3M99A

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
470
structure length
422
Chain Sequence
SICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQDAHEFWQFIINQIHQSYVLDLPNAKNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 111
structure length 422
sequence length 470
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3m99A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3m99A02
4AUQB 2MIQA 4CDFB 1ME4A 2DZZA 3PDFA 2LGVA 4ZQLA 1BQIA 4YV8A 1CJLA 4F52B 5JH3A 2MA5A 2BDLA 1PBHA 3GCBA 4YYQA 4N3WA 5CVMA 2LGGA 1DEUA 4HWYA 4YVAA 4AYCB 3ZPV1 2HD5A 2F7DA 4CDCB 5DINA 3L1ZB 4PI3A 3C5KA 3KV6A 5CHTA 4PTBA 2F6JA 4QRGA 1FBVA 2LGLA 3FL2A 4R8PK 2Y1MA 2K4DA 2M1RA 3KSEA 1ATKA 2YSMA 2R6NA 2OZ2A 3RVWA 1AYUA 3DF0A 3QZVA 5LKUA 4RY2A 1Z6UA 4PP2E 3MORA 2DCDA 2YJBA 1WEEA 1CPJA 4YADA 2ECNA 4CDEB 2NQIA 2QJ0A 3SOUA 5G0FA 1AYVA 2HXZA 2M3HA 5A24A 3IOQA 2DJGB 4PADA 1K3BB 5JA7A 5D1MB 1RMDA 3N9MA 4OELA 5CVNB 1N87A 3RVVA 3IMAA 2H7JA 1AYWA 2PNSA 1AU0A 2LDRA 5JG6A 1BGOA 1VFYA 1QOLA 2HDPA 4YAXA 1ZCMA 5FB0A 1U9WA 1NB3A 1WILA 1CTEA 2VPGA 1MS6A 4V3LC 4WZ3B 3V43A 4LLBA 3U5PA 2JMIA 6PADA 1WGMA 1JM7B 2QIZA 3OVZA 3O36A 2YHNA 1THEA 3N3GA 4OEMA 1POPA 3N9OA 2LXHC 5C11A 2L43A 5FPWA 1WEOA 4GNDA 1YVBA 5B77A 2LQ6A 5D1KB 3LQIA 2UZGA 2VHSA 3SOXA 2AYOA 2RI7A 4GNGA 2JQFR 1U9VA 3IV2A 5B76A 5C13A 2EGPA 3KWZA 1U5IA 1MIRA 2VHFA 2R9MA 3WXFA 3U8EA 1GCBA 5AIUA 1CS8A 1WENA 3KWBX 2YSJA 1QMYA 1X4IA 3AI8A 4AXMA 3N9LA 3HD3A 1MDWA 5TDWA 1S4VA 2IBIA 3O70A 3SOWA 2OULA 1EWLA 1WEVA 2YJCA 2FRQA 1F2CA 2B1MA 4I04A 2ECJA 4GNEA 2AU1A 2DC9A 2YQMA 2G45A 1CVZA 1FP0A 2C2VS 4N8WA 2IDAA 5KH7A 2M6MA 3WXEA 4W5CA 2FUIA 1JM7A 5LKZA 2C0YA 4X6HA 3L11A 1K2FA 3K8UA 2YUCA 2GHUA 1G25A 2MNYA 4N4FA 1AU3A 3VK6A 1KXRA 2XU1A 3LFYA 4YYRA 4WZ0A 2G8JA 3L1XA 2VJFA 2KWKA 4LJNA 4CCGX 2FUUA 3PUQA 4NN2A 4V3KC 1Q6KA 1XKGA 1NL6A 2OXQC 3RPGC 2I50A 3QT4A 2KWNA 4G54A 5CHVA 2AUZA 2MD7B 4P6GA 1X4UA 4YYSA 1HUCB 1ZIVA 4I07A 3V6CA 5J3XA 2G8EA 4PPEA 1EF7A 4CA1A 2XU4A 3H8BA 3MTNA 3V6EA 2F1GA 4XR7A 3KQIA 3N9NA 1ITOA 1PPOA 3CH2X 4Q8HA 4IC2A 1FH0A 4FO9A 3EB5A 4N4ZA 3RVXA 4YBMA 1QDQA 2NQAA 2KREA 1TU6A 3O0UA 2ACTA 4Q6FA 3E1ZB 4YYUA 1Y08A 1DVPA 1A6RA 2NQGA 3ZVYA 4A49A 1E4UA 1PXVA 5LCWB 1BY8A 1TLOA 1CHCA 5I3LA 4LADB 2YJ8A 4I05A 1MM2A 3U5OA 2E6RA 1AIMA 4WZ2A 2E03A 2DX8A 2R9FA 2E6SA 2ECTA 2ARYA 4AP4A 2VJFB 4YYWA 2YJ9A 3O34A 3HCUA 1IYMA 1YALA 3GV4A 2HHNA 1PPNA 2FRAA 3DPLR 2ECIA 1V87A 3H7DA 2YJ2A 1SP4B 5KH3A 3P5WA 4Q8GA 1NB5A 2OP3A 2ZETC 2KFTA 3O33A 4YATA 3B79A 2JMJA 3BOWA 2DC7A 4PP1A 4BPVA 4N79A 1X9YA 3KKUA 2MD8C 3NHEA 2LV9A 4GNFA 2FSAA 2P86A 2NAAA 5B8DA 2DCCA 2CSZA 3KV5A 1AU4A 2D8SA 1AECA 1PE6A 3O37A 3KFQA 3KNVA 1CB5A 1X4JA 4X6IA 2MNZA 3USVA 2Y1NA 5G04B 2DC6A 1T1HA 1KFUL 1U9QX 2LXPC 2ATOA 2DC8A 3OF8A 3QSDA 4QBBA 4K7CA 3BC3A 2ECVA 5H9MA 3I2DA 2AVWA 2KE1A 2LN0A 2VPEA 2XB1A 1AU2A 1U9XA 1JOCA 1F2BA 3CBJA 5EGWA 2VNFA 1WEMA 2CSYA 2MA6A 5H1TA 2BDZA 3OF9A 2VPBA 4UP0A 4S3OB 4DMXA 3OVXA 3EB6A 2XU3A 4R7EA 2PUYA 3IHPA 2G43A 2YHOA 2YW8A 4FIPA 2GFOA 3ZUAA 2HH5A 2JMDA 1YK7A 1VJVA 3PW3A 4MZSA 3LQHA 1WEPA 5J94A 2G6QA 4A4BA 4I7DA 1IWDA 4YBSA 3HCSA 2KYUA 3LRQA 2R9CA 3U5NA 2Y5BA 4BQVA 5DKAA 2DZYA 4B7YC 2E01A 2IPPB 2PNXA 1BORA 3MHSA 1YT7A 3ZNIA 1MEGA 3P5VA 2AYNA 5H1UA 5TDRA 2PBHA 3F5VA 3K24A 2Y6EA 4W5BA 1U6GB 4AVXA 1EWPA 2L80A 1GMYA 2H0DA 1F62A 2K17A 3O1GA 5EYAF 2G7YA 3LXSA 3TNXA 5B78A 1VD4A 3QJ3A 1O0EA 5FERA 2VJEA 4KLBA 4P6EA 7PCKA 4BBQA 9PAPA 2EA6A 4W4UA 2NQDB 8PCHA 3OISA 3HHIA 5PADA 2XEUA 2YYRA 1WESA 4AXLA 3P5XA 2YURA 2JQGR 3CH3X 4UI9B 3GL6A 3BWKA 2PADA 3I06A 4XUIA 3ERVA 5KH9A 4A4CA 1ME3A 1QXPA 1Z2QA 3M99A 2KGIA 5TABA 1WE9A 1SNKA 3F75A 2YREA 3DQVR 4MSXA 1DF0A 2CT2A 1CSBB 4ZDTA 2FO5A 2G6DA 3IEJA 1MM3A 4GB0A 4ZUXU 2F6NA 1NLJA 3KX1A 5K16A 4BSQA 4X6JA 4MZOA 1ZBDB 4QF2A 3PNRA 5TBNA 2E02A 3P5UA 2KU3A 1GECE 2F42A 1Z60A 5FEYA 2CKLA 4L58A 4WA6A 3S3QA 2L5UA 3SHBA 2O6XA 5AITA 1F2AA 2C2LA 1KHPA 1WEQA 3LQJA 4A0CD 1LDKC 1NPZA 1VYXA 3HCTA 5FB1A 1Y4HA 2AIMA 1LDJB 4FK5A 3O7AA 4YABA 2AUXA 2E00A 2WBFX 2KWJA 2FYEA 4DMYA 3HHAA 3RPGB 3H6SA 2JRJA 2LRIC 4IC3A 2KR4A 2KIZA 1GLOA 1PIPA 4P5OB 4CZWA 3WXGA 3ASLA 4LKAA 2VPDA 4QRXA 2L0BA 4I7CA 4S3OC 3ZYQA 2PREA 4QH6A 1EWOA 3CBKA 1ICFA 1KFXL 1WEWA 3NG2A 3ZPVE 1NQCA 2FUDA 1WFKA 2YT5A 2L75A 4QF3A 1WIMA 2DCAA 1PADA 5F02A 3T6RA 2VP7A 4CDDB 1CV8A 3M63A 1XWHA 3C9EA 3BPMA 2Y43A 4LK9A 2QICA 3ZVZB 2R9NA 1MHWA 2AN6A 1M6DA 3M62A 1VSNA 4AYCA 2P7UA 3HTKC 4C9ZA 4YC9A 1PPPA 5CVOB 5TRBA 2LGKA 3K9MA 2XU5A 5LKTA 3N4CA 2CKLB 3S3RA 2YU4A 3O35A 4L7XA 3D6SA 3IUTA 2MUMA 1TL9A 3BPFA 1F29A 1WEUA 4FJCA 1HYIA 4MVTA 3T7LA 1PPDA 2FTDA 3PHDA 2DJFB 2VJEB 2ECWA 1MEMA 3PURA 2AS8A 1JQPA 2HYED 2FQ9A 4BHWA 5B79A 2M85A 3HWNA 1CQDA 4TKPB 2H0DB 5H1VA 3BCNA 2EODA 5EF4A 1YK8A 3N3KA 4YBTA 2FT2A 4QRVA 1EWMA 2CB5A 2DCBA 2YQLA 4X3GA 1STFE 2R9OA 4BS6A 4YYVA 1HYJA 4UP5A 2K1JA 5G05B 3ZTGA 4B86C 2KWOA 5D1LB 1BP4A 4R2YA 3N9PA 2MT5A 3C6WA 5LKXA 4BS5A 3H89A 3MHHA 3RTRB 1KHQA 2KGGA 3U5MA 2ECGA 5B75A 2RSDA 3PBHA 4O64A 4I7BA 2B1NA 3N9QA 2CIOA 4XI1A 3H8CA 3I3TA 3KW9A 1PCIA 2BAYA 2P0RA 2K16A
chains in the Genus database with same CATH superfamily
4AUQB 2MIQA 4CDFB 5SVIA 1ME4A 2DZZA 3PDFA 2LGVA 4ZQLA 1BQIA 2BU3A 2M13A 4YV8A 1CJLA 4GUAA 4F52B 5JH3A 2MA5A 4M0WA 2BDLA 1PBHA 3GCBA 4YYQA 4N3WA 5CVMA 2LGGA 2IQJA 1DEUA 4HWYA 4YVAA 4AYCB 4P16A 3ZPV1 2HD5A 2F7DA 4CDCB 5DINA 1YZBA 3L1ZB 2Z84A 4PI3A 3C5KA 3KV6A 5CHTA 4PTBA 2F6JA 4QRGA 1FBVA 2LGLA 5EZSA 2KKYA 3FL2A 3MP2A 4R8PK 2Y1MA 2JRIA 2K4DA 2M1RA 3KSEA 1ATKA 2YSMA 2R6NA 2OZ2A 2BTWA 3RVWA 1AYUA 3DF0A 3QZVA 3PHWA 5LKUA 4RY2A 1Z6UA 3TMPA 4PP2E 3MORA 3PHUA 5K3QA 2DCDA 2YJBA 1WEEA 1CPJA 4YADA 2JTCA 2ECNA 5SVYA 4CDEB 4D8IA 2NQIA 2QJ0A 3SOUA 5G0FA 1AYVA 2HXZA 2M3HA 3DDTA 5A24A 2FD4A 3IOQA 4BOSA 2DJGB 4PADA 1K3BB 5JA7A 5D1MB 1RMDA 2P57A 3N9MA 4OELA 5CVNB 1N87A 3M7KA 3RVVA 3IMAA 2H7JA 1AYWA 2PNSA 1AU0A 2LDRA 5JG6A 2KKXA 1BGOA 1VFYA 3W30A 1QOLA 3FJUB 2HDPA 4YAXA 1ZCMA 2HWKA 5FB0A 1U9WA 1NB3A 1WILA 1CTEA 2VPGA 1MS6A 3BBAA 4V3LC 4WZ3B 3V43A 4LLBA 3U5PA 2JMIA 6PADA 1WGMA 2OWAA 2QIZA 1JM7B 3OVZA 2CRRA 3LDYA 3O36A 2YHNA 1THEA 3N3GA 4OEMA 1POPA 3N9OA 2LXHC 5C11A 2L43A 5FPWA 4BOQA 1WEOA 4GNDA 1YVBA 4HXDB 4IP3A 5B77A 4OGCA 2LQ6A 5D1KB 3LQIA 2UZGA 2VHSA 3SOXA 2AYOA 4D8BA 3LVRE 2RI7A 4GNGA 2DSMA 2JQFR 1U9VA 3IV2A 3E2DA 2AGAA 5B76A 5C13A 3FM8C 2EGPA 3KWZA 1U5IA 1MIRA 2VHFA 2R9MA 3WXFA 3U8EA 1GCBA 5AIUA 1CS8A 1WENA 3KWBX 2XP0A 2YSJA 1QMYA 1X4IA 3AI8A 4AXMA 3N9LA 3HD3A 1MDWA 5TDWA 1S4VA 2IBIA 2D8UA 3O70A 3SOWA 1EWLA 2OULA 1WEVA 2YJCA 2L7PA 3JUEA 2FRQA 2J7QA 4WURA 1F2CA 2B1MA 4I04A 2ECJA 3DWDA 4GNEA 2AU1A 3O65A 2DC9A 2RR4A 2YQMA 2G45A 1CVZA 1FP0A 2C2VS 4N8WA 2IDAA 5KH7A 2M6MA 3WXEA 4W5CA 2FUIA 1JM7A 5LKZA 2JM3A 2C0YA 3RNVA 4X6HA 3L11A 1K2FA 3K8UA 2YUCA 2GHUA 1G25A 2MNYA 4N4FA 1AU3A 3VK6A 1KXRA 2XU1A 3LFYA 4YYRA 4WZ0A 2FFWA 2G8JA 3E9SA 4H9DA 3L1XA 2VJFA 2KWKA 4LJNA 4CCGX 2FUUA 3PUQA 4NN2A 4V3KC 3LVQE 1Q6KA 1NL6A 2OXQC 1XKGA 3RPGC 2I50A 3QT4A 2KWNA 4G54A 5CHVA 2AUZA 2MD7B 4P6GA 1X4UA 2DOSA 4Z0RA 4MM3B 4YYSA 1HUCB 4RF0A 1ZIVA 4I07A 3V6CA 5J3XA 2G8EA 4PPEA 2CONA 4CA1A 1EF7A 3OQCA 2XU4A 3H8BA 3MTNA 3MDBC 3V6EA 4BOZA 2F1GA 4XR7A 3KQIA 3N9NA 1ITOA 1PPOA 3BB7A 3CH2X 4Q8HA 4IC2A 1FH0A 4FO9A 3EB5A 4N4ZA 3RVXA 4YBMA 1QDQA 4XZXA 4BOUA 2NQAA 2KREA 1TU6A 3O0UA 4D8EA 4QQ4A 2ACTA 4Q6FA 3E1ZB 3O47A 5EZQA 4YYUA 1Y08A 4A5UA 1DVPA 1A6RA 2YVRA 2NQGA 3ZVYA 4A49A 1E4UA 1PXVA 5LCWB 1BY8A 1TLOA 1CHCA 4RNAA 5I3LA 4LADB 2YJ8A 4I05A 1MM2A 3U5OA 2E6RA 1AIMA 1DCQA 4WZ2A 2E03A 2DX8A 2R9FA 2E6SA 2ECTA 2ARYA 3PRPA 2CRWA 4AP4A 2VJFB 4YYWA 2YJ9A 3O34A 3HCUA 4OW0A 1IYMA 1YALA 3SUBA 3GV4A 2HHNA 2UZJA 2MKEA 1PPNA 2FRAA 3DPLR 2ECIA 2CSVA 1V87A 3H7DA 2YJ2A 1SP4B 5KH3A 5JZEA 3P5WA 4Q8GA 4BOPA 1NB5A 2OP3A 2ZETC 2KFTA 3O33A 4YATA 3B79A 2JMJA 3BOWA 2DC7A 4PP1A 4BPVA 4N79A 1X9YA 3KKUA 2MD8C 3NHEA 2LV9A 4GNFA 2FSAA 2P86A 2NAAA 5B8DA 2DCCA 2CSZA 3KV5A 1AU4A 2D8SA 1AECA 1PE6A 3O37A 3PHXA 3KFQA 3KNVA 1CB5A 1X4JA 4X6IA 2MNZA 3USVA 2Y1NA 5G04B 2DC6A 1T1HA 1KFUL 1U9QX 2LXPC 2ATOA 2DC8A 3OF8A 3QSDA 4QBBA 4REZA 4K7CA 3BC3A 2ECVA 2LAUA 5H9MA 3I2DA 2AVWA 2KE1A 2LN0A 2VPEA 2XB1A 1AU2A 1U9XA 2JUNA 1JOCA 1F2BA 3CBJA 5EGWA 2VNFA 1WEMA 2CSYA 2MA6A 2XOZA 5H1TA 2BDZA 3OF9A 2VPBA 4UP0A 4S3OB 4DMXA 3OVXA 3EB6A 2XU3A 4R7EA 2PUYA 3IHPA 2G43A 1DKIA 2FE8A 2YHOA 2YW8A 4FIPA 2GFOA 3ZUAA 2HH5A 2JMDA 1YK7A 1VJVA 3PW3A 4MZSA 3LQHA 1WEPA 3LJUX 5J94A 2G6QA 4A4BA 4I7DA 1IWDA 3Q1DA 4YBSA 3HCSA 2KYUA 3LRQA 2R9CA 3U5NA 4PT5A 2Y5BA 4BQVA 5DKAA 2DZYA 4B7YC 2E01A 2IPPB 2PNXA 1BORA 3MHSA 1YT7A 3ZNIA 1MEGA 3P5VA 2AYNA 5H1UA 5TDRA 2PBHA 3B21A 3F5VA 3K24A 3MTVA 2Y6EA 4W5BA 1U6GB 4AVXA 1EWPA 2L80A 1GMYA 2H0DA 1F62A 2K17A 3O1GA 5EYAF 2G7YA 3LXSA 4RF1A 3TNXA 5B78A 1VD4A 3QJ3A 1O0EA 2E61A 5FERA 2VJEA 4KLBA 4P6EA 7PCKA 4BBQA 9PAPA 2EA6A 4W4UA 2NQDB 8PCHA 3OISA 3HHIA 2XOCA 5PADA 2XEUA 2YYRA 1WESA 4AXLA 3P5XA 2YURA 2XOYA 5E6JA 2JQGR 3CH3X 4ZTBA 4UI9B 3GL6A 3BWKA 2PADA 3I06A 2EGMA 3ERVA 4XUIA 5KH9A 3PLWA 4A4CA 1ME3A 1QXPA 1Z2QA 3M99A 2KGIA 5TABA 1WE9A 1SNKA 3F75A 2YREA 3DQVR 5SVIB 4MSXA 4OVZA 1DF0A 2CT2A 1CSBB 1UKFA 4O62A 2EXUA 4ZDTA 2FO5A 2G6DA 3IEJA 1MM3A 4GB0A 4ZUXU 2F6NA 1NLJA 3KX1A 5K16A 1PVJA 4BSQA 4X6JA 4MZOA 1ZBDB 4QF2A 3PNRA 5TBNA 3PRMA 2E02A 3P5UA 2KU3A 1GECE 4IUMA 2F42A 1Z60A 5FEYA 2CKLA 4L58A 4WA6A 3S3QA 2L5UA 3SHBA 2O6XA 5AITA 1F2AA 2C2LA 1KHPA 1WEQA 3LQJA 4A0CD 1LDKC 1NPZA 1VYXA 3HCTA 5FB1A 3C0RA 1Y4HA 2AIMA 1LDJB 4FK5A 3W31A 5SVXA 3O7AA 4Z0OA 4YABA 2AUXA 2E00A 2WBFX 2KWJA 2FYEA 4DMYA 3HHAA 3H7HA 3RPGB 2JRJA 2LRIC 3H6SA 4IC3A 2KR4A 2KIZA 1GLOA 1PIPA 4P5OB 4CZWA 3WXGA 3ASLA 4LKAA 4RKXA 2VPDA 4QRXA 2L0BA 4I7CA 4S3OC 1MBMA 3ZYQA 2PREA 4QH6A 1EWOA 3CBKA 1ICFA 1KFXL 1WEWA 3NG2A 3ZPVE 1NQCA 2FUDA 1WFKA 2YT5A 2L75A 3PSEA 4QF3A 1WIMA 2DCAA 2BTWB 3ZNHA 1PADA 5F02A 3T6RA 3KDEC 2VP7A 4CDDB 1CV8A 3FANA 3M63A 1XWHA 3C9EA 3TRKA 3BPMA 2Y43A 4LK9A 4OVZB 2QICA 3ZVZB 2J7QC 2R9NA 1MHWA 3T9KA 2AN6A 2B0OE 1M6DA 3M62A 1VSNA 4AYCA 2P7UA 3HTKC 4C9ZA 4YC9A 1PPPA 5CVOB 5TRBA 2LGKA 3FAOA 3BY4A 2XU5A 3K9MA 5LKTA 3N4CA 2CKLB 3S3RA 2YU4A 3O35A 4L7XA 3D6SA 3IUTA 2MUMA 1TL9A 3BPFA 1F29A 1WEUA 4FJCA 1HYIA 4MVTA 3T7LA 1PPDA 2FTDA 3PHDA 2DJFB 2VJEB 4R3DA 2ECWA 1MEMA 3PURA 2AS8A 1JQPA 2HYED 5KO3A 2FQ9A 4BHWA 4OGEA 5B79A 2M85A 3PT2A 3HWNA 1CQDA 4TKPB 2H0DB 5H1VA 3BCNA 2EODA 5EF4A 1YK8A 3N3KA 4YBTA 2FT2A 4QRVA 1EWMA 2CB5A 2DCBA 2YQLA 4X3GA 4F1PA 1STFE 2R9OA 3MJ5A 4BS6A 4YYVA 1HYJA 4UP5A 3FEHA 3IFUA 2K1JA 5G05B 3ZTGA 4B86C 2KWOA 5D1LB 1BP4A 4R2YA 3N9PA 2DJAA 2MT5A 3C6WA 5LKXA 4BS5A 3H89A 3MHHA 3RTRB 1KHQA 2KGGA 3U5MA 2ECGA 5B75A 2RSDA 3PBHA 4O64A 4I7BA 2B1NA 3N9QA 2CIOA 4XI1A 3H8CA 3I3TA 3KW9A 4MI7A 1PCIA 2BAYA 2P0RA 2K16A
chains in the Genus database with same CATH topology
4AUQB 2MIQA 4CDFB 1ME4A 2DZZA 3PDFA 2LGVA 4ZQLA 1BQIA 4YV8A 1CJLA 4F52B 5JH3A 2MA5A 2BDLA 4B55A 1PBHA 3GCBA 4YYQA 4N3WA 5CVMA 2LGGA 1DEUA 4HWYA 4YVAA 4AYCB 3ZPV1 2HD5A 2F7DA 4CDCB 5DINA 3L1ZB 4PI3A 3C5KA 3KV6A 5CHTA 4PTBA 2F6JA 4QRGA 1FBVA 2LGLA 3FL2A 4R8PK 2Y1MA 2K4DA 2M1RA 3KSEA 1ATKA 2YSMA 2R6NA 2OZ2A 3RVWA 1AYUA 3DF0A 3QZVA 5LKUA 4RY2A 1Z6UA 4PP2E 3MORA 2DCDA 2YJBA 1WEEA 1CPJA 4YADA 2ECNA 4CDEB 2NQIA 2QJ0A 3SOUA 5G0FA 1AYVA 2HXZA 2M3HA 5A24A 3IOQA 4C5PA 2DJGB 4PADA 1K3BB 5JA7A 5D1MB 1RMDA 3N9MA 4OELA 5CVNB 1N87A 3RVVA 3IMAA 2H7JA 1AYWA 2PNSA 1AU0A 2LDRA 5JG6A 1BGOA 1VFYA 1QOLA 2HDPA 4YAXA 1ZCMA 5FB0A 1U9WA 1NB3A 1WILA 1CTEA 2VPGA 1MS6A 4V3LC 4WZ3B 3V43A 4LLBA 3U5PA 2JMIA 6PADA 1WGMA 1JM7B 2QIZA 3OVZA 3O36A 2YHNA 1THEA 3N3GA 4OEMA 1POPA 3N9OA 2LXHC 5C11A 2L43A 4NV7A 5FPWA 1WEOA 4GNDA 1YVBA 5B77A 2LQ6A 5D1KB 3LQIA 2UZGA 2VHSA 3SOXA 2AYOA 2RI7A 4GNGA 2JQFR 1U9VA 3IV2A 5B76A 5C13A 2EGPA 3KWZA 1U5IA 1MIRA 2VHFA 2R9MA 3WXFA 3U8EA 1GCBA 5AIUA 1CS8A 1WENA 3KWBX 2YSJA 1QMYA 1X4IA 3AI8A 4AXMA 3N9LA 3HD3A 1MDWA 5TDWA 1S4VA 2IBIA 3O70A 3SOWA 2OULA 1EWLA 1WEVA 2YJCA 1E2TA 2FRQA 1F2CA 2B1MA 4I04A 2ECJA 4GNEA 2AU1A 2DC9A 2YQMA 2G45A 1CVZA 1FP0A 2C2VS 4N8WA 2IDAA 5KH7A 2M6MA 3WXEA 4W5CA 2FUIA 1JM7A 5LKZA 2C0YA 4X6HA 3L11A 1K2FA 3K8UA 2YUCA 2GHUA 1G25A 2MNYA 4N4FA 1AU3A 3VK6A 1KXRA 2XU1A 3LFYA 4YYRA 4WZ0A 2G8JA 3L1XA 2VJFA 2KWKA 4LJNA 4CCGX 2FUUA 3PUQA 4NN2A 4V3KC 1Q6KA 1XKGA 1NL6A 2OXQC 3RPGC 2I50A 3QT4A 2KWNA 4G54A 5CHVA 2AUZA 2MD7B 4P6GA 1X4UA 4YYSA 1HUCB 1ZIVA 4I07A 3V6CA 5J3XA 2G8EA 4PPEA 1EF7A 4CA1A 2XU4A 3H8BA 3MTNA 1GX3A 4GUZA 3V6EA 2F1GA 4XR7A 3KQIA 3N9NA 1ITOA 1PPOA 3CH2X 4Q8HA 4IC2A 1FH0A 4FO9A 3EB5A 4N4ZA 3RVXA 4YBMA 1QDQA 2NQAA 2KREA 1TU6A 3O0UA 2ACTA 4Q6FA 3E1ZB 4YYUA 1Y08A 1DVPA 1A6RA 2NQGA 3ZVYA 4A49A 1E4UA 1PXVA 5LCWB 1BY8A 1TLOA 1CHCA 1W6FA 5I3LA 4LADB 2YJ8A 4I05A 1MM2A 3U5OA 2E6RA 1AIMA 4WZ2A 2E03A 2DX8A 2R9FA 2E6SA 2ECTA 2ARYA 4AP4A 2VJFB 4YYWA 2YJ9A 3O34A 3HCUA 1IYMA 1YALA 3GV4A 2HHNA 1PPNA 2FRAA 3DPLR 2ECIA 1V87A 3H7DA 2YJ2A 1SP4B 5KH3A 3P5WA 4Q8GA 1NB5A 2OP3A 2ZETC 2KFTA 3O33A 4BGFA 4YATA 3B79A 2JMJA 3BOWA 2DC7A 4PP1A 4BPVA 4N79A 1X9YA 3KKUA 2MD8C 3NHEA 2LV9A 4GNFA 2FSAA 2P86A 2NAAA 5B8DA 2DCCA 2CSZA 3KV5A 1AU4A 2D8SA 1AECA 1PE6A 3O37A 3KFQA 3KNVA 1CB5A 1X4JA 4X6IA 2MNZA 3USVA 2Y1NA 5G04B 2DC6A 1T1HA 1KFUL 1U9QX 2LXPC 2ATOA 2DC8A 3OF8A 3QSDA 4QBBA 4K7CA 3BC3A 2ECVA 5H9MA 3I2DA 2AVWA 2KE1A 2LN0A 2VPEA 2XB1A 1AU2A 1U9XA 1JOCA 1F2BA 3CBJA 5EGWA 2VNFA 1WEMA 2CSYA 2MA6A 5H1TA 2BDZA 3OF9A 2VPBA 4UP0A 4S3OB 4DMXA 3OVXA 3EB6A 2XU3A 4R7EA 2PUYA 3IHPA 2VFCA 2G43A 2YHOA 2YW8A 4FIPA 2GFOA 3ZUAA 2BSZA 2HH5A 2JMDA 1YK7A 1VJVA 3PW3A 4MZSA 3LQHA 1WEPA 5J94A 2G6QA 4A4BA 1W5RA 4I7DA 1IWDA 4YBSA 3HCSA 2KYUA 3LRQA 2R9CA 3U5NA 2Y5BA 4BQVA 5DKAA 2DZYA 4B7YC 2E01A 2IPPB 2PNXA 1BORA 3MHSA 1YT7A 3ZNIA 1MEGA 3P5VA 2AYNA 5H1UA 5TDRA 2PBHA 3F5VA 3K24A 2Y6EA 4W5BA 1U6GB 4AVXA 1EWPA 2L80A 1GMYA 2H0DA 1F62A 2K17A 3O1GA 5EYAF 2G7YA 3LXSA 3TNXA 5B78A 1VD4A 3QJ3A 1O0EA 5FERA 2VJEA 4KLBA 4P6EA 7PCKA 4BBQA 9PAPA 2EA6A 4W4UA 2NQDB 8PCHA 3OISA 3HHIA 5PADA 2XEUA 2YYRA 1WESA 4AXLA 3P5XA 2YURA 2JQGR 3CH3X 4UI9B 3GL6A 3BWKA 2PADA 3I06A 4XUIA 3ERVA 5KH9A 4A4CA 1ME3A 1QXPA 1Z2QA 3M99A 2KGIA 5TABA 1WE9A 1SNKA 3F75A 2YREA 3DQVR 4MSXA 1DF0A 2CT2A 1CSBB 4ZDTA 2FO5A 2G6DA 3IEJA 1MM3A 4GB0A 4ZUXU 2F6NA 1NLJA 3KX1A 5K16A 4BSQA 4X6JA 4MZOA 1ZBDB 4QF2A 1W4TA 3PNRA 5TBNA 2E02A 3P5UA 2KU3A 1GECE 2F42A 1Z60A 5FEYA 2CKLA 4L58A 4WA6A 3S3QA 2L5UA 3SHBA 2O6XA 5AITA 1F2AA 2C2LA 1KHPA 1WEQA 3LQJA 4A0CD 1LDKC 1NPZA 1VYXA 3HCTA 5FB1A 1Y4HA 2AIMA 1LDJB 4FK5A 3O7AA 4YABA 2AUXA 2E00A 2WBFX 4NV8A 2KWJA 2FYEA 4DMYA 3HHAA 3RPGB 3H6SA 2JRJA 2LRIC 4IC3A 2KR4A 2KIZA 1GLOA 1PIPA 4P5OB 4CZWA 3WXGA 3ASLA 4LKAA 2VPDA 4QRXA 2L0BA 4I7CA 4S3OC 3ZYQA 2PREA 4QH6A 1EWOA 3CBKA 1ICFA 1KFXL 1WEWA 3NG2A 3ZPVE 1NQCA 2FUDA 1WFKA 2YT5A 2L75A 4QF3A 1WIMA 2DCAA 1PADA 5F02A 3T6RA 2VP7A 4CDDB 1CV8A 3M63A 1XWHA 3C9EA 3BPMA 2Y43A 4LK9A 2VFBA 2QICA 3ZVZB 2R9NA 1MHWA 2AN6A 3LTWA 1M6DA 3M62A 1VSNA 4AYCA 2P7UA 3HTKC 4C9ZA 4YC9A 1PPPA 5CVOB 5TRBA 2LGKA 3K9MA 2XU5A 5LKTA 3N4CA 2CKLB 3S3RA 2YU4A 3O35A 4L7XA 3D6SA 3IUTA 2MUMA 1TL9A 3BPFA 1F29A 1WEUA 4FJCA 1HYIA 4MVTA 3T7LA 1PPDA 2FTDA 3PHDA 2DJFB 2VJEB 2ECWA 1MEMA 3PURA 2AS8A 1JQPA 2HYED 2FQ9A 4BHWA 5B79A 2M85A 3HWNA 1CQDA 4TKPB 2H0DB 5H1VA 3BCNA 2EODA 5EF4A 3D9WA 1YK8A 3N3KA 4YBTA 2FT2A 4QRVA 1EWMA 2CB5A 2DCBA 2YQLA 4X3GA 1STFE 2R9OA 4BS6A 4YYVA 1HYJA 4UP5A 2K1JA 5G05B 3ZTGA 4B86C 2KWOA 5D1LB 1BP4A 4R2YA 3N9PA 2MT5A 3C6WA 5LKXA 4BS5A 3H89A 3MHHA 3RTRB 1KHQA 2KGGA 3U5MA 2ECGA 5B75A 2RSDA 3PBHA 4O64A 4I7BA 2B1NA 3N9QA 2CIOA 4XI1A 3H8CA 3I3TA 3KW9A 1PCIA 2BAYA 2P0RA 2K16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUQ B;  2MIQ A;  4CDF B;  1ME4 A;  2DZZ A;  3PDF A;  2LGV A;  4ZQL A;  1BQI A;  4YV8 A;  1CJL A;  4F52 B;  5JH3 A;  2MA5 A;  2BDL A;  1PBH A;  3GCB A;  4YYQ A;  4N3W A;  5CVM A;  2LGG A;  1DEU A;  4HWY A;  4YVA A;  4AYC B;  3ZPV 1;  2HD5 A;  2F7D A;  4CDC B;  5DIN A;  3L1Z B;  4PI3 A;  3C5K A;  3KV6 A;  5CHT A;  4PTB A;  2F6J A;  4QRG A;  1FBV A;  2LGL A;  3FL2 A;  4R8P K;  2Y1M A;  2K4D A;  2M1R A;  3KSE A;  1ATK A;  2YSM A;  2R6N A;  2OZ2 A;  3RVW A;  1AYU A;  3DF0 A;  3QZV A;  5LKU A;  4RY2 A;  1Z6U A;  4PP2 E;  3MOR A;  2DCD A;  2YJB A;  1WEE A;  1CPJ A;  4YAD A;  2ECN A;  4CDE B;  2NQI A;  2QJ0 A;  3SOU A;  5G0F A;  1AYV A;  2HXZ A;  2M3H A;  5A24 A;  3IOQ A;  2DJG B;  4PAD A;  1K3B B;  5JA7 A;  5D1M B;  1RMD A;  3N9M A;  4OEL A;  5CVN B;  1N87 A;  3RVV A;  3IMA A;  2H7J A;  1AYW A;  2PNS A;  1AU0 A;  2LDR A;  5JG6 A;  1BGO A;  1VFY A;  1QOL A;  2HDP A;  4YAX A;  1ZCM A;  5FB0 A;  1U9W A;  1NB3 A;  1WIL A;  1CTE A;  2VPG A;  1MS6 A;  4V3L C;  4WZ3 B;  3V43 A;  4LLB A;  3U5P A;  2JMI A;  6PAD A;  1WGM A;  1JM7 B;  2QIZ A;  3OVZ A;  3O36 A;  2YHN A;  1THE A;  3N3G A;  4OEM A;  1POP A;  3N9O A;  2LXH C;  5C11 A;  2L43 A;  5FPW A;  1WEO A;  4GND A;  1YVB A;  5B77 A;  2LQ6 A;  5D1K B;  3LQI A;  2UZG A;  2VHS A;  3SOX A;  2AYO A;  2RI7 A;  4GNG A;  2JQF R;  1U9V A;  3IV2 A;  5B76 A;  5C13 A;  2EGP A;  3KWZ A;  1U5I A;  1MIR A;  2VHF A;  2R9M A;  3WXF A;  3U8E A;  1GCB A;  5AIU A;  1CS8 A;  1WEN A;  3KWB X;  2YSJ A;  1QMY A;  1X4I A;  3AI8 A;  4AXM A;  3N9L A;  3HD3 A;  1MDW A;  5TDW A;  1S4V A;  2IBI A;  3O70 A;  3SOW A;  2OUL A;  1EWL A;  1WEV A;  2YJC A;  2FRQ A;  1F2C A;  2B1M A;  4I04 A;  2ECJ A;  4GNE A;  2AU1 A;  2DC9 A;  2YQM A;  2G45 A;  1CVZ A;  1FP0 A;  2C2V S;  4N8W A;  2IDA A;  5KH7 A;  2M6M A;  3WXE A;  4W5C A;  2FUI A;  1JM7 A;  5LKZ A;  2C0Y A;  4X6H A;  3L11 A;  1K2F A;  3K8U A;  2YUC A;  2GHU A;  1G25 A;  2MNY A;  4N4F A;  1AU3 A;  3VK6 A;  1KXR A;  2XU1 A;  3LFY A;  4YYR A;  4WZ0 A;  2G8J A;  3L1X A;  2VJF A;  2KWK A;  4LJN A;  4CCG X;  2FUU A;  3PUQ A;  4NN2 A;  4V3K C;  1Q6K A;  1XKG A;  1NL6 A;  2OXQ C;  3RPG C;  2I50 A;  3QT4 A;  2KWN A;  4G54 A;  5CHV A;  2AUZ A;  2MD7 B;  4P6G A;  1X4U A;  4YYS A;  1HUC B;  1ZIV A;  4I07 A;  3V6C A;  5J3X A;  2G8E A;  4PPE A;  1EF7 A;  4CA1 A;  2XU4 A;  3H8B A;  3MTN A;  3V6E A;  2F1G A;  4XR7 A;  3KQI A;  3N9N A;  1ITO A;  1PPO A;  3CH2 X;  4Q8H A;  4IC2 A;  1FH0 A;  4FO9 A;  3EB5 A;  4N4Z A;  3RVX A;  4YBM A;  1QDQ A;  2NQA A;  2KRE A;  1TU6 A;  3O0U A;  2ACT A;  4Q6F A;  3E1Z B;  4YYU A;  1Y08 A;  1DVP A;  1A6R A;  2NQG A;  3ZVY A;  4A49 A;  1E4U A;  1PXV A;  5LCW B;  1BY8 A;  1TLO A;  1CHC A;  5I3L A;  4LAD B;  2YJ8 A;  4I05 A;  1MM2 A;  3U5O A;  2E6R A;  1AIM A;  4WZ2 A;  2E03 A;  2DX8 A;  2R9F A;  2E6S A;  2ECT A;  2ARY A;  4AP4 A;  2VJF B;  4YYW A;  2YJ9 A;  3O34 A;  3HCU A;  1IYM A;  1YAL A;  3GV4 A;  2HHN A;  1PPN A;  2FRA A;  3DPL R;  2ECI A;  1V87 A;  3H7D A;  2YJ2 A;  1SP4 B;  5KH3 A;  3P5W A;  4Q8G A;  1NB5 A;  2OP3 A;  2ZET C;  2KFT A;  3O33 A;  4YAT A;  3B79 A;  2JMJ A;  3BOW A;  2DC7 A;  4PP1 A;  4BPV A;  4N79 A;  1X9Y A;  3KKU A;  2MD8 C;  3NHE A;  2LV9 A;  4GNF A;  2FSA A;  2P86 A;  2NAA A;  5B8D A;  2DCC A;  2CSZ A;  3KV5 A;  1AU4 A;  2D8S A;  1AEC A;  1PE6 A;  3O37 A;  3KFQ A;  3KNV A;  1CB5 A;  1X4J A;  4X6I A;  2MNZ A;  3USV A;  2Y1N A;  5G04 B;  2DC6 A;  1T1H A;  1KFU L;  1U9Q X;  2LXP C;  2ATO A;  2DC8 A;  3OF8 A;  3QSD A;  4QBB A;  4K7C A;  3BC3 A;  2ECV A;  5H9M A;  3I2D A;  2AVW A;  2KE1 A;  2LN0 A;  2VPE A;  2XB1 A;  1AU2 A;  1U9X A;  1JOC A;  1F2B A;  3CBJ A;  5EGW A;  2VNF A;  1WEM A;  2CSY A;  2MA6 A;  5H1T A;  2BDZ A;  3OF9 A;  2VPB A;  4UP0 A;  4S3O B;  4DMX A;  3OVX A;  3EB6 A;  2XU3 A;  4R7E A;  2PUY A;  3IHP A;  2G43 A;  2YHO A;  2YW8 A;  4FIP A;  2GFO A;  3ZUA A;  2HH5 A;  2JMD A;  1YK7 A;  1VJV A;  3PW3 A;  4MZS A;  3LQH A;  1WEP A;  5J94 A;  2G6Q A;  4A4B A;  4I7D A;  1IWD A;  4YBS A;  3HCS A;  2KYU A;  3LRQ A;  2R9C A;  3U5N A;  2Y5B A;  4BQV A;  5DKA A;  2DZY A;  4B7Y C;  2E01 A;  2IPP B;  2PNX A;  1BOR A;  3MHS A;  1YT7 A;  3ZNI A;  1MEG A;  3P5V A;  2AYN A;  5H1U A;  5TDR A;  2PBH A;  3F5V A;  3K24 A;  2Y6E A;  4W5B A;  1U6G B;  4AVX A;  1EWP A;  2L80 A;  1GMY A;  2H0D A;  1F62 A;  2K17 A;  3O1G A;  5EYA F;  2G7Y A;  3LXS A;  3TNX A;  5B78 A;  1VD4 A;  3QJ3 A;  1O0E A;  5FER A;  2VJE A;  4KLB A;  4P6E A;  7PCK A;  4BBQ A;  9PAP A;  2EA6 A;  4W4U A;  2NQD B;  8PCH A;  3OIS A;  3HHI A;  5PAD A;  2XEU A;  2YYR A;  1WES A;  4AXL A;  3P5X A;  2YUR A;  2JQG R;  3CH3 X;  4UI9 B;  3GL6 A;  3BWK A;  2PAD A;  3I06 A;  4XUI A;  3ERV A;  5KH9 A;  4A4C A;  1ME3 A;  1QXP A;  1Z2Q A;  3M99 A;  2KGI A;  5TAB A;  1WE9 A;  1SNK A;  3F75 A;  2YRE A;  3DQV R;  4MSX A;  1DF0 A;  2CT2 A;  1CSB B;  4ZDT A;  2FO5 A;  2G6D A;  3IEJ A;  1MM3 A;  4GB0 A;  4ZUX U;  2F6N A;  1NLJ A;  3KX1 A;  5K16 A;  4BSQ A;  4X6J A;  4MZO A;  1ZBD B;  4QF2 A;  3PNR A;  5TBN A;  2E02 A;  3P5U A;  2KU3 A;  1GEC E;  2F42 A;  1Z60 A;  5FEY A;  2CKL A;  4L58 A;  4WA6 A;  3S3Q A;  2L5U A;  3SHB A;  2O6X A;  5AIT A;  1F2A A;  2C2L A;  1KHP A;  1WEQ A;  3LQJ A;  4A0C D;  1LDK C;  1NPZ A;  1VYX A;  3HCT A;  5FB1 A;  1Y4H A;  2AIM A;  1LDJ B;  4FK5 A;  3O7A A;  4YAB A;  2AUX A;  2E00 A;  2WBF X;  2KWJ A;  2FYE A;  4DMY A;  3HHA A;  3RPG B;  3H6S A;  2JRJ A;  2LRI C;  4IC3 A;  2KR4 A;  2KIZ A;  1GLO A;  1PIP A;  4P5O B;  4CZW A;  3WXG A;  3ASL A;  4LKA A;  2VPD A;  4QRX A;  2L0B A;  4I7C A;  4S3O C;  3ZYQ A;  2PRE A;  4QH6 A;  1EWO A;  3CBK A;  1ICF A;  1KFX L;  1WEW A;  3NG2 A;  3ZPV E;  1NQC A;  2FUD A;  1WFK A;  2YT5 A;  2L75 A;  4QF3 A;  1WIM A;  2DCA A;  1PAD A;  5F02 A;  3T6R A;  2VP7 A;  4CDD B;  1CV8 A;  3M63 A;  1XWH A;  3C9E A;  3BPM A;  2Y43 A;  4LK9 A;  2QIC A;  3ZVZ B;  2R9N A;  1MHW A;  2AN6 A;  1M6D A;  3M62 A;  1VSN A;  4AYC A;  2P7U A;  3HTK C;  4C9Z A;  4YC9 A;  1PPP A;  5CVO B;  5TRB A;  2LGK A;  3K9M A;  2XU5 A;  5LKT A;  3N4C A;  2CKL B;  3S3R A;  2YU4 A;  3O35 A;  4L7X A;  3D6S A;  3IUT A;  2MUM A;  1TL9 A;  3BPF A;  1F29 A;  1WEU A;  4FJC A;  1HYI A;  4MVT A;  3T7L A;  1PPD A;  2FTD A;  3PHD A;  2DJF B;  2VJE B;  2ECW A;  1MEM A;  3PUR A;  2AS8 A;  1JQP A;  2HYE D;  2FQ9 A;  4BHW A;  5B79 A;  2M85 A;  3HWN A;  1CQD A;  4TKP B;  2H0D B;  5H1V A;  3BCN A;  2EOD A;  5EF4 A;  1YK8 A;  3N3K A;  4YBT A;  2FT2 A;  4QRV A;  1EWM A;  2CB5 A;  2DCB A;  2YQL A;  4X3G A;  1STF E;  2R9O A;  4BS6 A;  4YYV A;  1HYJ A;  4UP5 A;  2K1J A;  5G05 B;  3ZTG A;  4B86 C;  2KWO A;  5D1L B;  1BP4 A;  4R2Y A;  3N9P A;  2MT5 A;  3C6W A;  5LKX A;  4BS5 A;  3H89 A;  3MHH A;  3RTR B;  1KHQ A;  2KGG A;  3U5M A;  2ECG A;  5B75 A;  2RSD A;  3PBH A;  4O64 A;  4I7B A;  2B1N A;  3N9Q A;  2CIO A;  4XI1 A;  3H8C A;  3I3T A;  3KW9 A;  1PCI A;  2BAY A;  2P0R A;  2K16 A; 
#chains in the Genus database with same CATH topology
 4AUQ B;  2MIQ A;  4CDF B;  5SVI A;  1ME4 A;  2DZZ A;  3PDF A;  2LGV A;  4ZQL A;  1BQI A;  2BU3 A;  2M13 A;  4YV8 A;  1CJL A;  4GUA A;  4F52 B;  5JH3 A;  2MA5 A;  4M0W A;  2BDL A;  1PBH A;  3GCB A;  4YYQ A;  4N3W A;  5CVM A;  2LGG A;  2IQJ A;  1DEU A;  4HWY A;  4YVA A;  4AYC B;  4P16 A;  3ZPV 1;  2HD5 A;  2F7D A;  4CDC B;  5DIN A;  1YZB A;  3L1Z B;  2Z84 A;  4PI3 A;  3C5K A;  3KV6 A;  5CHT A;  4PTB A;  2F6J A;  4QRG A;  1FBV A;  2LGL A;  5EZS A;  2KKY A;  3FL2 A;  3MP2 A;  4R8P K;  2Y1M A;  2JRI A;  2K4D A;  2M1R A;  3KSE A;  1ATK A;  2YSM A;  2R6N A;  2OZ2 A;  2BTW A;  3RVW A;  1AYU A;  3DF0 A;  3QZV A;  3PHW A;  5LKU A;  4RY2 A;  1Z6U A;  3TMP A;  4PP2 E;  3MOR A;  3PHU A;  5K3Q A;  2DCD A;  2YJB A;  1WEE A;  1CPJ A;  4YAD A;  2JTC A;  2ECN A;  5SVY A;  4CDE B;  4D8I A;  2NQI A;  2QJ0 A;  3SOU A;  5G0F A;  1AYV A;  2HXZ A;  2M3H A;  3DDT A;  5A24 A;  2FD4 A;  3IOQ A;  4BOS A;  2DJG B;  4PAD A;  1K3B B;  5JA7 A;  5D1M B;  1RMD A;  2P57 A;  3N9M A;  4OEL A;  5CVN B;  1N87 A;  3M7K A;  3RVV A;  3IMA A;  2H7J A;  1AYW A;  2PNS A;  1AU0 A;  2LDR A;  5JG6 A;  2KKX A;  1BGO A;  1VFY A;  3W30 A;  1QOL A;  3FJU B;  2HDP A;  4YAX A;  1ZCM A;  2HWK A;  5FB0 A;  1U9W A;  1NB3 A;  1WIL A;  1CTE A;  2VPG A;  1MS6 A;  3BBA A;  4V3L C;  4WZ3 B;  3V43 A;  4LLB A;  3U5P A;  2JMI A;  6PAD A;  1WGM A;  2OWA A;  2QIZ A;  1JM7 B;  3OVZ A;  2CRR A;  3LDY A;  3O36 A;  2YHN A;  1THE A;  3N3G A;  4OEM A;  1POP A;  3N9O A;  2LXH C;  5C11 A;  2L43 A;  5FPW A;  4BOQ A;  1WEO A;  4GND A;  1YVB A;  4HXD B;  4IP3 A;  5B77 A;  4OGC A;  2LQ6 A;  5D1K B;  3LQI A;  2UZG A;  2VHS A;  3SOX A;  2AYO A;  4D8B A;  3LVR E;  2RI7 A;  4GNG A;  2DSM A;  2JQF R;  1U9V A;  3IV2 A;  3E2D A;  2AGA A;  5B76 A;  5C13 A;  3FM8 C;  2EGP A;  3KWZ A;  1U5I A;  1MIR A;  2VHF A;  2R9M A;  3WXF A;  3U8E A;  1GCB A;  5AIU A;  1CS8 A;  1WEN A;  3KWB X;  2XP0 A;  2YSJ A;  1QMY A;  1X4I A;  3AI8 A;  4AXM A;  3N9L A;  3HD3 A;  1MDW A;  5TDW A;  1S4V A;  2IBI A;  2D8U A;  3O70 A;  3SOW A;  1EWL A;  2OUL A;  1WEV A;  2YJC A;  2L7P A;  3JUE A;  2FRQ A;  2J7Q A;  4WUR A;  1F2C A;  2B1M A;  4I04 A;  2ECJ A;  3DWD A;  4GNE A;  2AU1 A;  3O65 A;  2DC9 A;  2RR4 A;  2YQM A;  2G45 A;  1CVZ A;  1FP0 A;  2C2V S;  4N8W A;  2IDA A;  5KH7 A;  2M6M A;  3WXE A;  4W5C A;  2FUI A;  1JM7 A;  5LKZ A;  2JM3 A;  2C0Y A;  3RNV A;  4X6H A;  3L11 A;  1K2F A;  3K8U A;  2YUC A;  2GHU A;  1G25 A;  2MNY A;  4N4F A;  1AU3 A;  3VK6 A;  1KXR A;  2XU1 A;  3LFY A;  4YYR A;  4WZ0 A;  2FFW A;  2G8J A;  3E9S A;  4H9D A;  3L1X A;  2VJF A;  2KWK A;  4LJN A;  4CCG X;  2FUU A;  3PUQ A;  4NN2 A;  4V3K C;  3LVQ E;  1Q6K A;  1NL6 A;  2OXQ C;  1XKG A;  3RPG C;  2I50 A;  3QT4 A;  2KWN A;  4G54 A;  5CHV A;  2AUZ A;  2MD7 B;  4P6G A;  1X4U A;  2DOS A;  4Z0R A;  4MM3 B;  4YYS A;  1HUC B;  4RF0 A;  1ZIV A;  4I07 A;  3V6C A;  5J3X A;  2G8E A;  4PPE A;  2CON A;  4CA1 A;  1EF7 A;  3OQC A;  2XU4 A;  3H8B A;  3MTN A;  3MDB C;  3V6E A;  4BOZ A;  2F1G A;  4XR7 A;  3KQI A;  3N9N A;  1ITO A;  1PPO A;  3BB7 A;  3CH2 X;  4Q8H A;  4IC2 A;  1FH0 A;  4FO9 A;  3EB5 A;  4N4Z A;  3RVX A;  4YBM A;  1QDQ A;  4XZX A;  4BOU A;  2NQA A;  2KRE A;  1TU6 A;  3O0U A;  4D8E A;  4QQ4 A;  2ACT A;  4Q6F A;  3E1Z B;  3O47 A;  5EZQ A;  4YYU A;  1Y08 A;  4A5U A;  1DVP A;  1A6R A;  2YVR A;  2NQG A;  3ZVY A;  4A49 A;  1E4U A;  1PXV A;  5LCW B;  1BY8 A;  1TLO A;  1CHC A;  4RNA A;  5I3L A;  4LAD B;  2YJ8 A;  4I05 A;  1MM2 A;  3U5O A;  2E6R A;  1AIM A;  1DCQ A;  4WZ2 A;  2E03 A;  2DX8 A;  2R9F A;  2E6S A;  2ECT A;  2ARY A;  3PRP A;  2CRW A;  4AP4 A;  2VJF B;  4YYW A;  2YJ9 A;  3O34 A;  3HCU A;  4OW0 A;  1IYM A;  1YAL A;  3SUB A;  3GV4 A;  2HHN A;  2UZJ A;  2MKE A;  1PPN A;  2FRA A;  3DPL R;  2ECI A;  2CSV A;  1V87 A;  3H7D A;  2YJ2 A;  1SP4 B;  5KH3 A;  5JZE A;  3P5W A;  4Q8G A;  4BOP A;  1NB5 A;  2OP3 A;  2ZET C;  2KFT A;  3O33 A;  4YAT A;  3B79 A;  2JMJ A;  3BOW A;  2DC7 A;  4PP1 A;  4BPV A;  4N79 A;  1X9Y A;  3KKU A;  2MD8 C;  3NHE A;  2LV9 A;  4GNF A;  2FSA A;  2P86 A;  2NAA A;  5B8D A;  2DCC A;  2CSZ A;  3KV5 A;  1AU4 A;  2D8S A;  1AEC A;  1PE6 A;  3O37 A;  3PHX A;  3KFQ A;  3KNV A;  1CB5 A;  1X4J A;  4X6I A;  2MNZ A;  3USV A;  2Y1N A;  5G04 B;  2DC6 A;  1T1H A;  1KFU L;  1U9Q X;  2LXP C;  2ATO A;  2DC8 A;  3OF8 A;  3QSD A;  4QBB A;  4REZ A;  4K7C A;  3BC3 A;  2ECV A;  2LAU A;  5H9M A;  3I2D A;  2AVW A;  2KE1 A;  2LN0 A;  2VPE A;  2XB1 A;  1AU2 A;  1U9X A;  2JUN A;  1JOC A;  1F2B A;  3CBJ A;  5EGW A;  2VNF A;  1WEM A;  2CSY A;  2MA6 A;  2XOZ A;  5H1T A;  2BDZ A;  3OF9 A;  2VPB A;  4UP0 A;  4S3O B;  4DMX A;  3OVX A;  3EB6 A;  2XU3 A;  4R7E A;  2PUY A;  3IHP A;  2G43 A;  1DKI A;  2FE8 A;  2YHO A;  2YW8 A;  4FIP A;  2GFO A;  3ZUA A;  2HH5 A;  2JMD A;  1YK7 A;  1VJV A;  3PW3 A;  4MZS A;  3LQH A;  1WEP A;  3LJU X;  5J94 A;  2G6Q A;  4A4B A;  4I7D A;  1IWD A;  3Q1D A;  4YBS A;  3HCS A;  2KYU A;  3LRQ A;  2R9C A;  3U5N A;  4PT5 A;  2Y5B A;  4BQV A;  5DKA A;  2DZY A;  4B7Y C;  2E01 A;  2IPP B;  2PNX A;  1BOR A;  3MHS A;  1YT7 A;  3ZNI A;  1MEG A;  3P5V A;  2AYN A;  5H1U A;  5TDR A;  2PBH A;  3B21 A;  3F5V A;  3K24 A;  3MTV A;  2Y6E A;  4W5B A;  1U6G B;  4AVX A;  1EWP A;  2L80 A;  1GMY A;  2H0D A;  1F62 A;  2K17 A;  3O1G A;  5EYA F;  2G7Y A;  3LXS A;  4RF1 A;  3TNX A;  5B78 A;  1VD4 A;  3QJ3 A;  1O0E A;  2E61 A;  5FER A;  2VJE A;  4KLB A;  4P6E A;  7PCK A;  4BBQ A;  9PAP A;  2EA6 A;  4W4U A;  2NQD B;  8PCH A;  3OIS A;  3HHI A;  2XOC A;  5PAD A;  2XEU A;  2YYR A;  1WES A;  4AXL A;  3P5X A;  2YUR A;  2XOY A;  5E6J A;  2JQG R;  3CH3 X;  4ZTB A;  4UI9 B;  3GL6 A;  3BWK A;  2PAD A;  3I06 A;  2EGM A;  3ERV A;  4XUI A;  5KH9 A;  3PLW A;  4A4C A;  1ME3 A;  1QXP A;  1Z2Q A;  3M99 A;  2KGI A;  5TAB A;  1WE9 A;  1SNK A;  3F75 A;  2YRE A;  3DQV R;  5SVI B;  4MSX A;  4OVZ A;  1DF0 A;  2CT2 A;  1CSB B;  1UKF A;  4O62 A;  2EXU A;  4ZDT A;  2FO5 A;  2G6D A;  3IEJ A;  1MM3 A;  4GB0 A;  4ZUX U;  2F6N A;  1NLJ A;  3KX1 A;  5K16 A;  1PVJ A;  4BSQ A;  4X6J A;  4MZO A;  1ZBD B;  4QF2 A;  3PNR A;  5TBN A;  3PRM A;  2E02 A;  3P5U A;  2KU3 A;  1GEC E;  4IUM A;  2F42 A;  1Z60 A;  5FEY A;  2CKL A;  4L58 A;  4WA6 A;  3S3Q A;  2L5U A;  3SHB A;  2O6X A;  5AIT A;  1F2A A;  2C2L A;  1KHP A;  1WEQ A;  3LQJ A;  4A0C D;  1LDK C;  1NPZ A;  1VYX A;  3HCT A;  5FB1 A;  3C0R A;  1Y4H A;  2AIM A;  1LDJ B;  4FK5 A;  3W31 A;  5SVX A;  3O7A A;  4Z0O A;  4YAB A;  2AUX A;  2E00 A;  2WBF X;  2KWJ A;  2FYE A;  4DMY A;  3HHA A;  3H7H A;  3RPG B;  2JRJ A;  2LRI C;  3H6S A;  4IC3 A;  2KR4 A;  2KIZ A;  1GLO A;  1PIP A;  4P5O B;  4CZW A;  3WXG A;  3ASL A;  4LKA A;  4RKX A;  2VPD A;  4QRX A;  2L0B A;  4I7C A;  4S3O C;  1MBM A;  3ZYQ A;  2PRE A;  4QH6 A;  1EWO A;  3CBK A;  1ICF A;  1KFX L;  1WEW A;  3NG2 A;  3ZPV E;  1NQC A;  2FUD A;  1WFK A;  2YT5 A;  2L75 A;  3PSE A;  4QF3 A;  1WIM A;  2DCA A;  2BTW B;  3ZNH A;  1PAD A;  5F02 A;  3T6R A;  3KDE C;  2VP7 A;  4CDD B;  1CV8 A;  3FAN A;  3M63 A;  1XWH A;  3C9E A;  3TRK A;  3BPM A;  2Y43 A;  4LK9 A;  4OVZ B;  2QIC A;  3ZVZ B;  2J7Q C;  2R9N A;  1MHW A;  3T9K A;  2AN6 A;  2B0O E;  1M6D A;  3M62 A;  1VSN A;  4AYC A;  2P7U A;  3HTK C;  4C9Z A;  4YC9 A;  1PPP A;  5CVO B;  5TRB A;  2LGK A;  3FAO A;  3BY4 A;  2XU5 A;  3K9M A;  5LKT A;  3N4C A;  2CKL B;  3S3R A;  2YU4 A;  3O35 A;  4L7X A;  3D6S A;  3IUT A;  2MUM A;  1TL9 A;  3BPF A;  1F29 A;  1WEU A;  4FJC A;  1HYI A;  4MVT A;  3T7L A;  1PPD A;  2FTD A;  3PHD A;  2DJF B;  2VJE B;  4R3D A;  2ECW A;  1MEM A;  3PUR A;  2AS8 A;  1JQP A;  2HYE D;  5KO3 A;  2FQ9 A;  4BHW A;  4OGE A;  5B79 A;  2M85 A;  3PT2 A;  3HWN A;  1CQD A;  4TKP B;  2H0D B;  5H1V A;  3BCN A;  2EOD A;  5EF4 A;  1YK8 A;  3N3K A;  4YBT A;  2FT2 A;  4QRV A;  1EWM A;  2CB5 A;  2DCB A;  2YQL A;  4X3G A;  4F1P A;  1STF E;  2R9O A;  3MJ5 A;  4BS6 A;  4YYV A;  1HYJ A;  4UP5 A;  3FEH A;  3IFU A;  2K1J A;  5G05 B;  3ZTG A;  4B86 C;  2KWO A;  5D1L B;  1BP4 A;  4R2Y A;  3N9P A;  2DJA A;  2MT5 A;  3C6W A;  5LKX A;  4BS5 A;  3H89 A;  3MHH A;  3RTR B;  1KHQ A;  2KGG A;  3U5M A;  2ECG A;  5B75 A;  2RSD A;  3PBH A;  4O64 A;  4I7B A;  2B1N A;  3N9Q A;  2CIO A;  4XI1 A;  3H8C A;  3I3T A;  3KW9 A;  4MI7 A;  1PCI A;  2BAY A;  2P0R A;  2K16 A; 
#chains in the Genus database with same CATH homology
 4AUQ B;  2MIQ A;  4CDF B;  1ME4 A;  2DZZ A;  3PDF A;  2LGV A;  4ZQL A;  1BQI A;  4YV8 A;  1CJL A;  4F52 B;  5JH3 A;  2MA5 A;  2BDL A;  4B55 A;  1PBH A;  3GCB A;  4YYQ A;  4N3W A;  5CVM A;  2LGG A;  1DEU A;  4HWY A;  4YVA A;  4AYC B;  3ZPV 1;  2HD5 A;  2F7D A;  4CDC B;  5DIN A;  3L1Z B;  4PI3 A;  3C5K A;  3KV6 A;  5CHT A;  4PTB A;  2F6J A;  4QRG A;  1FBV A;  2LGL A;  3FL2 A;  4R8P K;  2Y1M A;  2K4D A;  2M1R A;  3KSE A;  1ATK A;  2YSM A;  2R6N A;  2OZ2 A;  3RVW A;  1AYU A;  3DF0 A;  3QZV A;  5LKU A;  4RY2 A;  1Z6U A;  4PP2 E;  3MOR A;  2DCD A;  2YJB A;  1WEE A;  1CPJ A;  4YAD A;  2ECN A;  4CDE B;  2NQI A;  2QJ0 A;  3SOU A;  5G0F A;  1AYV A;  2HXZ A;  2M3H A;  5A24 A;  3IOQ A;  4C5P A;  2DJG B;  4PAD A;  1K3B B;  5JA7 A;  5D1M B;  1RMD A;  3N9M A;  4OEL A;  5CVN B;  1N87 A;  3RVV A;  3IMA A;  2H7J A;  1AYW A;  2PNS A;  1AU0 A;  2LDR A;  5JG6 A;  1BGO A;  1VFY A;  1QOL A;  2HDP A;  4YAX A;  1ZCM A;  5FB0 A;  1U9W A;  1NB3 A;  1WIL A;  1CTE A;  2VPG A;  1MS6 A;  4V3L C;  4WZ3 B;  3V43 A;  4LLB A;  3U5P A;  2JMI A;  6PAD A;  1WGM A;  1JM7 B;  2QIZ A;  3OVZ A;  3O36 A;  2YHN A;  1THE A;  3N3G A;  4OEM A;  1POP A;  3N9O A;  2LXH C;  5C11 A;  2L43 A;  4NV7 A;  5FPW A;  1WEO A;  4GND A;  1YVB A;  5B77 A;  2LQ6 A;  5D1K B;  3LQI A;  2UZG A;  2VHS A;  3SOX A;  2AYO A;  2RI7 A;  4GNG A;  2JQF R;  1U9V A;  3IV2 A;  5B76 A;  5C13 A;  2EGP A;  3KWZ A;  1U5I A;  1MIR A;  2VHF A;  2R9M A;  3WXF A;  3U8E A;  1GCB A;  5AIU A;  1CS8 A;  1WEN A;  3KWB X;  2YSJ A;  1QMY A;  1X4I A;  3AI8 A;  4AXM A;  3N9L A;  3HD3 A;  1MDW A;  5TDW A;  1S4V A;  2IBI A;  3O70 A;  3SOW A;  2OUL A;  1EWL A;  1WEV A;  2YJC A;  1E2T A;  2FRQ A;  1F2C A;  2B1M A;  4I04 A;  2ECJ A;  4GNE A;  2AU1 A;  2DC9 A;  2YQM A;  2G45 A;  1CVZ A;  1FP0 A;  2C2V S;  4N8W A;  2IDA A;  5KH7 A;  2M6M A;  3WXE A;  4W5C A;  2FUI A;  1JM7 A;  5LKZ A;  2C0Y A;  4X6H A;  3L11 A;  1K2F A;  3K8U A;  2YUC A;  2GHU A;  1G25 A;  2MNY A;  4N4F A;  1AU3 A;  3VK6 A;  1KXR A;  2XU1 A;  3LFY A;  4YYR A;  4WZ0 A;  2G8J A;  3L1X A;  2VJF A;  2KWK A;  4LJN A;  4CCG X;  2FUU A;  3PUQ A;  4NN2 A;  4V3K C;  1Q6K A;  1XKG A;  1NL6 A;  2OXQ C;  3RPG C;  2I50 A;  3QT4 A;  2KWN A;  4G54 A;  5CHV A;  2AUZ A;  2MD7 B;  4P6G A;  1X4U A;  4YYS A;  1HUC B;  1ZIV A;  4I07 A;  3V6C A;  5J3X A;  2G8E A;  4PPE A;  1EF7 A;  4CA1 A;  2XU4 A;  3H8B A;  3MTN A;  1GX3 A;  4GUZ A;  3V6E A;  2F1G A;  4XR7 A;  3KQI A;  3N9N A;  1ITO A;  1PPO A;  3CH2 X;  4Q8H A;  4IC2 A;  1FH0 A;  4FO9 A;  3EB5 A;  4N4Z A;  3RVX A;  4YBM A;  1QDQ A;  2NQA A;  2KRE A;  1TU6 A;  3O0U A;  2ACT A;  4Q6F A;  3E1Z B;  4YYU A;  1Y08 A;  1DVP A;  1A6R A;  2NQG A;  3ZVY A;  4A49 A;  1E4U A;  1PXV A;  5LCW B;  1BY8 A;  1TLO A;  1CHC A;  1W6F A;  5I3L A;  4LAD B;  2YJ8 A;  4I05 A;  1MM2 A;  3U5O A;  2E6R A;  1AIM A;  4WZ2 A;  2E03 A;  2DX8 A;  2R9F A;  2E6S A;  2ECT A;  2ARY A;  4AP4 A;  2VJF B;  4YYW A;  2YJ9 A;  3O34 A;  3HCU A;  1IYM A;  1YAL A;  3GV4 A;  2HHN A;  1PPN A;  2FRA A;  3DPL R;  2ECI A;  1V87 A;  3H7D A;  2YJ2 A;  1SP4 B;  5KH3 A;  3P5W A;  4Q8G A;  1NB5 A;  2OP3 A;  2ZET C;  2KFT A;  3O33 A;  4BGF A;  4YAT A;  3B79 A;  2JMJ A;  3BOW A;  2DC7 A;  4PP1 A;  4BPV A;  4N79 A;  1X9Y A;  3KKU A;  2MD8 C;  3NHE A;  2LV9 A;  4GNF A;  2FSA A;  2P86 A;  2NAA A;  5B8D A;  2DCC A;  2CSZ A;  3KV5 A;  1AU4 A;  2D8S A;  1AEC A;  1PE6 A;  3O37 A;  3KFQ A;  3KNV A;  1CB5 A;  1X4J A;  4X6I A;  2MNZ A;  3USV A;  2Y1N A;  5G04 B;  2DC6 A;  1T1H A;  1KFU L;  1U9Q X;  2LXP C;  2ATO A;  2DC8 A;  3OF8 A;  3QSD A;  4QBB A;  4K7C A;  3BC3 A;  2ECV A;  5H9M A;  3I2D A;  2AVW A;  2KE1 A;  2LN0 A;  2VPE A;  2XB1 A;  1AU2 A;  1U9X A;  1JOC A;  1F2B A;  3CBJ A;  5EGW A;  2VNF A;  1WEM A;  2CSY A;  2MA6 A;  5H1T A;  2BDZ A;  3OF9 A;  2VPB A;  4UP0 A;  4S3O B;  4DMX A;  3OVX A;  3EB6 A;  2XU3 A;  4R7E A;  2PUY A;  3IHP A;  2VFC A;  2G43 A;  2YHO A;  2YW8 A;  4FIP A;  2GFO A;  3ZUA A;  2BSZ A;  2HH5 A;  2JMD A;  1YK7 A;  1VJV A;  3PW3 A;  4MZS A;  3LQH A;  1WEP A;  5J94 A;  2G6Q A;  4A4B A;  1W5R A;  4I7D A;  1IWD A;  4YBS A;  3HCS A;  2KYU A;  3LRQ A;  2R9C A;  3U5N A;  2Y5B A;  4BQV A;  5DKA A;  2DZY A;  4B7Y C;  2E01 A;  2IPP B;  2PNX A;  1BOR A;  3MHS A;  1YT7 A;  3ZNI A;  1MEG A;  3P5V A;  2AYN A;  5H1U A;  5TDR A;  2PBH A;  3F5V A;  3K24 A;  2Y6E A;  4W5B A;  1U6G B;  4AVX A;  1EWP A;  2L80 A;  1GMY A;  2H0D A;  1F62 A;  2K17 A;  3O1G A;  5EYA F;  2G7Y A;  3LXS A;  3TNX A;  5B78 A;  1VD4 A;  3QJ3 A;  1O0E A;  5FER A;  2VJE A;  4KLB A;  4P6E A;  7PCK A;  4BBQ A;  9PAP A;  2EA6 A;  4W4U A;  2NQD B;  8PCH A;  3OIS A;  3HHI A;  5PAD A;  2XEU A;  2YYR A;  1WES A;  4AXL A;  3P5X A;  2YUR A;  2JQG R;  3CH3 X;  4UI9 B;  3GL6 A;  3BWK A;  2PAD A;  3I06 A;  4XUI A;  3ERV A;  5KH9 A;  4A4C A;  1ME3 A;  1QXP A;  1Z2Q A;  3M99 A;  2KGI A;  5TAB A;  1WE9 A;  1SNK A;  3F75 A;  2YRE A;  3DQV R;  4MSX A;  1DF0 A;  2CT2 A;  1CSB B;  4ZDT A;  2FO5 A;  2G6D A;  3IEJ A;  1MM3 A;  4GB0 A;  4ZUX U;  2F6N A;  1NLJ A;  3KX1 A;  5K16 A;  4BSQ A;  4X6J A;  4MZO A;  1ZBD B;  4QF2 A;  1W4T A;  3PNR A;  5TBN A;  2E02 A;  3P5U A;  2KU3 A;  1GEC E;  2F42 A;  1Z60 A;  5FEY A;  2CKL A;  4L58 A;  4WA6 A;  3S3Q A;  2L5U A;  3SHB A;  2O6X A;  5AIT A;  1F2A A;  2C2L A;  1KHP A;  1WEQ A;  3LQJ A;  4A0C D;  1LDK C;  1NPZ A;  1VYX A;  3HCT A;  5FB1 A;  1Y4H A;  2AIM A;  1LDJ B;  4FK5 A;  3O7A A;  4YAB A;  2AUX A;  2E00 A;  2WBF X;  4NV8 A;  2KWJ A;  2FYE A;  4DMY A;  3HHA A;  3RPG B;  3H6S A;  2JRJ A;  2LRI C;  4IC3 A;  2KR4 A;  2KIZ A;  1GLO A;  1PIP A;  4P5O B;  4CZW A;  3WXG A;  3ASL A;  4LKA A;  2VPD A;  4QRX A;  2L0B A;  4I7C A;  4S3O C;  3ZYQ A;  2PRE A;  4QH6 A;  1EWO A;  3CBK A;  1ICF A;  1KFX L;  1WEW A;  3NG2 A;  3ZPV E;  1NQC A;  2FUD A;  1WFK A;  2YT5 A;  2L75 A;  4QF3 A;  1WIM A;  2DCA A;  1PAD A;  5F02 A;  3T6R A;  2VP7 A;  4CDD B;  1CV8 A;  3M63 A;  1XWH A;  3C9E A;  3BPM A;  2Y43 A;  4LK9 A;  2VFB A;  2QIC A;  3ZVZ B;  2R9N A;  1MHW A;  2AN6 A;  3LTW A;  1M6D A;  3M62 A;  1VSN A;  4AYC A;  2P7U A;  3HTK C;  4C9Z A;  4YC9 A;  1PPP A;  5CVO B;  5TRB A;  2LGK A;  3K9M A;  2XU5 A;  5LKT A;  3N4C A;  2CKL B;  3S3R A;  2YU4 A;  3O35 A;  4L7X A;  3D6S A;  3IUT A;  2MUM A;  1TL9 A;  3BPF A;  1F29 A;  1WEU A;  4FJC A;  1HYI A;  4MVT A;  3T7L A;  1PPD A;  2FTD A;  3PHD A;  2DJF B;  2VJE B;  2ECW A;  1MEM A;  3PUR A;  2AS8 A;  1JQP A;  2HYE D;  2FQ9 A;  4BHW A;  5B79 A;  2M85 A;  3HWN A;  1CQD A;  4TKP B;  2H0D B;  5H1V A;  3BCN A;  2EOD A;  5EF4 A;  3D9W A;  1YK8 A;  3N3K A;  4YBT A;  2FT2 A;  4QRV A;  1EWM A;  2CB5 A;  2DCB A;  2YQL A;  4X3G A;  1STF E;  2R9O A;  4BS6 A;  4YYV A;  1HYJ A;  4UP5 A;  2K1J A;  5G05 B;  3ZTG A;  4B86 C;  2KWO A;  5D1L B;  1BP4 A;  4R2Y A;  3N9P A;  2MT5 A;  3C6W A;  5LKX A;  4BS5 A;  3H89 A;  3MHH A;  3RTR B;  1KHQ A;  2KGG A;  3U5M A;  2ECG A;  5B75 A;  2RSD A;  3PBH A;  4O64 A;  4I7B A;  2B1N A;  3N9Q A;  2CIO A;  4XI1 A;  3H8C A;  3I3T A;  3KW9 A;  1PCI A;  2BAY A;  2P0R A;  2K16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...