3M99A

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
470
structure length
422
Chain Sequence
SICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQDAHEFWQFIINQIHQSYVLDLPNAKNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 111
structure length 422
sequence length 470
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3m99A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3m99A02
2I50A 2KREA 3H89A 1U9WA 1WEPA 3SOWA 3KV5A 2LN0A 4PP1A 2EGPA 4PPEA 1O0EA 2HHNA 3ZVYA 3M63A 2DC9A 1GMYA 2FT2A 1AECA 4BQVA 4P6GA 4WZ2A 3PUQA 5FPWA 2FRAA 2H7JA 4DMYA 2F42A 3O34A 2D8SA 3WXGA 1IYMA 6PADA 2BAYA 3LQJA 1TLOA 5KH3A 3V6CA 2ECTA 2FUUA 2LV9A 1K3BB 3NG2A 4A4BA 2G7YA 2L75A 5KH7A 2ECJA 3KKUA 4QRXA 1ITOA 2LXPC 2F6NA 1XKGA 2ZETC 5G04B 4IC3A 2AUXA 3QT4A 4N79A 4QRGA 2E00A 2JMJA 1WGMA 4CCGX 3HCTA 5FERA 2DCAA 4TKPB 3N9PA 1PXVA 2IDAA 2DC8A 2YSJA 2XU4A 4YBSA 3SHBA 2VJFB 2NQGA 3K9MA 3BCNA 2GFOA 1F2BA 3DPLR 2JMIA 3KWZA 4R8PK 1WE9A 2YJBA 2JQGR 3O1GA 1VD4A 2HYED 1KHQA 4XUIA 2YREA 2KGIA 1CHCA 4YYUA 4GNDA 3DQVR 5LCWB 4B7YC 5F02A 3IV2A 1WEWA 3N9LA 4X3GA 3ZYQA 3KWBX 4AYCA 1AU2A 1IWDA 1LDKC 5H1UA 5B77A 1KHPA 3HHIA 3N3KA 2FTDA 5EYAF 1VYXA 2AU1A 1KXRA 2OXQC 4WA6A 2M6MA 5A24A 3IHPA 1ZCMA 4QRVA 3KV6A 1NB5A 1EWMA 2R9OA 2L5UA 8PCHA 2YJ9A 2FSAA 4I7BA 4I05A 3U5PA 5H9MA 3SOXA 2MD7B 2YHOA 1GLOA 1BQIA 2KWNA 2VHFA 3O35A 2DCCA 3T7LA 3MHHA 5D1LB 3HWNA 4LJNA 3N9MA 4N4ZA 3O33A 5FB0A 3E1ZB 1TU6A 3BWKA 2PNXA 4X6IA 2MA5A 2MNZA 2K17A 2LXHC 3ZNIA 1POPA 1FBVA 1PPPA 2DJFB 3KNVA 2JMDA 5DINA 2QJ0A 2VNFA 3PURA 4I7CA 2QIZA 3P5WA 1S4VA 4HWYA 1HYJA 2ECVA 2FYEA 3RVWA 2O6XA 1F2CA 3T6RA 2RI7A 9PAPA 4QF2A 3K24A 2LGLA 2PADA 2DJGB 2B1NA 4CDDB 2G6DA 3FL2A 3U5OA 2KR4A 1A6RA 1PPDA 1CV8A 2BDLA 3PHDA 4W4UA 5CHVA 1U6GB 2G45A 2QICA 3QJ3A 1AYUA 3BC3A 3CBKA 2ECIA 4K7CA 3L1ZB 3KSEA 3LQIA 3OF9A 3GV4A 4AUQB 2GHUA 2K4DA 2AYNA 4AVXA 1LDJB 3VK6A 2KFTA 3OVXA 4A0CD 3RPGC 5C13A 1JM7A 4MZSA 2KU3A 2PREA 2M85A 4LADB 4R7EA 2E6SA 2AN6A 2KWKA 3HD3A 2KE1A 3P5XA 2M1RA 4MVTA 4DMXA 2PNSA 4QH6A 1YK8A 2G8EA 2HDPA 5CVNB 5TABA 1M6DA 2Y1MA 1Q6KA 1WEQA 2C2VS 4S3OC 2XEUA 2ECNA 2DC7A 3BPFA 3RTRB 1WESA 4BBQA 4L7XA 1BY8A 1NL6A 1PBHA 1WILA 2H0DA 5LKXA 1AYWA 1U9XA 1N87A 3BPMA 2HH5A 3RVXA 3QSDA 1CPJA 4MZOA 1PCIA 3GL6A 2UZGA 5I3LA 2VPBA 3O7AA 1Y4HA 1THEA 4QF3A 3TNXA 1NQCA 1MM3A 2KGGA 4V3KC 1F29A 2OZ2A 3IUTA 2YT5A 3N9QA 1ATKA 4LLBA 2Y43A 4UP0A 2IPPB 3D6SA 4CDCB 3ZTGA 1JQPA 3L11A 4XI1A 2DZYA 4Q8GA 1CQDA 2YUCA 2OULA 2YYRA 4AYCB 3IEJA 4UP5A 2YJ8A 3S3RA 4BS6A 2YSMA 4MSXA 4X6JA 2G8JA 5AIUA 4YYSA 5B78A 2PBHA 1F62A 3B79A 3U5MA 3KX1A 3KW9A 1BORA 3L1XA 3MHSA 2EODA 1FP0A 1DF0A 2F1GA 2HXZA 1MIRA 1AU3A 2YURA 4BSQA 2YW8A 2AUZA 1CS8A 5JA7A 1VFYA 4R2YA 1EWPA 2ECGA 5AITA 2F6JA 4CDEB 3HHAA 4AXLA 4CZWA 1HYIA 2XU5A 1MM2A 4YYRA 2CKLA 5D1KB 4N3WA 1X4IA 5CHTA 2KYUA 3DF0A 3IOQA 2CSZA 2E03A 2R6NA 2R9MA 4OEMA 5G05B 5LKTA 1ZIVA 5B76A 1AU4A 2C2LA 3O36A 1WENA 1WEMA 4QBBA 1ICFA 4FO9A 4FK5A 4YBTA 2LGVA 2FRQA 1CB5A 4BS5A 3ZPV1 2NAAA 2XU3A 4YYQA 5D1MB 2KWOA 2NQDB 2NQAA 2YJ2A 2CT2A 2DX8A 4P5OB 3PDFA 1WIMA 1Z2QA 2AVWA 1EWOA 2Y6EA 4CA1A 2KIZA 2VPEA 2LGGA 4S3OB 1YK7A 2M3HA 3M62A 1U9QX 1CJLA 4XR7A 2VPGA 3F75A 2DZZA 5DKAA 5B75A 4OELA 2FQ9A 1NLJA 4A49A 3OISA 4YV8A 4YAXA 5TDWA 3MTNA 2MT5A 3M99A 4P6EA 3O70A 2G43A 1YVBA 1X4JA 1STFE 1PADA 2R9NA 3N9OA 2LGKA 2YQLA 1EF7A 1JM7B 4LKAA 3H8CA 4I07A 2VJEA 5H1TA 5EGWA 4AXMA 4A4CA 4YYWA 3U5NA 1AIMA 3EB5A 3BOWA 4YC9A 4GNEA 2JQFR 3N9NA 2K1JA 3I2DA 2DCBA 3V43A 2MUMA 1QMYA 4L58A 4AP4A 3USVA 4X6HA 1MEMA 1MEGA 2OP3A 5B8DA 1V87A 3P5VA 1ME4A 4RY2A 1Z6UA 5C11A 4CDFB 2G6QA 3I06A 3N3GA 4V3LC 3H7DA 1GECE 5K16A 2Y5BA 2H0DB 2HD5A 3V6EA 1PE6A 3RVVA 4Q8HA 3AI8A 1Y08A 1CTEA 2ECWA 2L0BA 4IC2A 1U9VA 3U8EA 5CVOB 3C6WA 4YVAA 2YQMA 2LQ6A 4N4FA 4O64A 1F2AA 4PTBA 1WFKA 4YADA 1SNKA 3CH3X 3KQIA 2BDZA 4FIPA 3C9EA 2MD8C 3CH2X 3SOUA 1QOLA 2XB1A 2YJCA 1YT7A 3PW3A 1HUCB 1MS6A 2MA6A 2L43A 5G0FA 1NPZA 1DVPA 2VP7A 4PP2E 2ACTA 3F5VA 3HTKC 1G25A 1VJVA 5FEYA 2FUIA 2VPDA 1U5IA 2WBFX 1X9YA 2K16A 4ZDTA 2R9CA 4GB0A 1DEUA 4C9ZA 2ATOA 4YYVA 4W5CA 4WZ0A 4LK9A 3PBHA 3PNRA 2VJFA 3ZUAA 3H8BA 3IMAA 4PI3A 3WXEA 4GNGA 4N8WA 3HCSA 2CKLB 1EWLA 3OF8A 1MHWA 3CBJA 5JG6A 3EB6A 4BHWA 2YHNA 5TDRA 1BP4A 7PCKA 3ZVZB 3ERVA 2FUDA 3C5KA 1QDQA 2AIMA 4I7DA 2C0YA 1GCBA 3GCBA 3RPGB 2P0RA 5LKUA 4ZQLA 5JH3A 4W5BA 2FO5A 1K2FA 1AYVA 1RMDA 5H1VA 1PIPA 3K8UA 1MDWA 1WEOA 5TBNA 1CVZA 2E6RA 5J94A 5EF4A 5PADA 1NB3A 1TL9A 4YBMA 3I3TA 1JOCA 4UI9B 1E4UA 1VSNA 5CVMA 1T1HA 2L80A 1AU0A 1QXPA 3LRQA 3LQHA 3P5UA 2AS8A 4I04A 2P86A 2RSDA 5KH9A 1CSBB 2B1MA 1WEEA 2LRIC 3O0UA 2DC6A 1WEUA 1X4UA 2JRJA 4NN2A 4G54A 2DCDA 5TRBA 2IBIA 2CIOA 4GNFA 4KLBA 4PADA 3KFQA 3MORA 2YU4A 1YALA 2VHSA 2Y1NA 5LKZA 1KFUL 2MIQA 2MNYA 4WZ3B 3ZPVE 4YATA 4ZUXU 2CB5A 2NQIA 4YABA 5B79A 2XU1A 2EA6A 1ME3A 3HCUA 2CSYA 2F7DA 2VJEB 4FJCA 5FB1A 2PUYA 3LFYA 3O37A 1PPNA 1SP4B 4BPVA 2LDRA 1WEVA 3S3QA 1XWHA 3WXFA 1ZBDB 1KFXL 2P7UA 2R9FA 3LXSA 2E02A 2KWJA 3H6SA 2E01A 1BGOA 1PPOA 2AYOA 3QZVA 1Z60A 4Q6FA 4B86C 3N4CA 3NHEA 3ASLA 3OVZA 5J3XA 1FH0A 2ARYA 4F52B
chains in the Genus database with same CATH superfamily
2I50A 2KREA 3H89A 1U9WA 1WEPA 3SOWA 3KV5A 2LN0A 4PP1A 2EGPA 4PPEA 1O0EA 2HHNA 3ZVYA 3M63A 2DC9A 1GMYA 2FT2A 1AECA 4BQVA 4P6GA 4QQ4A 4WZ2A 3PUQA 5FPWA 2BU3A 2FRAA 2H7JA 4DMYA 2F42A 3O34A 2D8SA 3WXGA 1IYMA 6PADA 4D8BA 2BAYA 2D8UA 3LQJA 1TLOA 5KH3A 3V6CA 2ECTA 2FUUA 2LV9A 1K3BB 3NG2A 4A4BA 2G7YA 2L75A 5KH7A 2ECJA 3LJUX 1UKFA 3KKUA 4QRXA 1ITOA 2LXPC 2F6NA 1XKGA 2ZETC 5G04B 2KKYA 4IC3A 2AUXA 3QT4A 4N79A 4QRGA 2E00A 2JMJA 1WGMA 4CCGX 2J7QA 3HCTA 5FERA 2DCAA 4TKPB 3N9PA 3PT2A 1PXVA 2IDAA 2DC8A 3SUBA 2YSJA 2XU4A 4YBSA 3SHBA 3DWDA 5EZSA 2VJFB 2NQGA 3K9MA 3BCNA 2GFOA 1F2BA 3DPLR 2BTWB 2JMIA 3KWZA 4R8PK 1WE9A 2YJBA 2JQGR 4R3DA 3O1GA 4OVZA 1VD4A 2HYED 2MKEA 1KHQA 4XUIA 2OWAA 2KGIA 1CHCA 2YREA 4YYUA 2UZJA 2M13A 4GNDA 3DQVR 5LCWB 4B7YC 5F02A 3IV2A 1WEWA 3ZNHA 3N9LA 4X3GA 3ZYQA 3TMPA 3KWBX 4AYCA 1AU2A 4OGCA 1IWDA 1LDKC 5H1UA 5B77A 2CRWA 1KHPA 3HHIA 3N3KA 2FTDA 5EYAF 1VYXA 2AU1A 1KXRA 2OXQC 2LAUA 4WA6A 2JTCA 2M6MA 5A24A 3IHPA 1ZCMA 4QRVA 3KV6A 1NB5A 4Z0RA 1EWMA 2R9OA 2L5UA 3BB7A 8PCHA 2XOZA 2YJ9A 2FSAA 4I7BA 4I05A 3U5PA 5H9MA 3SOXA 2MD7B 2YHOA 2CSVA 1GLOA 1BQIA 3W30A 2KWNA 2VHFA 3H7HA 3O35A 2DCCA 3T7LA 3MHHA 5D1LB 3HWNA 4LJNA 3N9MA 4N4ZA 3O33A 3BY4A 5FB0A 4BOZA 2EXUA 3E1ZB 2B0OE 1TU6A 3BWKA 2PNXA 4X6IA 2MA5A 2MNZA 2K17A 2LXHC 3ZNIA 1POPA 1FBVA 1PPPA 2DJFB 3KNVA 4D8EA 4Z0OA 2JMDA 5DINA 2QJ0A 3MP2A 2VNFA 3PURA 4I7CA 2QIZA 3P5WA 1S4VA 4HWYA 1HYJA 2ECVA 2FYEA 3RVWA 3M7KA 2O6XA 1F2CA 3T6RA 2RI7A 4RF1A 4QF2A 3K24A 9PAPA 2IQJA 2LGLA 2PADA 2DJGB 4PT5A 2B1NA 4F1PA 2G6DA 4CDDB 3FL2A 3U5OA 2RR4A 2KR4A 1A6RA 1PPDA 1CV8A 2BDLA 3PHDA 4W4UA 5CHVA 1U6GB 2G45A 2QICA 3QJ3A 1AYUA 3BC3A 3CBKA 2ECIA 4K7CA 3L1ZB 3KSEA 3LQIA 3OF9A 3GV4A 4AUQB 2GHUA 2K4DA 2AYNA 4AVXA 1LDJB 4WURA 3VK6A 2EGMA 2KFTA 3OVXA 4A0CD 3RPGC 5C13A 1JM7A 4MZSA 2KU3A 2PREA 2M85A 4LADB 4R7EA 2E6SA 2AN6A 4RKXA 2KWKA 2AGAA 3HD3A 2KE1A 3P5XA 2M1RA 4MVTA 2FFWA 4DMXA 2PNSA 4QH6A 1YK8A 2G8EA 2HDPA 3KDEC 2DJAA 2DSMA 5CVNB 5TABA 1M6DA 3FANA 2Y1MA 1Q6KA 1WEQA 2C2VS 4S3OC 2XEUA 2ECNA 2DC7A 3BPFA 3RTRB 1WESA 4BBQA 4L7XA 1BY8A 1NL6A 1DKIA 1PBHA 1WILA 2H0DA 5LKXA 1AYWA 1U9XA 1N87A 3BPMA 5SVIA 3E2DA 5KO3A 2HH5A 3RVXA 3QSDA 1CPJA 4MZOA 1PCIA 3GL6A 2UZGA 5I3LA 2VPBA 3O7AA 1Y4HA 1THEA 4QF3A 4OVZB 1NQCA 5SVXA 3TNXA 1MM3A 2KGGA 4RF0A 4V3KC 1F29A 2OZ2A 3PSEA 3E9SA 3IUTA 4BOSA 2YT5A 3N9QA 1ATKA 4LLBA 2Y43A 4UP0A 2IPPB 3D6SA 4CDCB 3ZTGA 1JQPA 3L11A 4XI1A 2DZYA 4Q8GA 1CQDA 2YUCA 2XU1A 2OULA 2YYRA 4AYCB 3IEJA 4UP5A 1MBMA 2YJ8A 1DCQA 4OW0A 3S3RA 4BS6A 2YSMA 4MSXA 4X6JA 2G8JA 5AIUA 4YYSA 5B78A 3DDTA 1F62A 2PBHA 4GUAA 3B79A 4P16A 3U5MA 3KX1A 3KW9A 1BORA 3L1XA 3MHSA 2EODA 1FP0A 1DF0A 2F1GA 2HXZA 4REZA 1MIRA 1AU3A 2JUNA 2YURA 4BSQA 2YW8A 2AUZA 4BOQA 3FJUB 1CS8A 5JA7A 1VFYA 4R2YA 1EWPA 2ECGA 4M0WA 5AITA 2F6JA 4CDEB 3HHAA 4AXLA 4BOPA 1HYIA 4CZWA 2XU5A 1MM2A 4YYRA 2CKLA 5D1KB 4N3WA 1X4IA 5CHTA 4IUMA 2KYUA 3DF0A 3IOQA 2CSZA 2E03A 2R6NA 2R9MA 4OEMA 5G05B 2JRIA 5LKTA 1ZIVA 5B76A 1AU4A 4ZTBA 2C2LA 3O36A 1WENA 1WEMA 3MDBC 4QBBA 1ICFA 4FO9A 4FK5A 4YBTA 2LGVA 2FRQA 1CB5A 4BS5A 3ZPV1 4BOUA 2NAAA 2XU3A 4YYQA 5D1MB 3LVQE 2KWOA 2NQDB 2NQAA 2YJ2A 2CT2A 3Q1DA 2DX8A 4P5OB 3PDFA 1WIMA 1Z2QA 2AVWA 2FE8A 1EWOA 2Y6EA 5JZEA 4CA1A 2KIZA 2VPEA 2LGGA 4S3OB 1YK7A 2M3HA 3M62A 1U9QX 3PHXA 1CJLA 4XR7A 2VPGA 3F75A 2DZZA 3RNVA 5DKAA 5B75A 4OELA 2FQ9A 1NLJA 4A49A 3OISA 4YV8A 4YAXA 5TDWA 3MTNA 2MT5A 3M99A 4P6EA 3O70A 2G43A 1YVBA 1X4JA 1STFE 1PADA 3BBAA 2R9NA 3N9OA 2LGKA 2YVRA 2YQLA 1EF7A 1JM7B 4LKAA 3H8CA 4I07A 2VJEA 5H1TA 5EGWA 4AXMA 4A4CA 4YYWA 3U5NA 1AIMA 3EB5A 3BOWA 4YC9A 4GNEA 2JQFR 3FM8C 3N9NA 2K1JA 3I2DA 5SVYA 2DCBA 3V43A 2JM3A 2MUMA 4L58A 1QMYA 4AP4A 3USVA 4X6HA 1MEMA 1MEGA 2OP3A 3O47A 3O65A 5B8DA 1V87A 3P5VA 1ME4A 4RY2A 1Z6UA 5C11A 4CDFB 2G6QA 3I06A 3N3GA 4V3LC 3H7DA 1GECE 5K16A 2Y5BA 2H0DB 4H9DA 2HD5A 3V6EA 2XP0A 1PE6A 3RVVA 4Q8HA 3AI8A 1Y08A 3JUEA 5SVIB 4OGEA 1CTEA 2ECWA 2L0BA 4IC2A 5K3QA 1U9VA 5CVOB 3C6WA 3U8EA 4YVAA 2YQMA 2LQ6A 4N4FA 4O64A 1F2AA 4PTBA 1WFKA 4YADA 4XZXA 1SNKA 3OQCA 3CH3X 3KQIA 2BDZA 4FIPA 3C9EA 2MD8C 3CH2X 3SOUA 1QOLA 2XB1A 2YJCA 1YT7A 3PW3A 1HUCB 1MS6A 2MA6A 2L43A 5G0FA 1NPZA 1DVPA 4A5UA 2VP7A 3C0RA 3TRKA 4MM3B 4PP2E 2ACTA 3F5VA 3HTKC 1G25A 1VJVA 2CRRA 2DOSA 5FEYA 2FUIA 2VPDA 1U5IA 2WBFX 1X9YA 2K16A 4ZDTA 2R9CA 2XOCA 4GB0A 1DEUA 4C9ZA 1YZBA 2ATOA 4YYVA 4W5CA 4WZ0A 4LK9A 3PBHA 3PNRA 2VJFA 3PHWA 3ZUAA 3H8BA 3IMAA 4IP3A 4PI3A 3WXEA 2BTWA 4GNGA 4N8WA 3HCSA 2CKLB 1EWLA 3OF8A 1MHWA 3LVRE 3CBJA 5JG6A 3EB6A 4BHWA 2YHNA 5TDRA 1BP4A 7PCKA 3MJ5A 4D8IA 3ZVZB 2HWKA 3FEHA 3ERVA 3PHUA 2FUDA 3C5KA 1QDQA 2E61A 2AIMA 2L7PA 4I7DA 2C0YA 1GCBA 3GCBA 4RNAA 3RPGB 2P0RA 5LKUA 4ZQLA 5JH3A 4W5BA 3PRPA 5EZQA 3B21A 2FO5A 1K2FA 1AYVA 1RMDA 5H1VA 1PIPA 2J7QC 3K8UA 1MDWA 1WEOA 5TBNA 1CVZA 2E6RA 5J94A 5EF4A 5PADA 1NB3A 1TL9A 4YBMA 4MI7A 3I3TA 3MTVA 1JOCA 4UI9B 3LDYA 1E4UA 1VSNA 5CVMA 1T1HA 2L80A 1AU0A 1QXPA 3LRQA 3LQHA 3P5UA 2AS8A 4I04A 3PRMA 3FAOA 5E6JA 2P86A 2RSDA 5KH9A 1CSBB 2B1MA 1WEEA 2LRIC 3O0UA 2FD4A 2DC6A 3IFUA 1WEUA 1X4UA 2JRJA 2P57A 4NN2A 4G54A 4HXDB 2DCDA 5TRBA 2IBIA 2CIOA 4GNFA 4KLBA 4PADA 3KFQA 3MORA 2YU4A 1YALA 2VHSA 2Y1NA 5LKZA 1KFUL 2MIQA 2MNYA 4WZ3B 3ZPVE 4YATA 4ZUXU 2CB5A 2NQIA 2CONA 4O62A 4YABA 5B79A 2EA6A 2XOYA 1ME3A 3HCUA 2CSYA 2F7DA 2VJEB 4FJCA 5FB1A 2PUYA 3LFYA 3O37A 1PPNA 1SP4B 4BPVA 2LDRA 2KKXA 1WEVA 3S3QA 1PVJA 1XWHA 3WXFA 1ZBDB 1KFXL 2P7UA 2R9FA 2Z84A 3LXSA 2E02A 2KWJA 3H6SA 2E01A 1BGOA 1PPOA 2AYOA 3QZVA 1Z60A 3W31A 4Q6FA 4B86C 3N4CA 3PLWA 3ASLA 3T9KA 3NHEA 3OVZA 5J3XA 1FH0A 2ARYA 4F52B
chains in the Genus database with same CATH topology
2I50A 2KREA 3H89A 1U9WA 1WEPA 3SOWA 3KV5A 2LN0A 4PP1A 2EGPA 4PPEA 2VFCA 1O0EA 2HHNA 3ZVYA 3M63A 2DC9A 1GMYA 4B55A 2FT2A 1AECA 4BQVA 4P6GA 4WZ2A 3PUQA 5FPWA 2FRAA 2H7JA 4DMYA 2F42A 3O34A 2D8SA 3WXGA 1IYMA 6PADA 2BAYA 3LQJA 1TLOA 5KH3A 3V6CA 2ECTA 2FUUA 2LV9A 1K3BB 3NG2A 4A4BA 2G7YA 2L75A 5KH7A 2ECJA 3KKUA 4QRXA 1ITOA 2LXPC 2F6NA 1XKGA 2ZETC 5G04B 4IC3A 2AUXA 3QT4A 4N79A 4QRGA 2E00A 2JMJA 1WGMA 4CCGX 3HCTA 5FERA 2DCAA 4TKPB 3N9PA 1PXVA 2IDAA 2DC8A 2YSJA 2XU4A 4YBSA 3SHBA 2VJFB 2NQGA 3K9MA 3BCNA 2GFOA 1F2BA 3DPLR 2JMIA 3KWZA 4R8PK 1WE9A 2YJBA 2JQGR 3O1GA 1VD4A 2HYED 1KHQA 4XUIA 2YREA 2KGIA 1CHCA 4YYUA 4GNDA 3DQVR 5LCWB 4B7YC 5F02A 3IV2A 1WEWA 3N9LA 4X3GA 3ZYQA 3KWBX 4AYCA 1AU2A 1IWDA 1LDKC 5H1UA 5B77A 1KHPA 3HHIA 3N3KA 2FTDA 5EYAF 1VYXA 2AU1A 1KXRA 2OXQC 2VFBA 4WA6A 2M6MA 5A24A 3IHPA 1ZCMA 4QRVA 3KV6A 1NB5A 1EWMA 2R9OA 2L5UA 8PCHA 2YJ9A 2FSAA 4I7BA 3D9WA 4I05A 3U5PA 5H9MA 3SOXA 2MD7B 2YHOA 1GLOA 1BQIA 2KWNA 2VHFA 3O35A 2DCCA 3T7LA 3MHHA 5D1LB 3HWNA 4LJNA 3N9MA 4N4ZA 3O33A 5FB0A 3E1ZB 1TU6A 3BWKA 2PNXA 4X6IA 2MA5A 2MNZA 2K17A 2LXHC 3ZNIA 1POPA 1FBVA 1PPPA 2DJFB 3KNVA 2JMDA 5DINA 2QJ0A 2VNFA 3PURA 4I7CA 2QIZA 3P5WA 1S4VA 4HWYA 1HYJA 2ECVA 2FYEA 3RVWA 1E2TA 2O6XA 1F2CA 3T6RA 2RI7A 9PAPA 4QF2A 3K24A 2LGLA 2PADA 2DJGB 2B1NA 4CDDB 2G6DA 3FL2A 3U5OA 2KR4A 1A6RA 1PPDA 1CV8A 2BDLA 3PHDA 4W4UA 5CHVA 1U6GB 2G45A 2QICA 3QJ3A 1AYUA 3BC3A 3CBKA 2ECIA 4K7CA 3L1ZB 3KSEA 3LQIA 3OF9A 3GV4A 4AUQB 2GHUA 2K4DA 2AYNA 4AVXA 1LDJB 3VK6A 2KFTA 3OVXA 4A0CD 3RPGC 5C13A 1JM7A 4MZSA 2KU3A 2PREA 2M85A 4LADB 4R7EA 2E6SA 2AN6A 2KWKA 3HD3A 2KE1A 3P5XA 2M1RA 4MVTA 4DMXA 2PNSA 4QH6A 1YK8A 2G8EA 2HDPA 5CVNB 5TABA 1M6DA 2Y1MA 1Q6KA 1WEQA 2C2VS 4S3OC 2XEUA 2ECNA 2DC7A 3BPFA 3RTRB 1WESA 4BBQA 4L7XA 1BY8A 1NL6A 1PBHA 1WILA 2H0DA 5LKXA 1AYWA 1U9XA 1N87A 3BPMA 2HH5A 3RVXA 3QSDA 1CPJA 4MZOA 1PCIA 3GL6A 2UZGA 5I3LA 2VPBA 3O7AA 1Y4HA 1THEA 4QF3A 3TNXA 1NQCA 1MM3A 2KGGA 4V3KC 1F29A 2OZ2A 3IUTA 2YT5A 3N9QA 1ATKA 4LLBA 2Y43A 4UP0A 2IPPB 3D6SA 4CDCB 3ZTGA 1JQPA 3L11A 4XI1A 2DZYA 4Q8GA 1CQDA 2YUCA 2OULA 2YYRA 4AYCB 3IEJA 4UP5A 2YJ8A 3S3RA 4BS6A 2YSMA 4MSXA 4X6JA 2G8JA 5AIUA 4YYSA 5B78A 2PBHA 1F62A 3B79A 3U5MA 3KX1A 3KW9A 1BORA 3L1XA 3MHSA 2EODA 1FP0A 1DF0A 2F1GA 2HXZA 1MIRA 1AU3A 2YURA 4BSQA 2YW8A 2AUZA 1CS8A 5JA7A 1VFYA 4R2YA 1EWPA 2ECGA 5AITA 2F6JA 4CDEB 3HHAA 4AXLA 4CZWA 1HYIA 2XU5A 1MM2A 4YYRA 2CKLA 5D1KB 4N3WA 1X4IA 5CHTA 2KYUA 3DF0A 3IOQA 2CSZA 2E03A 2R6NA 2R9MA 4OEMA 5G05B 5LKTA 1ZIVA 5B76A 1AU4A 2C2LA 3O36A 1WENA 1WEMA 4QBBA 1ICFA 4FO9A 4FK5A 4YBTA 2LGVA 2FRQA 1CB5A 4BS5A 3ZPV1 2NAAA 2XU3A 4YYQA 5D1MB 2KWOA 2NQDB 2NQAA 2YJ2A 2CT2A 2DX8A 4P5OB 3PDFA 1WIMA 1Z2QA 2AVWA 1EWOA 2Y6EA 4CA1A 2KIZA 1W5RA 2VPEA 2LGGA 4S3OB 1YK7A 2M3HA 3M62A 1U9QX 1CJLA 4XR7A 2VPGA 3F75A 2DZZA 5DKAA 5B75A 4OELA 2FQ9A 1NLJA 4A49A 3OISA 4YV8A 4YAXA 5TDWA 3MTNA 2MT5A 3M99A 1W4TA 4P6EA 3O70A 2G43A 1YVBA 1X4JA 1STFE 1PADA 2R9NA 3N9OA 2LGKA 2YQLA 1EF7A 1JM7B 4LKAA 3H8CA 4I07A 2VJEA 5H1TA 5EGWA 4AXMA 4A4CA 4BGFA 4YYWA 3U5NA 1AIMA 3EB5A 3BOWA 4YC9A 4GNEA 2JQFR 3N9NA 2K1JA 3I2DA 2DCBA 3V43A 2MUMA 1QMYA 4L58A 4AP4A 3USVA 4X6HA 1MEMA 1MEGA 2OP3A 5B8DA 1V87A 3P5VA 1ME4A 4RY2A 1Z6UA 5C11A 4CDFB 2G6QA 3I06A 3N3GA 4V3LC 3H7DA 1GECE 5K16A 2Y5BA 2H0DB 2HD5A 3V6EA 1PE6A 3RVVA 4Q8HA 3AI8A 1Y08A 1CTEA 2ECWA 2L0BA 4IC2A 1U9VA 3U8EA 5CVOB 3C6WA 4YVAA 2YQMA 2LQ6A 4N4FA 4O64A 1F2AA 4PTBA 1WFKA 4YADA 1SNKA 3CH3X 3KQIA 2BDZA 4FIPA 3C9EA 2MD8C 3CH2X 3SOUA 1QOLA 2XB1A 2YJCA 1YT7A 3PW3A 1HUCB 1MS6A 2MA6A 2L43A 5G0FA 1NPZA 1DVPA 2VP7A 4NV8A 4NV7A 4PP2E 2ACTA 3F5VA 3HTKC 1G25A 1VJVA 5FEYA 2FUIA 2VPDA 1U5IA 2BSZA 1X9YA 2WBFX 2K16A 4ZDTA 2R9CA 4GB0A 1DEUA 4C9ZA 2ATOA 4YYVA 4W5CA 4WZ0A 4LK9A 3PBHA 3PNRA 2VJFA 3ZUAA 3H8BA 3IMAA 4PI3A 3WXEA 4GNGA 4N8WA 3HCSA 2CKLB 1EWLA 3OF8A 1MHWA 3CBJA 5JG6A 3EB6A 4BHWA 2YHNA 5TDRA 1BP4A 7PCKA 3ZVZB 1GX3A 3ERVA 2FUDA 3C5KA 1QDQA 2AIMA 4I7DA 2C0YA 1GCBA 3GCBA 3RPGB 2P0RA 5LKUA 4ZQLA 5JH3A 4W5BA 2FO5A 1K2FA 1AYVA 1RMDA 5H1VA 1PIPA 3K8UA 1MDWA 1WEOA 5TBNA 1CVZA 2E6RA 5J94A 5EF4A 5PADA 1NB3A 1TL9A 4YBMA 3I3TA 1JOCA 4UI9B 1E4UA 1VSNA 5CVMA 1T1HA 2L80A 1AU0A 1QXPA 3LRQA 3LQHA 3P5UA 2AS8A 4I04A 2P86A 2RSDA 5KH9A 1CSBB 2B1MA 1WEEA 2LRIC 3O0UA 2DC6A 1WEUA 1X4UA 2JRJA 4NN2A 4G54A 2DCDA 5TRBA 2IBIA 2CIOA 4GNFA 4KLBA 4PADA 3KFQA 3MORA 3LTWA 2YU4A 1YALA 1W6FA 2Y1NA 5LKZA 1KFUL 2VHSA 2MIQA 2MNYA 4WZ3B 3ZPVE 4YATA 4ZUXU 2CB5A 2NQIA 4YABA 5B79A 2XU1A 4GUZA 2EA6A 1ME3A 3HCUA 2CSYA 2F7DA 2VJEB 4FJCA 5FB1A 2PUYA 3LFYA 3O37A 1PPNA 1SP4B 4BPVA 2LDRA 1WEVA 3S3QA 1XWHA 3WXFA 1ZBDB 1KFXL 2P7UA 4C5PA 2R9FA 3LXSA 2E02A 2KWJA 3H6SA 2E01A 1BGOA 1PPOA 2AYOA 3QZVA 1Z60A 4Q6FA 4B86C 3N4CA 3NHEA 3ASLA 3OVZA 5J3XA 1FH0A 2ARYA 4F52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I50 A;  2KRE A;  3H89 A;  1U9W A;  1WEP A;  3SOW A;  3KV5 A;  2LN0 A;  4PP1 A;  2EGP A;  4PPE A;  1O0E A;  2HHN A;  3ZVY A;  3M63 A;  2DC9 A;  1GMY A;  2FT2 A;  1AEC A;  4BQV A;  4P6G A;  4WZ2 A;  3PUQ A;  5FPW A;  2FRA A;  2H7J A;  4DMY A;  2F42 A;  3O34 A;  2D8S A;  3WXG A;  1IYM A;  6PAD A;  2BAY A;  3LQJ A;  1TLO A;  5KH3 A;  3V6C A;  2ECT A;  2FUU A;  2LV9 A;  1K3B B;  3NG2 A;  4A4B A;  2G7Y A;  2L75 A;  5KH7 A;  2ECJ A;  3KKU A;  4QRX A;  1ITO A;  2LXP C;  2F6N A;  1XKG A;  2ZET C;  5G04 B;  4IC3 A;  2AUX A;  3QT4 A;  4N79 A;  4QRG A;  2E00 A;  2JMJ A;  1WGM A;  4CCG X;  3HCT A;  5FER A;  2DCA A;  4TKP B;  3N9P A;  1PXV A;  2IDA A;  2DC8 A;  2YSJ A;  2XU4 A;  4YBS A;  3SHB A;  2VJF B;  2NQG A;  3K9M A;  3BCN A;  2GFO A;  1F2B A;  3DPL R;  2JMI A;  3KWZ A;  4R8P K;  1WE9 A;  2YJB A;  2JQG R;  3O1G A;  1VD4 A;  2HYE D;  1KHQ A;  4XUI A;  2YRE A;  2KGI A;  1CHC A;  4YYU A;  4GND A;  3DQV R;  5LCW B;  4B7Y C;  5F02 A;  3IV2 A;  1WEW A;  3N9L A;  4X3G A;  3ZYQ A;  3KWB X;  4AYC A;  1AU2 A;  1IWD A;  1LDK C;  5H1U A;  5B77 A;  1KHP A;  3HHI A;  3N3K A;  2FTD A;  5EYA F;  1VYX A;  2AU1 A;  1KXR A;  2OXQ C;  4WA6 A;  2M6M A;  5A24 A;  3IHP A;  1ZCM A;  4QRV A;  3KV6 A;  1NB5 A;  1EWM A;  2R9O A;  2L5U A;  8PCH A;  2YJ9 A;  2FSA A;  4I7B A;  4I05 A;  3U5P A;  5H9M A;  3SOX A;  2MD7 B;  2YHO A;  1GLO A;  1BQI A;  2KWN A;  2VHF A;  3O35 A;  2DCC A;  3T7L A;  3MHH A;  5D1L B;  3HWN A;  4LJN A;  3N9M A;  4N4Z A;  3O33 A;  5FB0 A;  3E1Z B;  1TU6 A;  3BWK A;  2PNX A;  4X6I A;  2MA5 A;  2MNZ A;  2K17 A;  2LXH C;  3ZNI A;  1POP A;  1FBV A;  1PPP A;  2DJF B;  3KNV A;  2JMD A;  5DIN A;  2QJ0 A;  2VNF A;  3PUR A;  4I7C A;  2QIZ A;  3P5W A;  1S4V A;  4HWY A;  1HYJ A;  2ECV A;  2FYE A;  3RVW A;  2O6X A;  1F2C A;  3T6R A;  2RI7 A;  9PAP A;  4QF2 A;  3K24 A;  2LGL A;  2PAD A;  2DJG B;  2B1N A;  4CDD B;  2G6D A;  3FL2 A;  3U5O A;  2KR4 A;  1A6R A;  1PPD A;  1CV8 A;  2BDL A;  3PHD A;  4W4U A;  5CHV A;  1U6G B;  2G45 A;  2QIC A;  3QJ3 A;  1AYU A;  3BC3 A;  3CBK A;  2ECI A;  4K7C A;  3L1Z B;  3KSE A;  3LQI A;  3OF9 A;  3GV4 A;  4AUQ B;  2GHU A;  2K4D A;  2AYN A;  4AVX A;  1LDJ B;  3VK6 A;  2KFT A;  3OVX A;  4A0C D;  3RPG C;  5C13 A;  1JM7 A;  4MZS A;  2KU3 A;  2PRE A;  2M85 A;  4LAD B;  4R7E A;  2E6S A;  2AN6 A;  2KWK A;  3HD3 A;  2KE1 A;  3P5X A;  2M1R A;  4MVT A;  4DMX A;  2PNS A;  4QH6 A;  1YK8 A;  2G8E A;  2HDP A;  5CVN B;  5TAB A;  1M6D A;  2Y1M A;  1Q6K A;  1WEQ A;  2C2V S;  4S3O C;  2XEU A;  2ECN A;  2DC7 A;  3BPF A;  3RTR B;  1WES A;  4BBQ A;  4L7X A;  1BY8 A;  1NL6 A;  1PBH A;  1WIL A;  2H0D A;  5LKX A;  1AYW A;  1U9X A;  1N87 A;  3BPM A;  2HH5 A;  3RVX A;  3QSD A;  1CPJ A;  4MZO A;  1PCI A;  3GL6 A;  2UZG A;  5I3L A;  2VPB A;  3O7A A;  1Y4H A;  1THE A;  4QF3 A;  3TNX A;  1NQC A;  1MM3 A;  2KGG A;  4V3K C;  1F29 A;  2OZ2 A;  3IUT A;  2YT5 A;  3N9Q A;  1ATK A;  4LLB A;  2Y43 A;  4UP0 A;  2IPP B;  3D6S A;  4CDC B;  3ZTG A;  1JQP A;  3L11 A;  4XI1 A;  2DZY A;  4Q8G A;  1CQD A;  2YUC A;  2OUL A;  2YYR A;  4AYC B;  3IEJ A;  4UP5 A;  2YJ8 A;  3S3R A;  4BS6 A;  2YSM A;  4MSX A;  4X6J A;  2G8J A;  5AIU A;  4YYS A;  5B78 A;  2PBH A;  1F62 A;  3B79 A;  3U5M A;  3KX1 A;  3KW9 A;  1BOR A;  3L1X A;  3MHS A;  2EOD A;  1FP0 A;  1DF0 A;  2F1G A;  2HXZ A;  1MIR A;  1AU3 A;  2YUR A;  4BSQ A;  2YW8 A;  2AUZ A;  1CS8 A;  5JA7 A;  1VFY A;  4R2Y A;  1EWP A;  2ECG A;  5AIT A;  2F6J A;  4CDE B;  3HHA A;  4AXL A;  4CZW A;  1HYI A;  2XU5 A;  1MM2 A;  4YYR A;  2CKL A;  5D1K B;  4N3W A;  1X4I A;  5CHT A;  2KYU A;  3DF0 A;  3IOQ A;  2CSZ A;  2E03 A;  2R6N A;  2R9M A;  4OEM A;  5G05 B;  5LKT A;  1ZIV A;  5B76 A;  1AU4 A;  2C2L A;  3O36 A;  1WEN A;  1WEM A;  4QBB A;  1ICF A;  4FO9 A;  4FK5 A;  4YBT A;  2LGV A;  2FRQ A;  1CB5 A;  4BS5 A;  3ZPV 1;  2NAA A;  2XU3 A;  4YYQ A;  5D1M B;  2KWO A;  2NQD B;  2NQA A;  2YJ2 A;  2CT2 A;  2DX8 A;  4P5O B;  3PDF A;  1WIM A;  1Z2Q A;  2AVW A;  1EWO A;  2Y6E A;  4CA1 A;  2KIZ A;  2VPE A;  2LGG A;  4S3O B;  1YK7 A;  2M3H A;  3M62 A;  1U9Q X;  1CJL A;  4XR7 A;  2VPG A;  3F75 A;  2DZZ A;  5DKA A;  5B75 A;  4OEL A;  2FQ9 A;  1NLJ A;  4A49 A;  3OIS A;  4YV8 A;  4YAX A;  5TDW A;  3MTN A;  2MT5 A;  3M99 A;  4P6E A;  3O70 A;  2G43 A;  1YVB A;  1X4J A;  1STF E;  1PAD A;  2R9N A;  3N9O A;  2LGK A;  2YQL A;  1EF7 A;  1JM7 B;  4LKA A;  3H8C A;  4I07 A;  2VJE A;  5H1T A;  5EGW A;  4AXM A;  4A4C A;  4YYW A;  3U5N A;  1AIM A;  3EB5 A;  3BOW A;  4YC9 A;  4GNE A;  2JQF R;  3N9N A;  2K1J A;  3I2D A;  2DCB A;  3V43 A;  2MUM A;  1QMY A;  4L58 A;  4AP4 A;  3USV A;  4X6H A;  1MEM A;  1MEG A;  2OP3 A;  5B8D A;  1V87 A;  3P5V A;  1ME4 A;  4RY2 A;  1Z6U A;  5C11 A;  4CDF B;  2G6Q A;  3I06 A;  3N3G A;  4V3L C;  3H7D A;  1GEC E;  5K16 A;  2Y5B A;  2H0D B;  2HD5 A;  3V6E A;  1PE6 A;  3RVV A;  4Q8H A;  3AI8 A;  1Y08 A;  1CTE A;  2ECW A;  2L0B A;  4IC2 A;  1U9V A;  3U8E A;  5CVO B;  3C6W A;  4YVA A;  2YQM A;  2LQ6 A;  4N4F A;  4O64 A;  1F2A A;  4PTB A;  1WFK A;  4YAD A;  1SNK A;  3CH3 X;  3KQI A;  2BDZ A;  4FIP A;  3C9E A;  2MD8 C;  3CH2 X;  3SOU A;  1QOL A;  2XB1 A;  2YJC A;  1YT7 A;  3PW3 A;  1HUC B;  1MS6 A;  2MA6 A;  2L43 A;  5G0F A;  1NPZ A;  1DVP A;  2VP7 A;  4PP2 E;  2ACT A;  3F5V A;  3HTK C;  1G25 A;  1VJV A;  5FEY A;  2FUI A;  2VPD A;  1U5I A;  2WBF X;  1X9Y A;  2K16 A;  4ZDT A;  2R9C A;  4GB0 A;  1DEU A;  4C9Z A;  2ATO A;  4YYV A;  4W5C A;  4WZ0 A;  4LK9 A;  3PBH A;  3PNR A;  2VJF A;  3ZUA A;  3H8B A;  3IMA A;  4PI3 A;  3WXE A;  4GNG A;  4N8W A;  3HCS A;  2CKL B;  1EWL A;  3OF8 A;  1MHW A;  3CBJ A;  5JG6 A;  3EB6 A;  4BHW A;  2YHN A;  5TDR A;  1BP4 A;  7PCK A;  3ZVZ B;  3ERV A;  2FUD A;  3C5K A;  1QDQ A;  2AIM A;  4I7D A;  2C0Y A;  1GCB A;  3GCB A;  3RPG B;  2P0R A;  5LKU A;  4ZQL A;  5JH3 A;  4W5B A;  2FO5 A;  1K2F A;  1AYV A;  1RMD A;  5H1V A;  1PIP A;  3K8U A;  1MDW A;  1WEO A;  5TBN A;  1CVZ A;  2E6R A;  5J94 A;  5EF4 A;  5PAD A;  1NB3 A;  1TL9 A;  4YBM A;  3I3T A;  1JOC A;  4UI9 B;  1E4U A;  1VSN A;  5CVM A;  1T1H A;  2L80 A;  1AU0 A;  1QXP A;  3LRQ A;  3LQH A;  3P5U A;  2AS8 A;  4I04 A;  2P86 A;  2RSD A;  5KH9 A;  1CSB B;  2B1M A;  1WEE A;  2LRI C;  3O0U A;  2DC6 A;  1WEU A;  1X4U A;  2JRJ A;  4NN2 A;  4G54 A;  2DCD A;  5TRB A;  2IBI A;  2CIO A;  4GNF A;  4KLB A;  4PAD A;  3KFQ A;  3MOR A;  2YU4 A;  1YAL A;  2VHS A;  2Y1N A;  5LKZ A;  1KFU L;  2MIQ A;  2MNY A;  4WZ3 B;  3ZPV E;  4YAT A;  4ZUX U;  2CB5 A;  2NQI A;  4YAB A;  5B79 A;  2XU1 A;  2EA6 A;  1ME3 A;  3HCU A;  2CSY A;  2F7D A;  2VJE B;  4FJC A;  5FB1 A;  2PUY A;  3LFY A;  3O37 A;  1PPN A;  1SP4 B;  4BPV A;  2LDR A;  1WEV A;  3S3Q A;  1XWH A;  3WXF A;  1ZBD B;  1KFX L;  2P7U A;  2R9F A;  3LXS A;  2E02 A;  2KWJ A;  3H6S A;  2E01 A;  1BGO A;  1PPO A;  2AYO A;  3QZV A;  1Z60 A;  4Q6F A;  4B86 C;  3N4C A;  3NHE A;  3ASL A;  3OVZ A;  5J3X A;  1FH0 A;  2ARY A;  4F52 B; 
#chains in the Genus database with same CATH topology
 2I50 A;  2KRE A;  3H89 A;  1U9W A;  1WEP A;  3SOW A;  3KV5 A;  2LN0 A;  4PP1 A;  2EGP A;  4PPE A;  1O0E A;  2HHN A;  3ZVY A;  3M63 A;  2DC9 A;  1GMY A;  2FT2 A;  1AEC A;  4BQV A;  4P6G A;  4QQ4 A;  4WZ2 A;  3PUQ A;  5FPW A;  2BU3 A;  2FRA A;  2H7J A;  4DMY A;  2F42 A;  3O34 A;  2D8S A;  3WXG A;  1IYM A;  6PAD A;  4D8B A;  2BAY A;  2D8U A;  3LQJ A;  1TLO A;  5KH3 A;  3V6C A;  2ECT A;  2FUU A;  2LV9 A;  1K3B B;  3NG2 A;  4A4B A;  2G7Y A;  2L75 A;  5KH7 A;  2ECJ A;  3LJU X;  1UKF A;  3KKU A;  4QRX A;  1ITO A;  2LXP C;  2F6N A;  1XKG A;  2ZET C;  5G04 B;  2KKY A;  4IC3 A;  2AUX A;  3QT4 A;  4N79 A;  4QRG A;  2E00 A;  2JMJ A;  1WGM A;  4CCG X;  2J7Q A;  3HCT A;  5FER A;  2DCA A;  4TKP B;  3N9P A;  3PT2 A;  1PXV A;  2IDA A;  2DC8 A;  3SUB A;  2YSJ A;  2XU4 A;  4YBS A;  3SHB A;  3DWD A;  5EZS A;  2VJF B;  2NQG A;  3K9M A;  3BCN A;  2GFO A;  1F2B A;  3DPL R;  2BTW B;  2JMI A;  3KWZ A;  4R8P K;  1WE9 A;  2YJB A;  2JQG R;  4R3D A;  3O1G A;  4OVZ A;  1VD4 A;  2HYE D;  2MKE A;  1KHQ A;  4XUI A;  2OWA A;  2KGI A;  1CHC A;  2YRE A;  4YYU A;  2UZJ A;  2M13 A;  4GND A;  3DQV R;  5LCW B;  4B7Y C;  5F02 A;  3IV2 A;  1WEW A;  3ZNH A;  3N9L A;  4X3G A;  3ZYQ A;  3TMP A;  3KWB X;  4AYC A;  1AU2 A;  4OGC A;  1IWD A;  1LDK C;  5H1U A;  5B77 A;  2CRW A;  1KHP A;  3HHI A;  3N3K A;  2FTD A;  5EYA F;  1VYX A;  2AU1 A;  1KXR A;  2OXQ C;  2LAU A;  4WA6 A;  2JTC A;  2M6M A;  5A24 A;  3IHP A;  1ZCM A;  4QRV A;  3KV6 A;  1NB5 A;  4Z0R A;  1EWM A;  2R9O A;  2L5U A;  3BB7 A;  8PCH A;  2XOZ A;  2YJ9 A;  2FSA A;  4I7B A;  4I05 A;  3U5P A;  5H9M A;  3SOX A;  2MD7 B;  2YHO A;  2CSV A;  1GLO A;  1BQI A;  3W30 A;  2KWN A;  2VHF A;  3H7H A;  3O35 A;  2DCC A;  3T7L A;  3MHH A;  5D1L B;  3HWN A;  4LJN A;  3N9M A;  4N4Z A;  3O33 A;  3BY4 A;  5FB0 A;  4BOZ A;  2EXU A;  3E1Z B;  2B0O E;  1TU6 A;  3BWK A;  2PNX A;  4X6I A;  2MA5 A;  2MNZ A;  2K17 A;  2LXH C;  3ZNI A;  1POP A;  1FBV A;  1PPP A;  2DJF B;  3KNV A;  4D8E A;  4Z0O A;  2JMD A;  5DIN A;  2QJ0 A;  3MP2 A;  2VNF A;  3PUR A;  4I7C A;  2QIZ A;  3P5W A;  1S4V A;  4HWY A;  1HYJ A;  2ECV A;  2FYE A;  3RVW A;  3M7K A;  2O6X A;  1F2C A;  3T6R A;  2RI7 A;  4RF1 A;  4QF2 A;  3K24 A;  9PAP A;  2IQJ A;  2LGL A;  2PAD A;  2DJG B;  4PT5 A;  2B1N A;  4F1P A;  2G6D A;  4CDD B;  3FL2 A;  3U5O A;  2RR4 A;  2KR4 A;  1A6R A;  1PPD A;  1CV8 A;  2BDL A;  3PHD A;  4W4U A;  5CHV A;  1U6G B;  2G45 A;  2QIC A;  3QJ3 A;  1AYU A;  3BC3 A;  3CBK A;  2ECI A;  4K7C A;  3L1Z B;  3KSE A;  3LQI A;  3OF9 A;  3GV4 A;  4AUQ B;  2GHU A;  2K4D A;  2AYN A;  4AVX A;  1LDJ B;  4WUR A;  3VK6 A;  2EGM A;  2KFT A;  3OVX A;  4A0C D;  3RPG C;  5C13 A;  1JM7 A;  4MZS A;  2KU3 A;  2PRE A;  2M85 A;  4LAD B;  4R7E A;  2E6S A;  2AN6 A;  4RKX A;  2KWK A;  2AGA A;  3HD3 A;  2KE1 A;  3P5X A;  2M1R A;  4MVT A;  2FFW A;  4DMX A;  2PNS A;  4QH6 A;  1YK8 A;  2G8E A;  2HDP A;  3KDE C;  2DJA A;  2DSM A;  5CVN B;  5TAB A;  1M6D A;  3FAN A;  2Y1M A;  1Q6K A;  1WEQ A;  2C2V S;  4S3O C;  2XEU A;  2ECN A;  2DC7 A;  3BPF A;  3RTR B;  1WES A;  4BBQ A;  4L7X A;  1BY8 A;  1NL6 A;  1DKI A;  1PBH A;  1WIL A;  2H0D A;  5LKX A;  1AYW A;  1U9X A;  1N87 A;  3BPM A;  5SVI A;  3E2D A;  5KO3 A;  2HH5 A;  3RVX A;  3QSD A;  1CPJ A;  4MZO A;  1PCI A;  3GL6 A;  2UZG A;  5I3L A;  2VPB A;  3O7A A;  1Y4H A;  1THE A;  4QF3 A;  4OVZ B;  1NQC A;  5SVX A;  3TNX A;  1MM3 A;  2KGG A;  4RF0 A;  4V3K C;  1F29 A;  2OZ2 A;  3PSE A;  3E9S A;  3IUT A;  4BOS A;  2YT5 A;  3N9Q A;  1ATK A;  4LLB A;  2Y43 A;  4UP0 A;  2IPP B;  3D6S A;  4CDC B;  3ZTG A;  1JQP A;  3L11 A;  4XI1 A;  2DZY A;  4Q8G A;  1CQD A;  2YUC A;  2XU1 A;  2OUL A;  2YYR A;  4AYC B;  3IEJ A;  4UP5 A;  1MBM A;  2YJ8 A;  1DCQ A;  4OW0 A;  3S3R A;  4BS6 A;  2YSM A;  4MSX A;  4X6J A;  2G8J A;  5AIU A;  4YYS A;  5B78 A;  3DDT A;  1F62 A;  2PBH A;  4GUA A;  3B79 A;  4P16 A;  3U5M A;  3KX1 A;  3KW9 A;  1BOR A;  3L1X A;  3MHS A;  2EOD A;  1FP0 A;  1DF0 A;  2F1G A;  2HXZ A;  4REZ A;  1MIR A;  1AU3 A;  2JUN A;  2YUR A;  4BSQ A;  2YW8 A;  2AUZ A;  4BOQ A;  3FJU B;  1CS8 A;  5JA7 A;  1VFY A;  4R2Y A;  1EWP A;  2ECG A;  4M0W A;  5AIT A;  2F6J A;  4CDE B;  3HHA A;  4AXL A;  4BOP A;  1HYI A;  4CZW A;  2XU5 A;  1MM2 A;  4YYR A;  2CKL A;  5D1K B;  4N3W A;  1X4I A;  5CHT A;  4IUM A;  2KYU A;  3DF0 A;  3IOQ A;  2CSZ A;  2E03 A;  2R6N A;  2R9M A;  4OEM A;  5G05 B;  2JRI A;  5LKT A;  1ZIV A;  5B76 A;  1AU4 A;  4ZTB A;  2C2L A;  3O36 A;  1WEN A;  1WEM A;  3MDB C;  4QBB A;  1ICF A;  4FO9 A;  4FK5 A;  4YBT A;  2LGV A;  2FRQ A;  1CB5 A;  4BS5 A;  3ZPV 1;  4BOU A;  2NAA A;  2XU3 A;  4YYQ A;  5D1M B;  3LVQ E;  2KWO A;  2NQD B;  2NQA A;  2YJ2 A;  2CT2 A;  3Q1D A;  2DX8 A;  4P5O B;  3PDF A;  1WIM A;  1Z2Q A;  2AVW A;  2FE8 A;  1EWO A;  2Y6E A;  5JZE A;  4CA1 A;  2KIZ A;  2VPE A;  2LGG A;  4S3O B;  1YK7 A;  2M3H A;  3M62 A;  1U9Q X;  3PHX A;  1CJL A;  4XR7 A;  2VPG A;  3F75 A;  2DZZ A;  3RNV A;  5DKA A;  5B75 A;  4OEL A;  2FQ9 A;  1NLJ A;  4A49 A;  3OIS A;  4YV8 A;  4YAX A;  5TDW A;  3MTN A;  2MT5 A;  3M99 A;  4P6E A;  3O70 A;  2G43 A;  1YVB A;  1X4J A;  1STF E;  1PAD A;  3BBA A;  2R9N A;  3N9O A;  2LGK A;  2YVR A;  2YQL A;  1EF7 A;  1JM7 B;  4LKA A;  3H8C A;  4I07 A;  2VJE A;  5H1T A;  5EGW A;  4AXM A;  4A4C A;  4YYW A;  3U5N A;  1AIM A;  3EB5 A;  3BOW A;  4YC9 A;  4GNE A;  2JQF R;  3FM8 C;  3N9N A;  2K1J A;  3I2D A;  5SVY A;  2DCB A;  3V43 A;  2JM3 A;  2MUM A;  4L58 A;  1QMY A;  4AP4 A;  3USV A;  4X6H A;  1MEM A;  1MEG A;  2OP3 A;  3O47 A;  3O65 A;  5B8D A;  1V87 A;  3P5V A;  1ME4 A;  4RY2 A;  1Z6U A;  5C11 A;  4CDF B;  2G6Q A;  3I06 A;  3N3G A;  4V3L C;  3H7D A;  1GEC E;  5K16 A;  2Y5B A;  2H0D B;  4H9D A;  2HD5 A;  3V6E A;  2XP0 A;  1PE6 A;  3RVV A;  4Q8H A;  3AI8 A;  1Y08 A;  3JUE A;  5SVI B;  4OGE A;  1CTE A;  2ECW A;  2L0B A;  4IC2 A;  5K3Q A;  1U9V A;  5CVO B;  3C6W A;  3U8E A;  4YVA A;  2YQM A;  2LQ6 A;  4N4F A;  4O64 A;  1F2A A;  4PTB A;  1WFK A;  4YAD A;  4XZX A;  1SNK A;  3OQC A;  3CH3 X;  3KQI A;  2BDZ A;  4FIP A;  3C9E A;  2MD8 C;  3CH2 X;  3SOU A;  1QOL A;  2XB1 A;  2YJC A;  1YT7 A;  3PW3 A;  1HUC B;  1MS6 A;  2MA6 A;  2L43 A;  5G0F A;  1NPZ A;  1DVP A;  4A5U A;  2VP7 A;  3C0R A;  3TRK A;  4MM3 B;  4PP2 E;  2ACT A;  3F5V A;  3HTK C;  1G25 A;  1VJV A;  2CRR A;  2DOS A;  5FEY A;  2FUI A;  2VPD A;  1U5I A;  2WBF X;  1X9Y A;  2K16 A;  4ZDT A;  2R9C A;  2XOC A;  4GB0 A;  1DEU A;  4C9Z A;  1YZB A;  2ATO A;  4YYV A;  4W5C A;  4WZ0 A;  4LK9 A;  3PBH A;  3PNR A;  2VJF A;  3PHW A;  3ZUA A;  3H8B A;  3IMA A;  4IP3 A;  4PI3 A;  3WXE A;  2BTW A;  4GNG A;  4N8W A;  3HCS A;  2CKL B;  1EWL A;  3OF8 A;  1MHW A;  3LVR E;  3CBJ A;  5JG6 A;  3EB6 A;  4BHW A;  2YHN A;  5TDR A;  1BP4 A;  7PCK A;  3MJ5 A;  4D8I A;  3ZVZ B;  2HWK A;  3FEH A;  3ERV A;  3PHU A;  2FUD A;  3C5K A;  1QDQ A;  2E61 A;  2AIM A;  2L7P A;  4I7D A;  2C0Y A;  1GCB A;  3GCB A;  4RNA A;  3RPG B;  2P0R A;  5LKU A;  4ZQL A;  5JH3 A;  4W5B A;  3PRP A;  5EZQ A;  3B21 A;  2FO5 A;  1K2F A;  1AYV A;  1RMD A;  5H1V A;  1PIP A;  2J7Q C;  3K8U A;  1MDW A;  1WEO A;  5TBN A;  1CVZ A;  2E6R A;  5J94 A;  5EF4 A;  5PAD A;  1NB3 A;  1TL9 A;  4YBM A;  4MI7 A;  3I3T A;  3MTV A;  1JOC A;  4UI9 B;  3LDY A;  1E4U A;  1VSN A;  5CVM A;  1T1H A;  2L80 A;  1AU0 A;  1QXP A;  3LRQ A;  3LQH A;  3P5U A;  2AS8 A;  4I04 A;  3PRM A;  3FAO A;  5E6J A;  2P86 A;  2RSD A;  5KH9 A;  1CSB B;  2B1M A;  1WEE A;  2LRI C;  3O0U A;  2FD4 A;  2DC6 A;  3IFU A;  1WEU A;  1X4U A;  2JRJ A;  2P57 A;  4NN2 A;  4G54 A;  4HXD B;  2DCD A;  5TRB A;  2IBI A;  2CIO A;  4GNF A;  4KLB A;  4PAD A;  3KFQ A;  3MOR A;  2YU4 A;  1YAL A;  2VHS A;  2Y1N A;  5LKZ A;  1KFU L;  2MIQ A;  2MNY A;  4WZ3 B;  3ZPV E;  4YAT A;  4ZUX U;  2CB5 A;  2NQI A;  2CON A;  4O62 A;  4YAB A;  5B79 A;  2EA6 A;  2XOY A;  1ME3 A;  3HCU A;  2CSY A;  2F7D A;  2VJE B;  4FJC A;  5FB1 A;  2PUY A;  3LFY A;  3O37 A;  1PPN A;  1SP4 B;  4BPV A;  2LDR A;  2KKX A;  1WEV A;  3S3Q A;  1PVJ A;  1XWH A;  3WXF A;  1ZBD B;  1KFX L;  2P7U A;  2R9F A;  2Z84 A;  3LXS A;  2E02 A;  2KWJ A;  3H6S A;  2E01 A;  1BGO A;  1PPO A;  2AYO A;  3QZV A;  1Z60 A;  3W31 A;  4Q6F A;  4B86 C;  3N4C A;  3PLW A;  3ASL A;  3T9K A;  3NHE A;  3OVZ A;  5J3X A;  1FH0 A;  2ARY A;  4F52 B; 
#chains in the Genus database with same CATH homology
 2I50 A;  2KRE A;  3H89 A;  1U9W A;  1WEP A;  3SOW A;  3KV5 A;  2LN0 A;  4PP1 A;  2EGP A;  4PPE A;  2VFC A;  1O0E A;  2HHN A;  3ZVY A;  3M63 A;  2DC9 A;  1GMY A;  4B55 A;  2FT2 A;  1AEC A;  4BQV A;  4P6G A;  4WZ2 A;  3PUQ A;  5FPW A;  2FRA A;  2H7J A;  4DMY A;  2F42 A;  3O34 A;  2D8S A;  3WXG A;  1IYM A;  6PAD A;  2BAY A;  3LQJ A;  1TLO A;  5KH3 A;  3V6C A;  2ECT A;  2FUU A;  2LV9 A;  1K3B B;  3NG2 A;  4A4B A;  2G7Y A;  2L75 A;  5KH7 A;  2ECJ A;  3KKU A;  4QRX A;  1ITO A;  2LXP C;  2F6N A;  1XKG A;  2ZET C;  5G04 B;  4IC3 A;  2AUX A;  3QT4 A;  4N79 A;  4QRG A;  2E00 A;  2JMJ A;  1WGM A;  4CCG X;  3HCT A;  5FER A;  2DCA A;  4TKP B;  3N9P A;  1PXV A;  2IDA A;  2DC8 A;  2YSJ A;  2XU4 A;  4YBS A;  3SHB A;  2VJF B;  2NQG A;  3K9M A;  3BCN A;  2GFO A;  1F2B A;  3DPL R;  2JMI A;  3KWZ A;  4R8P K;  1WE9 A;  2YJB A;  2JQG R;  3O1G A;  1VD4 A;  2HYE D;  1KHQ A;  4XUI A;  2YRE A;  2KGI A;  1CHC A;  4YYU A;  4GND A;  3DQV R;  5LCW B;  4B7Y C;  5F02 A;  3IV2 A;  1WEW A;  3N9L A;  4X3G A;  3ZYQ A;  3KWB X;  4AYC A;  1AU2 A;  1IWD A;  1LDK C;  5H1U A;  5B77 A;  1KHP A;  3HHI A;  3N3K A;  2FTD A;  5EYA F;  1VYX A;  2AU1 A;  1KXR A;  2OXQ C;  2VFB A;  4WA6 A;  2M6M A;  5A24 A;  3IHP A;  1ZCM A;  4QRV A;  3KV6 A;  1NB5 A;  1EWM A;  2R9O A;  2L5U A;  8PCH A;  2YJ9 A;  2FSA A;  4I7B A;  3D9W A;  4I05 A;  3U5P A;  5H9M A;  3SOX A;  2MD7 B;  2YHO A;  1GLO A;  1BQI A;  2KWN A;  2VHF A;  3O35 A;  2DCC A;  3T7L A;  3MHH A;  5D1L B;  3HWN A;  4LJN A;  3N9M A;  4N4Z A;  3O33 A;  5FB0 A;  3E1Z B;  1TU6 A;  3BWK A;  2PNX A;  4X6I A;  2MA5 A;  2MNZ A;  2K17 A;  2LXH C;  3ZNI A;  1POP A;  1FBV A;  1PPP A;  2DJF B;  3KNV A;  2JMD A;  5DIN A;  2QJ0 A;  2VNF A;  3PUR A;  4I7C A;  2QIZ A;  3P5W A;  1S4V A;  4HWY A;  1HYJ A;  2ECV A;  2FYE A;  3RVW A;  1E2T A;  2O6X A;  1F2C A;  3T6R A;  2RI7 A;  9PAP A;  4QF2 A;  3K24 A;  2LGL A;  2PAD A;  2DJG B;  2B1N A;  4CDD B;  2G6D A;  3FL2 A;  3U5O A;  2KR4 A;  1A6R A;  1PPD A;  1CV8 A;  2BDL A;  3PHD A;  4W4U A;  5CHV A;  1U6G B;  2G45 A;  2QIC A;  3QJ3 A;  1AYU A;  3BC3 A;  3CBK A;  2ECI A;  4K7C A;  3L1Z B;  3KSE A;  3LQI A;  3OF9 A;  3GV4 A;  4AUQ B;  2GHU A;  2K4D A;  2AYN A;  4AVX A;  1LDJ B;  3VK6 A;  2KFT A;  3OVX A;  4A0C D;  3RPG C;  5C13 A;  1JM7 A;  4MZS A;  2KU3 A;  2PRE A;  2M85 A;  4LAD B;  4R7E A;  2E6S A;  2AN6 A;  2KWK A;  3HD3 A;  2KE1 A;  3P5X A;  2M1R A;  4MVT A;  4DMX A;  2PNS A;  4QH6 A;  1YK8 A;  2G8E A;  2HDP A;  5CVN B;  5TAB A;  1M6D A;  2Y1M A;  1Q6K A;  1WEQ A;  2C2V S;  4S3O C;  2XEU A;  2ECN A;  2DC7 A;  3BPF A;  3RTR B;  1WES A;  4BBQ A;  4L7X A;  1BY8 A;  1NL6 A;  1PBH A;  1WIL A;  2H0D A;  5LKX A;  1AYW A;  1U9X A;  1N87 A;  3BPM A;  2HH5 A;  3RVX A;  3QSD A;  1CPJ A;  4MZO A;  1PCI A;  3GL6 A;  2UZG A;  5I3L A;  2VPB A;  3O7A A;  1Y4H A;  1THE A;  4QF3 A;  3TNX A;  1NQC A;  1MM3 A;  2KGG A;  4V3K C;  1F29 A;  2OZ2 A;  3IUT A;  2YT5 A;  3N9Q A;  1ATK A;  4LLB A;  2Y43 A;  4UP0 A;  2IPP B;  3D6S A;  4CDC B;  3ZTG A;  1JQP A;  3L11 A;  4XI1 A;  2DZY A;  4Q8G A;  1CQD A;  2YUC A;  2OUL A;  2YYR A;  4AYC B;  3IEJ A;  4UP5 A;  2YJ8 A;  3S3R A;  4BS6 A;  2YSM A;  4MSX A;  4X6J A;  2G8J A;  5AIU A;  4YYS A;  5B78 A;  2PBH A;  1F62 A;  3B79 A;  3U5M A;  3KX1 A;  3KW9 A;  1BOR A;  3L1X A;  3MHS A;  2EOD A;  1FP0 A;  1DF0 A;  2F1G A;  2HXZ A;  1MIR A;  1AU3 A;  2YUR A;  4BSQ A;  2YW8 A;  2AUZ A;  1CS8 A;  5JA7 A;  1VFY A;  4R2Y A;  1EWP A;  2ECG A;  5AIT A;  2F6J A;  4CDE B;  3HHA A;  4AXL A;  4CZW A;  1HYI A;  2XU5 A;  1MM2 A;  4YYR A;  2CKL A;  5D1K B;  4N3W A;  1X4I A;  5CHT A;  2KYU A;  3DF0 A;  3IOQ A;  2CSZ A;  2E03 A;  2R6N A;  2R9M A;  4OEM A;  5G05 B;  5LKT A;  1ZIV A;  5B76 A;  1AU4 A;  2C2L A;  3O36 A;  1WEN A;  1WEM A;  4QBB A;  1ICF A;  4FO9 A;  4FK5 A;  4YBT A;  2LGV A;  2FRQ A;  1CB5 A;  4BS5 A;  3ZPV 1;  2NAA A;  2XU3 A;  4YYQ A;  5D1M B;  2KWO A;  2NQD B;  2NQA A;  2YJ2 A;  2CT2 A;  2DX8 A;  4P5O B;  3PDF A;  1WIM A;  1Z2Q A;  2AVW A;  1EWO A;  2Y6E A;  4CA1 A;  2KIZ A;  1W5R A;  2VPE A;  2LGG A;  4S3O B;  1YK7 A;  2M3H A;  3M62 A;  1U9Q X;  1CJL A;  4XR7 A;  2VPG A;  3F75 A;  2DZZ A;  5DKA A;  5B75 A;  4OEL A;  2FQ9 A;  1NLJ A;  4A49 A;  3OIS A;  4YV8 A;  4YAX A;  5TDW A;  3MTN A;  2MT5 A;  3M99 A;  1W4T A;  4P6E A;  3O70 A;  2G43 A;  1YVB A;  1X4J A;  1STF E;  1PAD A;  2R9N A;  3N9O A;  2LGK A;  2YQL A;  1EF7 A;  1JM7 B;  4LKA A;  3H8C A;  4I07 A;  2VJE A;  5H1T A;  5EGW A;  4AXM A;  4A4C A;  4BGF A;  4YYW A;  3U5N A;  1AIM A;  3EB5 A;  3BOW A;  4YC9 A;  4GNE A;  2JQF R;  3N9N A;  2K1J A;  3I2D A;  2DCB A;  3V43 A;  2MUM A;  1QMY A;  4L58 A;  4AP4 A;  3USV A;  4X6H A;  1MEM A;  1MEG A;  2OP3 A;  5B8D A;  1V87 A;  3P5V A;  1ME4 A;  4RY2 A;  1Z6U A;  5C11 A;  4CDF B;  2G6Q A;  3I06 A;  3N3G A;  4V3L C;  3H7D A;  1GEC E;  5K16 A;  2Y5B A;  2H0D B;  2HD5 A;  3V6E A;  1PE6 A;  3RVV A;  4Q8H A;  3AI8 A;  1Y08 A;  1CTE A;  2ECW A;  2L0B A;  4IC2 A;  1U9V A;  3U8E A;  5CVO B;  3C6W A;  4YVA A;  2YQM A;  2LQ6 A;  4N4F A;  4O64 A;  1F2A A;  4PTB A;  1WFK A;  4YAD A;  1SNK A;  3CH3 X;  3KQI A;  2BDZ A;  4FIP A;  3C9E A;  2MD8 C;  3CH2 X;  3SOU A;  1QOL A;  2XB1 A;  2YJC A;  1YT7 A;  3PW3 A;  1HUC B;  1MS6 A;  2MA6 A;  2L43 A;  5G0F A;  1NPZ A;  1DVP A;  2VP7 A;  4NV8 A;  4NV7 A;  4PP2 E;  2ACT A;  3F5V A;  3HTK C;  1G25 A;  1VJV A;  5FEY A;  2FUI A;  2VPD A;  1U5I A;  2BSZ A;  1X9Y A;  2WBF X;  2K16 A;  4ZDT A;  2R9C A;  4GB0 A;  1DEU A;  4C9Z A;  2ATO A;  4YYV A;  4W5C A;  4WZ0 A;  4LK9 A;  3PBH A;  3PNR A;  2VJF A;  3ZUA A;  3H8B A;  3IMA A;  4PI3 A;  3WXE A;  4GNG A;  4N8W A;  3HCS A;  2CKL B;  1EWL A;  3OF8 A;  1MHW A;  3CBJ A;  5JG6 A;  3EB6 A;  4BHW A;  2YHN A;  5TDR A;  1BP4 A;  7PCK A;  3ZVZ B;  1GX3 A;  3ERV A;  2FUD A;  3C5K A;  1QDQ A;  2AIM A;  4I7D A;  2C0Y A;  1GCB A;  3GCB A;  3RPG B;  2P0R A;  5LKU A;  4ZQL A;  5JH3 A;  4W5B A;  2FO5 A;  1K2F A;  1AYV A;  1RMD A;  5H1V A;  1PIP A;  3K8U A;  1MDW A;  1WEO A;  5TBN A;  1CVZ A;  2E6R A;  5J94 A;  5EF4 A;  5PAD A;  1NB3 A;  1TL9 A;  4YBM A;  3I3T A;  1JOC A;  4UI9 B;  1E4U A;  1VSN A;  5CVM A;  1T1H A;  2L80 A;  1AU0 A;  1QXP A;  3LRQ A;  3LQH A;  3P5U A;  2AS8 A;  4I04 A;  2P86 A;  2RSD A;  5KH9 A;  1CSB B;  2B1M A;  1WEE A;  2LRI C;  3O0U A;  2DC6 A;  1WEU A;  1X4U A;  2JRJ A;  4NN2 A;  4G54 A;  2DCD A;  5TRB A;  2IBI A;  2CIO A;  4GNF A;  4KLB A;  4PAD A;  3KFQ A;  3MOR A;  3LTW A;  2YU4 A;  1YAL A;  1W6F A;  2Y1N A;  5LKZ A;  1KFU L;  2VHS A;  2MIQ A;  2MNY A;  4WZ3 B;  3ZPV E;  4YAT A;  4ZUX U;  2CB5 A;  2NQI A;  4YAB A;  5B79 A;  2XU1 A;  4GUZ A;  2EA6 A;  1ME3 A;  3HCU A;  2CSY A;  2F7D A;  2VJE B;  4FJC A;  5FB1 A;  2PUY A;  3LFY A;  3O37 A;  1PPN A;  1SP4 B;  4BPV A;  2LDR A;  1WEV A;  3S3Q A;  1XWH A;  3WXF A;  1ZBD B;  1KFX L;  2P7U A;  4C5P A;  2R9F A;  3LXS A;  2E02 A;  2KWJ A;  3H6S A;  2E01 A;  1BGO A;  1PPO A;  2AYO A;  3QZV A;  1Z60 A;  4Q6F A;  4B86 C;  3N4C A;  3NHE A;  3ASL A;  3OVZ A;  5J3X A;  1FH0 A;  2ARY A;  4F52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...