 3HTKC 2M6MA 3RVVA 4I04A 3IMAA 4N4FA 1BQIA 5F02A 2JMDA 2YW8A 1SNKA 4I05A 4NV7A 4ZUXU 4MZOA 2RI7A 4I07A 2ECNA 4DMYA 3C9EA 2YJ9A 1WEEA 4P5OB 2FSAA 4CDDB 3N9LA 2L5UA 2IDAA 2L80A 3M63A 1NQCA 1AU4A 2P7UA 4A4BA 2KGGA 1KFXL 5JA7A 1PPNA 4PTBA 5EYAF 1Z6UA 3T7LA 1G25A 1YALA 2FYEA 1WENA 2M85A 2DX8A 5CVNB 1AU2A 1X9YA 1KXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 A;  1X4J A;  4UP5 A;  2YQL A;  2YUC A;  2MT5 A;  2PRE A;  2VNF A;  1QDQ A;  2F6J A;  2AYO A;  2XU3 A;  4KLB A;  4A0C D;  4P6G A;  4QBB A;  2FRQ A;  2C2V S;  4MSX A;  1VSN A;  4L58 A;  4LLB A;  1MM2 A;  2IBI A;  2VJF B;  2MD7 B;  2VP7 A;  3OVX A;  2G43 A;  3KV6 A;  2OUL A;  4WA6 A;  3WXG A;  1PPO A;  1GCB A;  2VJF A;  4YYR A;  2YJ2 A;  4K7C A;  3P5W A;  4UI9 B;  1YVB A;  4AXM A;  2RSD A;  1EWL A;  4W5B A;  5B76 A;  3MHH A;  4LAD B;  5DIN A;  2G6D A;  4YYS A;  1QOL A;  3ERV A;  2NQG A;  3B79 A;  1MM3 A;  2YRE A;  5FPW A;  1TL9 A;  4B86 C;  1WES A;  2M3H A;  2OXQ C;  1U9X A;  3CBK A;  1E4U A;  1WEM A;  4YYU A;  4YBM A;  3H8C A;  2R9F A;  4QRV A;  1PPP A;  1MDW A;  3O35 A;  2MIQ A;  2EGP A;  2YSJ A;  2LGK A;  2VPE A;  3KQI A;  3MTN A;  4XUI A;  3QSD A;  1U9W A;  2NQA A;  2EA6 A;  3HCU A;  3KWZ A;  2VPB A;  3BWK A;  2FUI A;  3EB5 A;  1SP4 B;  3RPG B;  3SOU A;  1U9V A;  2KFT A;  3DQV R;  1MIR A;  2AN6 A;  3O0U A;  5K16 A;  3CH2 X;  2YT5 A;  4CDF B;  2EOD A;  1IYM A;  2F42 A;  4WZ2 A;  3C6W A;  1KHP A;  2E6S A;  5FB1 A;  5KH3 A;  2XB1 A;  1JQP A;  2XU4 A;  1AYV A;  2LGG A;  3K24 A;  1CPJ A;  3H89 A;  2CB5 A;  2LGV A;  3QZV A;  4PPE A;  3EB6 A;  2DC7 A;  5J94 A;  4YVA A;  1GMY A;  5G04 B;  1Q6K A;  4PI3 A;  2YHO A;  2IPP B;  3O70 A;  1ME3 A;  3KX1 A;  1FBV A;  5LKX A;  2YSM A;  1QXP A;  1XKG A;  2DC8 A;  2ECG A;  4FIP A;  4A49 A;  3PDF A;  5H1V A;  1WEW A;  2E00 A;  2KWO A;  3KNV A;  4C9Z A;  1K2F A;  2OP3 A;  2KYU A;  2PBH A;  3BPM A;  4BQV A;  2VHS A;  3PUQ A;  2ACT A;  2WBF X;  2AUX A;  2R9N A;  1AYU A;  2K17 A;  5I3L A;  1BP4 A;  2VJE B;  1F2C A;  4YC9 A;  1NB3 A;  1EF7 A;  1BY8 A;  4CDE B;  4B7Y C;  4CZW A;  1M6D A;  2GHU A;  3P5X A;  5PAD A;  2VJE A;  2DCA A;  4QF3 A;  3N3G A;  5H1T A;  2KIZ A;  2PAD A;  3BPF A;  1NB5 A;  2H0D A;  4YAD A;  2BAY A;  5B79 A;  3PNR A;  1STF E;  4MZS A;  4QRG A;  1WEP A;  3GV4 A;  3O34 A;  4AUQ B;  4UP0 A;  4GNF A;  3K8U A;  1U5I A;  3BOW A;  3IOQ A;  2R9O A;  1K3B B;  3OF9 A;  3U5P A;  3H8B A;  4S3O B;  1X4U A;  4WZ3 B;  1YK7 A;  4GND A;  3DPL R;  2ECW A;  2CIO A;  1DVP A;  2R9M A;  2P0R A;  3GL6 A;  3N9O A;  4QRX A;  3KWB X;  1WIM A;  3IUT A;  2LQ6 A;  3P5V A;  4R2Y A;  1Y4H A;  3ZVY A;  4BBQ A;  3FL2 A;  1GLO A;  5LKT A;  1S4V A;  2L43 A;  2XU5 A;  2KRE A;  1A6R A;  2DCC A;  4BS5 A;  2VHF A;  1V87 A;  4FO9 A;  2ARY A;  4AYC A;  5TRB A;  1T1H A;  3SHB A;  5JH3 A;  1ME4 A;  3CBJ A;  2AU1 A;  3BC3 A;  1THE A;  4V3K C;  5FB0 A;  3ZNI A;  2HYE D;  4PAD A;  3OVZ A;  5AIT A;  2K16 A;  2FT2 A;  4V3L C;  5D1M B;  4A4C A;  2H7J A;  2HHN A;  3CH3 X;  4OEL A;  3N9P A;  4AXL A;  1KFU L;  5C13 A;  2ECI A;  2C2L A;  2YYR A;  2AYN A;  2B1M A;  2G7Y A;  4G54 A;  5EF4 A;  7PCK A;  1PCI A;  3U5O A;  2CSY A;  3H6S A;  2JRJ A;  1ICF A;  5CVM A;  2DC9 A;  1CSB B;  2XU1 A;  3T6R A;  2JQF R;  2B1N A;  1BGO A;  4YV8 A;  3L1Z B;  2YHN A;  3KFQ A;  4YBT A;  3KV5 A;  4YAX A;  2FTD A;  1PAD A;  3TNX A;  1O0E A;  5G0F A;  5C11 A;  3HD3 A;  1YT7 A;  3F5V A;  3QT4 A;  1ZIV A;  3PW3 A;  2BDZ A;  1MHW A;  1PPD A;  2F6N A;  5D1K B;  1ZBD B;  1RMD A;  2G6Q A;  3PUR A;  3ZVZ B;  1EWO A;  1QMY A;  3V43 A;  3BCN A;  2DCB A;  5CHV A;  2QIC A;  4X3G A;  1KHQ A;  3KKU A;  2PUY A;  4QF2 A;  5FER A;  2HXZ A;  4CA1 A;  2LGL A;  2QJ0 A;  1TLO A;  2DZY A;  4X6H A;  1NLJ A;  3V6C A;  3SOX A;  1CVZ A;  3RVX A;  2NQI A;  3HHI A;  4W5C A;  1U9Q X;  4OEM A;  1Z60 A;  3E1Z B;  2YJ8 A;  4GNE A;  3S3R A;  2F1G A;  1JM7 B;  3ZPV 1;  2KU3 A;  4YAB A;  2GFO A;  3IHP A;  1IWD A;  2VPD A;  4GB0 A;  3AI8 A;  1WFK A;  5A24 A;  1TU6 A;  2MNZ A;  1JM7 A;  1X4I A;  3O37 A;  2K1J A;  1CJL A;  2NAA A;  2LN0 A;  2DC6 A;  4YBS A;  3P5U A;  9PAP A;  4FK5 A;  1WIL A;  5LKU A;  1DEU A;  1NPZ A;  2E03 A;  1F62 A;  2FRA A;  2G8E A;  4XR7 A;  4PP1 A;  1MS6 A;  2LRI C;  3PBH A;  6PAD A;  2D8S A;  2H0D B;  3N9N A;  1ATK A;  2R9C A;  5LCW B;  2FUD A;  3IEJ A;  4I7D A;  4BSQ A;  4Q8H A;  3NHE A;  5B8D A;  4P6E A;  3U5N A;  4XI1 A;  4LJN A;  3WXE A;  1CS8 A;  2OZ2 A;  1BOR A;  2LV9 A;  3LFY A;  1VD4 A;  3VK6 A;  3ZPV E;  2Y1M A;  4FJC A;  4YAT A;  5H9M A;  2KWN A;  3ZTG A;  2R6N A;  1XWH A;  5AIU A;  4X6J A;  4N4Z A;  5KH9 A;  3O33 A;  5J3X A;  2FUU A;  2ECV A;  2JMI A;  2MA5 A;  4CDC B;  2VPG A;  5B77 A;  1AU0 A;  1LDK C;  2HDP A;  3LXS A;  2G8J A;  3S3Q A;  1WGM A;  1NL6 A;  1MEG A;  3WXF A;  2ECT A;  3MHS A;  5JG6 A;  5FEY A;  5LKZ A;  3V6E A;  4NN2 A;  3N3K A;  4LK9 A;  4N79 A;  3LQJ A;  3HCT A;  3D6S A;  2MA6 A;  4AYC B;  1WEQ A;  2E02 A;  1ZCM A;  1WE9 A;  2JQG R;  2G45 A;  1LDJ B;  2LDR A;  5G05 B;  3N9Q A;  2NQD B;  3IV2 A;  4X6I A;  5B78 A;  2ATO A;  1JOC A;  4MVT A;  1Y08 A;  2BDL A;  2UZG A;  2JMJ A;  3L1X A;  1AEC A;  1CB5 A;  4O64 A;  1DF0 A;  1POP A;  1WEO A;  2CSZ A;  1AYW A;  3ZUA A;  1F2A A;  1AIM A;  5KH7 A;  4ZQL A;  2KWJ A;  2C0Y A;  2HH5 A;  2PNX A;  4HWY A;  2KWK A;  2YU4 A;  4RY2 A;  4L7X A;  5B75 A;  3RPG C;  2KGI A;  4TKP B;  3KW9 A;  3RTR B;  1EWP A;  3I2D A;  1PBH A;  3MOR A;  3ZYQ A;  2Y6E A;  2CT2 A;  4F52 B;  1F2B A;  3NG2 A;  2HD5 A;  1N87 A;  2LXP C;  4IC2 A;  4YYW A;  2E6R A;  5TBN A;  3PHD A;  5TAB A;  1EWM A;  3LRQ A;  1HUC B;  2FQ9 A;  5EGW A;  4YYV A;  2AIM A;  3SOW A;  3QJ3 A;  2DCD A;  3GCB A;  5D1L B;  4N8W A;  2DJG B;  4YYQ A;  2I50 A;  1CTE A;  1VYX A;  1F29 A;  3O7A A;  2DJF B;  4PP2 E;  4AVX A;  2O6X A;  2Y5B A;  4I7C A;  1FH0 A;  3OF8 A;  5H1U A;  3RVW A;  2Y43 A;  3ASL A;  2MNY A;  3K9M A;  3O1G A;  3OIS A;  4R7E A;  2L0B A;  2L75 A;  4CCG X;  3C5K A;  4BPV A;  2MD8 C;  4IC3 A;  4WZ0 A;  1VJV A;  3KSE A;  1FP0 A;  1VFY A;  2AVW A;  3HHA A;  4Q6F A;  3N4C A;  1AU3 A;  4W4U A;  2KR4 A;  2KE1 A;  2MUM A;  3HCS A;  5CHT A;  4DMX A;  1U6G B;  1CQD A;  1WEU A;  4S3O C;  1MEM A;  2E01 A;  1HYJ A;  2YJB A;  2CKL B;  2Y1N A;  2YQM A;  4Q8G A;  1WEV A;  4R8P K;  8PCH A;  1HYI A;  1YK8 A;  2M1R A;  2DZZ A;  3U8E A;  4QH6 A;  2AUZ A;  3L11 A;  2PNS A;  3I06 A;  4LKA A;  2YUR A;  5TDW A;  2FO5 A;  3H7D A;  2CKL A;  4AP4 A;  3USV A;  5TDR A;  3LQH A;  4I7B A;  4BHW A;  3M62 A;  2ECJ A;  2XEU A;  1PXV A;  2P86 A;  3I3T A;  3N9M A;  4ZDT A;  3U5M A;  1GEC E;  2ZET C;  1ITO A;  4N3W A;  2YJC A;  1CV8 A;  2QIZ A;  4GNG A;  3LQI A;  1PE6 A;  2AS8 A;  3DF0 A;  3F75 A;  5DKA A;  1PIP A;  5CVO B;  4BS6 A;  3HWN A;  2K4D A;  1CHC A;  3O36 A;  2F7D A;  2LXH C;  1Z2Q A;  3HTK C;  2M6M A;  3RVV A;  4I04 A;  3IMA A;  4N4F A;  1BQI A;  5F02 A;  2JMD A;  2YW8 A;  1SNK A;  4I05 A;  4ZUX U;  4MZO A;  2RI7 A;  4I07 A;  2ECN A;  4DMY A;  3C9E A;  2YJ9 A;  1WEE A;  4P5O B;  2FSA A;  4CDD B;  3N9L A;  2L5U A;  2IDA A;  2L80 A;  3M63 A;  1NQC A;  1AU4 A;  2P7U A;  4A4B A;  2KGG A;  1KFX L;  5JA7 A;  1PPN A;  4PTB A;  5EYA F;  1Z6U A;  3T7L A;  1G25 A;  1YAL A;  2FYE A;  1WEN A;  2M85 A;  2DX8 A;  5CVN B;  1AU2 A;  1X9Y A;  1KXR A; 
#chains in the Genus database with same CATH topology
 3M99 A;  3PT2 A;  1X4J A;  4UP5 A;  3W30 A;  1DKI A;  4BOZ A;  2YQL A;  2YUC A;  2MT5 A;  2PRE A;  2VNF A;  2KKX A;  2F6J A;  1QDQ A;  2AYO A;  2XU3 A;  4KLB A;  4A0C D;  4P6G A;  4QBB A;  2FRQ A;  2C2V S;  4MSX A;  1VSN A;  4L58 A;  4LLB A;  1MM2 A;  2IBI A;  2VJF B;  2MD7 B;  2VP7 A;  3OVX A;  2G43 A;  3KV6 A;  2OUL A;  4WA6 A;  5JZE A;  3WXG A;  4RNA A;  1PPO A;  5K3Q A;  2VJF A;  1GCB A;  4YYR A;  2YJ2 A;  4K7C A;  4A5U A;  3P5W A;  4UI9 B;  1YVB A;  4AXM A;  2RSD A;  1EWL A;  1MBM A;  5B76 A;  4W5B A;  3MHH A;  3O65 A;  2L7P A;  4LAD B;  5DIN A;  2G6D A;  4YYS A;  1QOL A;  3ERV A;  2NQG A;  4ZTB A;  3B79 A;  1MM3 A;  2YRE A;  5FPW A;  4BOS A;  1TL9 A;  4B86 C;  1WES A;  2M3H A;  2OXQ C;  1U9X A;  3CBK A;  1E4U A;  1WEM A;  3PHW A;  4GUA A;  4YBM A;  3H8C A;  2R9F A;  4YYU A;  4QRV A;  1PPP A;  1MDW A;  3O35 A;  2MIQ A;  2BTW A;  3E9S A;  2EGP A;  2J7Q C;  2YSJ A;  2LGK A;  2VPE A;  3KQI A;  3MTN A;  4XUI A;  3QSD A;  1U9W A;  2NQA A;  2EA6 A;  3HCU A;  3KWZ A;  2VPB A;  3BWK A;  2FUI A;  4O62 A;  3EB5 A;  1SP4 B;  3RPG B;  3SOU A;  1U9V A;  2KFT A;  3DQV R;  1MIR A;  2AN6 A;  3O0U A;  5K16 A;  3CH2 X;  2YT5 A;  4CDF B;  2EOD A;  1IYM A;  2F42 A;  4WZ2 A;  3C6W A;  1KHP A;  2E6S A;  5FB1 A;  5KH3 A;  2XB1 A;  1JQP A;  3ZNH A;  2XU4 A;  1AYV A;  2LGG A;  3K24 A;  2E61 A;  1CPJ A;  3H89 A;  2CB5 A;  2LGV A;  3BB7 A;  3QZV A;  4PPE A;  3EB6 A;  2DC7 A;  5J94 A;  4YVA A;  4Z0O A;  1GMY A;  5G04 B;  1Q6K A;  4PI3 A;  2YHO A;  2IPP B;  3O70 A;  1ME3 A;  3KX1 A;  1FBV A;  5LKX A;  4OVZ B;  2YSM A;  3FAO A;  1QXP A;  4F1P A;  1XKG A;  2DC8 A;  2OWA A;  2DJA A;  2ECG A;  4FIP A;  4A49 A;  3PDF A;  5H1V A;  1WEW A;  2E00 A;  1YZB A;  2KWO A;  3KNV A;  4Z0R A;  1K2F A;  4C9Z A;  2KYU A;  3LJU X;  2OP3 A;  2PBH A;  3BPM A;  4BQV A;  2VHS A;  3PUQ A;  2ACT A;  2WBF X;  2AUX A;  2R9N A;  1AYU A;  2K17 A;  5I3L A;  1BP4 A;  2VJE B;  1F2C A;  4YC9 A;  1NB3 A;  1EF7 A;  1BY8 A;  4CDE B;  4B7Y C;  4CZW A;  3MP2 A;  4H9D A;  2XOY A;  1M6D A;  2GHU A;  2J7Q A;  3P5X A;  5PAD A;  2FE8 A;  2VJE A;  2DCA A;  4QF3 A;  3N3G A;  5H1T A;  2KIZ A;  2PAD A;  3BPF A;  1NB5 A;  2H0D A;  4YAD A;  2BAY A;  5B79 A;  3PNR A;  1STF E;  4MZS A;  4QRG A;  1WEP A;  3GV4 A;  3O34 A;  4AUQ B;  4UP0 A;  4GNF A;  3K8U A;  2M13 A;  1U5I A;  3BOW A;  3IOQ A;  2R9O A;  1K3B B;  3OF9 A;  3U5P A;  4Q8H A;  3H8B A;  2LAU A;  4S3O B;  5KO3 A;  4IUM A;  1X4U A;  4WZ3 B;  3PLW A;  1YK7 A;  4GND A;  3DPL R;  2ECW A;  2CIO A;  1DVP A;  2B0O E;  2CRR A;  2R9M A;  2JTC A;  2P0R A;  1UKF A;  3MJ5 A;  3GL6 A;  3N9O A;  4QRX A;  3KWB X;  1WIM A;  3IUT A;  2LQ6 A;  3P5V A;  4R2Y A;  1Y4H A;  3ZVY A;  4BBQ A;  3FL2 A;  1GLO A;  5LKT A;  2KKY A;  2L43 A;  1S4V A;  2XU5 A;  2KRE A;  1A6R A;  2DCC A;  4BS5 A;  2VHF A;  1V87 A;  5EZQ A;  4FO9 A;  2ARY A;  4AYC A;  5SVY A;  5TRB A;  4D8B A;  1T1H A;  3SHB A;  5JH3 A;  1ME4 A;  3CBJ A;  3FAN A;  4BOQ A;  2AU1 A;  3Q1D A;  3BC3 A;  1THE A;  2BU3 A;  4V3K C;  4HXD B;  4IP3 A;  3OQC A;  5FB0 A;  3ZNI A;  2HYE D;  4PAD A;  3OVZ A;  3W31 A;  4BOU A;  5AIT A;  2K16 A;  2FT2 A;  4V3L C;  5D1M B;  4A4C A;  2H7J A;  3O47 A;  2HHN A;  3CH3 X;  4OEL A;  3N9P A;  3PSE A;  4AXL A;  1KFU L;  5C13 A;  2ECI A;  2C2L A;  2YYR A;  2AYN A;  2B1M A;  2G7Y A;  3PRM A;  4G54 A;  4RF1 A;  5EF4 A;  7PCK A;  1PCI A;  3U5O A;  2CSY A;  3H6S A;  2JRJ A;  2BTW B;  1ICF A;  5CVM A;  2DC9 A;  1CSB B;  2JUN A;  2XU1 A;  3T6R A;  4RF0 A;  2JQF R;  2B1N A;  1BGO A;  4YV8 A;  3L1Z B;  2YHN A;  3KFQ A;  4YBT A;  3KV5 A;  4YAX A;  4QQ4 A;  1PAD A;  2FTD A;  1O0E A;  3TNX A;  4P16 A;  5G0F A;  5C11 A;  3LVR E;  3BY4 A;  3HD3 A;  1YT7 A;  3F5V A;  3QT4 A;  1ZIV A;  3PW3 A;  2BDZ A;  2JRI A;  1MHW A;  1PPD A;  2F6N A;  5D1K B;  1ZBD B;  1RMD A;  2G6Q A;  3PUR A;  3ZVZ B;  1EWO A;  1QMY A;  3V43 A;  3BCN A;  2DCB A;  5CHV A;  5EZS A;  2QIC A;  4X3G A;  1KHQ A;  3KKU A;  3RNV A;  2PUY A;  4QF2 A;  5FER A;  2HXZ A;  3E2D A;  4CA1 A;  2LGL A;  2QJ0 A;  1TLO A;  2DZY A;  4X6H A;  1NLJ A;  3V6C A;  3SOX A;  1CVZ A;  3RVX A;  2NQI A;  3HHI A;  4W5C A;  1U9Q X;  4OEM A;  1Z60 A;  3E1Z B;  2YJ8 A;  4GNE A;  3SUB A;  3S3R A;  2F1G A;  1JM7 B;  3ZPV 1;  2KU3 A;  4YAB A;  2GFO A;  3H7H A;  3IHP A;  1IWD A;  4OGC A;  2P57 A;  2VPD A;  4GB0 A;  3AI8 A;  1WFK A;  5A24 A;  1TU6 A;  2MNZ A;  1JM7 A;  1X4I A;  3O37 A;  2K1J A;  3FEH A;  1CJL A;  2NAA A;  2LN0 A;  2DC6 A;  4YBS A;  3P5U A;  9PAP A;  4FK5 A;  1WIL A;  5LKU A;  1DEU A;  1NPZ A;  2E03 A;  1F62 A;  2FRA A;  2G8E A;  4XR7 A;  4PP1 A;  1MS6 A;  2LRI C;  3PBH A;  6PAD A;  2D8S A;  2H0D B;  3N9N A;  1ATK A;  2R9C A;  5LCW B;  2FUD A;  3IEJ A;  4I7D A;  2UZJ A;  4BSQ A;  3NHE A;  2CON A;  5B8D A;  4P6E A;  3FM8 C;  3U5N A;  4XI1 A;  4LJN A;  3WXE A;  1CS8 A;  2OZ2 A;  1BOR A;  2LV9 A;  2AGA A;  3LFY A;  1VD4 A;  3VK6 A;  3ZPV E;  3LVQ E;  2Y1M A;  4FJC A;  3KDE C;  4YAT A;  5H9M A;  2KWN A;  3ZTG A;  2R6N A;  1XWH A;  5AIU A;  4X6J A;  4N4Z A;  5KH9 A;  3O33 A;  5J3X A;  4REZ A;  2FUU A;  2ECV A;  2JMI A;  2MA5 A;  4CDC B;  2VPG A;  5B77 A;  1AU0 A;  1LDK C;  2HDP A;  2MKE A;  3LXS A;  4XZX A;  2G8J A;  3S3Q A;  1WGM A;  1NL6 A;  1MEG A;  3WXF A;  2ECT A;  3MHS A;  5JG6 A;  5FEY A;  5LKZ A;  3V6E A;  4NN2 A;  3N3K A;  4WUR A;  4LK9 A;  4N79 A;  3LQJ A;  3HCT A;  3D6S A;  2MA6 A;  4AYC B;  1WEQ A;  2E02 A;  1ZCM A;  1WE9 A;  2JQG R;  2G45 A;  1LDJ B;  2LDR A;  5G05 B;  3N9Q A;  2NQD B;  3IV2 A;  3TMP A;  4X6I A;  5B78 A;  3T9K A;  2ATO A;  2FD4 A;  1JOC A;  2CSV A;  2RR4 A;  4MVT A;  1Y08 A;  2UZG A;  2JMJ A;  2BDL A;  3L1X A;  5SVI A;  1AEC A;  3LDY A;  1CB5 A;  3DWD A;  4O64 A;  1DF0 A;  1POP A;  1WEO A;  2CSZ A;  1AYW A;  3ZUA A;  1F2A A;  1AIM A;  5KH7 A;  4M0W A;  4ZQL A;  2KWJ A;  2C0Y A;  2HH5 A;  2PNX A;  4HWY A;  2KWK A;  2YU4 A;  4RY2 A;  4L7X A;  5B75 A;  2IQJ A;  2EXU A;  3PRP A;  3RPG C;  2KGI A;  4RKX A;  4TKP B;  3KW9 A;  3RTR B;  1EWP A;  3I2D A;  1PBH A;  4R3D A;  2HWK A;  3MOR A;  3ZYQ A;  2Y6E A;  2CT2 A;  4F52 B;  1F2B A;  3NG2 A;  3PHU A;  2DSM A;  5SVX A;  2HD5 A;  5E6J A;  2XOC A;  1N87 A;  2LXP C;  2CRW A;  4IC2 A;  4YYW A;  2E6R A;  5TBN A;  3PHD A;  5TAB A;  1EWM A;  3LRQ A;  4PT5 A;  1HUC B;  2FQ9 A;  5EGW A;  4YYV A;  2AIM A;  4D8E A;  3MDB C;  3SOW A;  3QJ3 A;  2DCD A;  3GCB A;  5D1L B;  4N8W A;  2DJG B;  3IFU A;  4YYQ A;  2I50 A;  1CTE A;  1VYX A;  2XOZ A;  1F29 A;  3O7A A;  2DJF B;  4PP2 E;  4AVX A;  2O6X A;  3M7K A;  2Z84 A;  4D8I A;  2Y5B A;  2YVR A;  4I7C A;  1FH0 A;  4OGE A;  2FFW A;  3OF8 A;  3BBA A;  5H1U A;  3RVW A;  2Y43 A;  3ASL A;  2MNY A;  3K9M A;  3O1G A;  3OIS A;  4MI7 A;  3JUE A;  4R7E A;  2L0B A;  2L75 A;  4CCG X;  3C5K A;  4BPV A;  2MD8 C;  3MTV A;  4BOP A;  4IC3 A;  4WZ0 A;  1VJV A;  3KSE A;  1FP0 A;  1VFY A;  2AVW A;  3HHA A;  4Q6F A;  3C0R A;  3N4C A;  2D8U A;  1AU3 A;  4W4U A;  2KR4 A;  2KE1 A;  2MUM A;  3HCS A;  5CHT A;  1DCQ A;  4DMX A;  1U6G B;  1CQD A;  1WEU A;  4S3O C;  1MEM A;  2E01 A;  1HYJ A;  2YJB A;  2CKL B;  2Y1N A;  2YQM A;  4Q8G A;  1WEV A;  4R8P K;  8PCH A;  1HYI A;  1YK8 A;  2M1R A;  2DZZ A;  3U8E A;  4QH6 A;  2AUZ A;  3L11 A;  2PNS A;  3I06 A;  4LKA A;  2YUR A;  5TDW A;  2FO5 A;  3H7D A;  2CKL A;  4AP4 A;  3USV A;  5TDR A;  4OVZ A;  3LQH A;  4I7B A;  4BHW A;  3M62 A;  2ECJ A;  2XEU A;  1PXV A;  2P86 A;  3I3T A;  3N9M A;  2EGM A;  3FJU B;  4ZDT A;  3U5M A;  1GEC E;  3PHX A;  2ZET C;  1ITO A;  4N3W A;  2YJC A;  1CV8 A;  2QIZ A;  4GNG A;  3LQI A;  1PE6 A;  2AS8 A;  3DF0 A;  3F75 A;  5DKA A;  1PIP A;  5CVO B;  4BS6 A;  3HWN A;  2K4D A;  2XP0 A;  1CHC A;  3O36 A;  2F7D A;  2LXH C;  1Z2Q A;  3HTK C;  2M6M A;  3DDT A;  3RVV A;  4I04 A;  2JM3 A;  3IMA A;  4N4F A;  1BQI A;  4OW0 A;  5F02 A;  2JMD A;  2YW8 A;  1SNK A;  4I05 A;  4ZUX U;  4MZO A;  2RI7 A;  4I07 A;  5SVI B;  3TRK A;  2ECN A;  4DMY A;  3C9E A;  2YJ9 A;  1WEE A;  1PVJ A;  4P5O B;  2FSA A;  4CDD B;  3N9L A;  2DOS A;  2L5U A;  2IDA A;  2L80 A;  3M63 A;  1NQC A;  1AU4 A;  2P7U A;  3B21 A;  4A4B A;  2KGG A;  1KFX L;  4MM3 B;  5JA7 A;  1PPN A;  4PTB A;  5EYA F;  1Z6U A;  3T7L A;  1G25 A;  1YAL A;  2FYE A;  1WEN A;  2M85 A;  2DX8 A;  5CVN B;  1AU2 A;  1X9Y A;  1KXR A; 
#chains in the Genus database with same CATH homology
 3M99 A;  1X4J A;  4UP5 A;  2YQL A;  2YUC A;  2MT5 A;  2PRE A;  2VNF A;  1QDQ A;  2F6J A;  2AYO A;  2XU3 A;  4KLB A;  4A0C D;  4P6G A;  4QBB A;  4C5P A;  2FRQ A;  2C2V S;  4MSX A;  1VSN A;  4L58 A;  4LLB A;  1MM2 A;  2IBI A;  2VJF B;  2MD7 B;  2VP7 A;  3OVX A;  2G43 A;  3KV6 A;  2OUL A;  4WA6 A;  3WXG A;  1PPO A;  1GCB A;  2VJF A;  4YYR A;  2YJ2 A;  4K7C A;  4B55 A;  3P5W A;  4UI9 B;  1YVB A;  4AXM A;  2RSD A;  1EWL A;  4W5B A;  5B76 A;  3MHH A;  4LAD B;  5DIN A;  2G6D A;  4YYS A;  1QOL A;  1GX3 A;  3ERV A;  2NQG A;  3B79 A;  1MM3 A;  2YRE A;  5FPW A;  1TL9 A;  4B86 C;  1WES A;  2M3H A;  2OXQ C;  1U9X A;  3CBK A;  1E4U A;  1WEM A;  4YYU A;  4YBM A;  3H8C A;  2R9F A;  4QRV A;  1PPP A;  1MDW A;  3O35 A;  2MIQ A;  2EGP A;  2YSJ A;  2LGK A;  2VPE A;  3KQI A;  3MTN A;  4XUI A;  3QSD A;  1U9W A;  2NQA A;  2EA6 A;  3HCU A;  3KWZ A;  2VPB A;  3BWK A;  2FUI A;  3EB5 A;  1SP4 B;  3RPG B;  3SOU A;  1U9V A;  2KFT A;  3DQV R;  1MIR A;  2AN6 A;  3O0U A;  5K16 A;  3CH2 X;  2YT5 A;  4CDF B;  2EOD A;  1IYM A;  2F42 A;  4WZ2 A;  3C6W A;  1KHP A;  2E6S A;  5FB1 A;  5KH3 A;  2XB1 A;  1JQP A;  2XU4 A;  1AYV A;  2LGG A;  3K24 A;  1CPJ A;  3H89 A;  2CB5 A;  2LGV A;  3QZV A;  4PPE A;  3EB6 A;  2DC7 A;  5J94 A;  4YVA A;  1GMY A;  5G04 B;  1Q6K A;  4PI3 A;  2YHO A;  2IPP B;  3O70 A;  1ME3 A;  3KX1 A;  1FBV A;  5LKX A;  2YSM A;  1QXP A;  1XKG A;  2DC8 A;  2ECG A;  4FIP A;  4A49 A;  3PDF A;  5H1V A;  1WEW A;  2E00 A;  2KWO A;  3KNV A;  4C9Z A;  1K2F A;  2OP3 A;  2KYU A;  2PBH A;  3BPM A;  4BQV A;  2VHS A;  3PUQ A;  2ACT A;  2WBF X;  2AUX A;  2R9N A;  1AYU A;  2K17 A;  5I3L A;  1BP4 A;  2VJE B;  1F2C A;  4YC9 A;  1NB3 A;  1EF7 A;  1BY8 A;  4CDE B;  4B7Y C;  4CZW A;  1M6D A;  2GHU A;  4GUZ A;  3P5X A;  5PAD A;  2VJE A;  2DCA A;  4QF3 A;  3N3G A;  5H1T A;  2KIZ A;  2PAD A;  3BPF A;  1NB5 A;  4BGF A;  2H0D A;  4YAD A;  2BAY A;  5B79 A;  3PNR A;  1STF E;  4MZS A;  4QRG A;  1WEP A;  3GV4 A;  3O34 A;  4AUQ B;  4UP0 A;  4GNF A;  3K8U A;  1U5I A;  3BOW A;  3IOQ A;  2R9O A;  1K3B B;  3OF9 A;  3U5P A;  3H8B A;  4S3O B;  1X4U A;  4WZ3 B;  1YK7 A;  4GND A;  3DPL R;  2ECW A;  2CIO A;  1DVP A;  2R9M A;  2P0R A;  3GL6 A;  3N9O A;  4QRX A;  3KWB X;  1WIM A;  3IUT A;  2LQ6 A;  3P5V A;  4R2Y A;  1Y4H A;  3ZVY A;  4BBQ A;  3FL2 A;  1GLO A;  5LKT A;  1S4V A;  2L43 A;  2XU5 A;  2KRE A;  1A6R A;  2DCC A;  4BS5 A;  2VHF A;  1V87 A;  4FO9 A;  2ARY A;  4AYC A;  5TRB A;  1T1H A;  3SHB A;  5JH3 A;  1ME4 A;  3CBJ A;  2AU1 A;  1E2T A;  3BC3 A;  1THE A;  4V3K C;  5FB0 A;  3ZNI A;  2HYE D;  4PAD A;  3OVZ A;  5AIT A;  2K16 A;  2FT2 A;  4V3L C;  5D1M B;  4A4C A;  2H7J A;  2HHN A;  3CH3 X;  4OEL A;  3N9P A;  4AXL A;  1KFU L;  5C13 A;  2ECI A;  2C2L A;  2YYR A;  2AYN A;  2B1M A;  2G7Y A;  4G54 A;  5EF4 A;  7PCK A;  1PCI A;  3U5O A;  2CSY A;  3H6S A;  2JRJ A;  1ICF A;  5CVM A;  3LTW A;  2DC9 A;  1CSB B;  2XU1 A;  3T6R A;  2JQF R;  2B1N A;  1BGO A;  4YV8 A;  3L1Z B;  2YHN A;  3KFQ A;  4YBT A;  3KV5 A;  4YAX A;  2FTD A;  1PAD A;  3TNX A;  1O0E A;  5G0F A;  5C11 A;  3HD3 A;  1YT7 A;  3F5V A;  3QT4 A;  1ZIV A;  3PW3 A;  2BDZ A;  1MHW A;  1PPD A;  2F6N A;  5D1K B;  1ZBD B;  1RMD A;  2G6Q A;  3PUR A;  3ZVZ B;  1EWO A;  1QMY A;  3V43 A;  3BCN A;  2DCB A;  5CHV A;  2QIC A;  4X3G A;  1KHQ A;  3KKU A;  2PUY A;  4QF2 A;  5FER A;  2HXZ A;  4CA1 A;  4NV8 A;  2LGL A;  2QJ0 A;  1TLO A;  2DZY A;  4X6H A;  1NLJ A;  3V6C A;  3SOX A;  1CVZ A;  3RVX A;  2NQI A;  3HHI A;  4W5C A;  1U9Q X;  4OEM A;  1Z60 A;  3E1Z B;  2YJ8 A;  4GNE A;  3S3R A;  2F1G A;  1JM7 B;  3ZPV 1;  2KU3 A;  4YAB A;  2GFO A;  3IHP A;  1IWD A;  2VPD A;  4GB0 A;  3AI8 A;  1WFK A;  5A24 A;  1TU6 A;  2MNZ A;  1JM7 A;  1X4I A;  3O37 A;  2K1J A;  1W6F A;  1CJL A;  2NAA A;  2LN0 A;  2DC6 A;  4YBS A;  3P5U A;  9PAP A;  4FK5 A;  1WIL A;  5LKU A;  1DEU A;  1NPZ A;  2E03 A;  1F62 A;  2FRA A;  2G8E A;  4XR7 A;  4PP1 A;  1MS6 A;  2LRI C;  3PBH A;  6PAD A;  2D8S A;  2H0D B;  3N9N A;  1ATK A;  2R9C A;  5LCW B;  2FUD A;  3IEJ A;  4I7D A;  4BSQ A;  4Q8H A;  3NHE A;  5B8D A;  4P6E A;  3U5N A;  4XI1 A;  4LJN A;  3WXE A;  1CS8 A;  2OZ2 A;  1BOR A;  2LV9 A;  3LFY A;  1VD4 A;  3VK6 A;  3ZPV E;  2Y1M A;  4FJC A;  4YAT A;  5H9M A;  2KWN A;  3ZTG A;  2R6N A;  1XWH A;  5AIU A;  4X6J A;  4N4Z A;  5KH9 A;  3O33 A;  5J3X A;  2FUU A;  2ECV A;  2JMI A;  2MA5 A;  4CDC B;  2VPG A;  5B77 A;  1AU0 A;  1LDK C;  2HDP A;  3LXS A;  2G8J A;  3S3Q A;  1WGM A;  1NL6 A;  1MEG A;  3WXF A;  2ECT A;  3MHS A;  5JG6 A;  5FEY A;  5LKZ A;  3V6E A;  4NN2 A;  3N3K A;  4LK9 A;  4N79 A;  3LQJ A;  3HCT A;  3D6S A;  2MA6 A;  4AYC B;  1WEQ A;  2E02 A;  1ZCM A;  1WE9 A;  2JQG R;  2G45 A;  1LDJ B;  2LDR A;  5G05 B;  3N9Q A;  2NQD B;  3IV2 A;  4X6I A;  5B78 A;  2ATO A;  1JOC A;  4MVT A;  1Y08 A;  2BDL A;  2UZG A;  2JMJ A;  3L1X A;  1AEC A;  1CB5 A;  4O64 A;  1DF0 A;  1POP A;  1WEO A;  2CSZ A;  1AYW A;  3ZUA A;  1F2A A;  1AIM A;  5KH7 A;  4ZQL A;  2KWJ A;  2C0Y A;  2HH5 A;  2PNX A;  4HWY A;  2KWK A;  2YU4 A;  4RY2 A;  4L7X A;  5B75 A;  3RPG C;  2KGI A;  4TKP B;  3KW9 A;  3RTR B;  1EWP A;  3I2D A;  1PBH A;  3MOR A;  3ZYQ A;  2Y6E A;  2CT2 A;  4F52 B;  1F2B A;  3NG2 A;  2HD5 A;  1N87 A;  2LXP C;  4IC2 A;  4YYW A;  2E6R A;  5TBN A;  3PHD A;  5TAB A;  1EWM A;  1W5R A;  3LRQ A;  2BSZ A;  1HUC B;  2FQ9 A;  5EGW A;  4YYV A;  2AIM A;  3SOW A;  3QJ3 A;  3D9W A;  2DCD A;  3GCB A;  5D1L B;  4N8W A;  2DJG B;  4YYQ A;  2I50 A;  1CTE A;  1VYX A;  1F29 A;  3O7A A;  2DJF B;  4PP2 E;  4AVX A;  2O6X A;  2Y5B A;  4I7C A;  1FH0 A;  3OF8 A;  5H1U A;  3RVW A;  2Y43 A;  3ASL A;  2MNY A;  3K9M A;  3O1G A;  3OIS A;  4R7E A;  2L0B A;  2L75 A;  4CCG X;  3C5K A;  1W4T A;  4BPV A;  2MD8 C;  4IC3 A;  4WZ0 A;  1VJV A;  3KSE A;  1FP0 A;  1VFY A;  2AVW A;  3HHA A;  4Q6F A;  3N4C A;  1AU3 A;  4W4U A;  2KR4 A;  2KE1 A;  2MUM A;  3HCS A;  5CHT A;  4DMX A;  1U6G B;  1CQD A;  1WEU A;  4S3O C;  1MEM A;  2E01 A;  1HYJ A;  2YJB A;  2CKL B;  2Y1N A;  2YQM A;  4Q8G A;  1WEV A;  4R8P K;  2VFC A;  1HYI A;  1YK8 A;  8PCH A;  2M1R A;  2VFB A;  2DZZ A;  3U8E A;  4QH6 A;  2AUZ A;  3L11 A;  2PNS A;  3I06 A;  4LKA A;  2YUR A;  5TDW A;  2FO5 A;  3H7D A;  2CKL A;  4AP4 A;  3USV A;  5TDR A;  3LQH A;  4I7B A;  4BHW A;  3M62 A;  2ECJ A;  2XEU A;  1PXV A;  2P86 A;  3I3T A;  3N9M A;  4ZDT A;  3U5M A;  1GEC E;  2ZET C;  1ITO A;  4N3W A;  2YJC A;  1CV8 A;  2QIZ A;  4GNG A;  3LQI A;  1PE6 A;  2AS8 A;  3DF0 A;  3F75 A;  5DKA A;  1PIP A;  5CVO B;  4BS6 A;  3HWN A;  2K4D A;  1CHC A;  3O36 A;  2F7D A;  2LXH C;  1Z2Q A;  3HTK C;  2M6M A;  3RVV A;  4I04 A;  3IMA A;  4N4F A;  1BQI A;  5F02 A;  2JMD A;  2YW8 A;  1SNK A;  4I05 A;  4NV7 A;  4ZUX U;  4MZO A;  2RI7 A;  4I07 A;  2ECN A;  4DMY A;  3C9E A;  2YJ9 A;  1WEE A;  4P5O B;  2FSA A;  4CDD B;  3N9L A;  2L5U A;  2IDA A;  2L80 A;  3M63 A;  1NQC A;  1AU4 A;  2P7U A;  4A4B A;  2KGG A;  1KFX L;  5JA7 A;  1PPN A;  4PTB A;  5EYA F;  1Z6U A;  3T7L A;  1G25 A;  1YAL A;  2FYE A;  1WEN A;  2M85 A;  2DX8 A;  5CVN B;  1AU2 A;  1X9Y A;  1KXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...