3M99A

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
470
structure length
422
Chain Sequence
b'SICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQDAHEFWQFIINQIHQSYVLDLPNAKNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 111
structure length 422
sequence length 470
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3m99A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3m99A02
4QRXA 2Y1MA 4B86C 1F62A 3QSDA 1PCIA 3P5XA 2CKLA 1X9YA 1XKGA 1A6RA 4P6GA 3U5OA 2DZYA 3BOWA 2Y5BA 4X6JA 4FO9A 3GV4A 4YBMA 3M63A 1QOLA 2GHUA 3BWKA 1WESA 5H1UA 4QF2A 4YYRA 2CT2A 2YREA 2OULA 4YYWA 1PADA 2R9NA 4IC2A 1FH0A 3IMAA 4I7DA 2OXQC 2L0BA 1AYVA 2MUMA 2AN6A 1NQCA 4YYVA 2LDRA 4V3LC 2D8SA 4A4BA 1EF7A 1POPA 5JG6A 2UZGA 1RMDA 3FL2A 1MDWA 2FUIA 4UI9B 4CCGX 1CS8A 3USVA 3N9MA 3SOWA 3KFQA 3C5KA 3RVWA 3KWZA 5LKZA 1GLOA 1WEPA 1WEUA 1F2BA 2ATOA 2XU5A 4OEMA 3L1XA 3SOXA 4DMYA 2VNFA 4GNGA 2Y1NA 2DX8A 1Z2QA 2FQ9A 3S3QA 4YYUA 4YAXA 1IYMA 1GCBA 1V87A 5PADA 1WEVA 2C0YA 2DZZA 3PHDA 3N9QA 1EWPA 1K2FA 4UP0A 4BS5A 3O0UA 1EWLA 3N9NA 2JRJA 3HHAA 1MIRA 2B1NA 2R9FA 3O37A 2YT5A 2EA6A 3ZPV1 2G6QA 5LKUA 5B8DA 3V6CA 2VJEB 1FBVA 4A0CD 4AUQB 3RVVA 5TBNA 2DJGB 2KR4A 2VJEA 3GCBA 3H8BA 3KW9A 3EB5A 4R7EA 1CHCA 6PADA 5JH3A 2DC7A 2HHNA 3O7AA 1CQDA 1SP4B 5CVMA 2F1GA 2KIZA 1TU6A 1VSNA 2ECIA 1VFYA 3PW3A 5AITA 1NB3A 5H1TA 3U5MA 2LGKA 2MT5A 2DCCA 4QH6A 5TDRA 5DINA 3KX1A 2XU3A 4N79A 2ECWA 4QBBA 2HH5A 2ZETC 2G43A 3RPGC 2BDZA 2HD5A 1GECE 1QDQA 1K3BB 4A4CA 1U9XA 3U5NA 4CA1A 2YQLA 2R9OA 4Q8GA 1PIPA 2C2LA 1WEEA 2I50A 5G0FA 2PADA 3ZVZB 3SHBA 2LRIC 2YJ2A 2PNXA 2M85A 1BGOA 4R8PK 1F2AA 3KKUA 3I06A 4WA6A 4MZOA 2E00A 4X6HA 5LKXA 4NN2A 2E01A 1VJVA 5B76A 3E1ZB 4N4FA 1AECA 3S3RA 1MM2A 2E6SA 3N9PA 1ITOA 3WXFA 2E03A 4RY2A 1Y08A 1KXRA 3BC3A 4AP4A 1WE9A 4XI1A 2AUXA 3WXGA 3BCNA 2MA6A 1NLJA 3RPGB 2DC8A 1JOCA 5LKTA 3CBKA 2G8EA 2KU3A 2AYOA 3CBJA 5KH3A 2NAAA 5CVOB 2LQ6A 2MNYA 2YHNA 4O64A 1MEMA 4GNDA 1YK7A 1GMYA 1PPDA 2KWJA 3H6SA 2P0RA 4XUIA 2MD8C 4MVTA 1PBHA 1CB5A 3TNXA 2BDLA 2HDPA 1F2CA 2L43A 4V3KC 5D1KB 2F7DA 4ZUXU 3GL6A 2YJCA 3C9EA 2DCAA 1YT7A 3K9MA 5B78A 2L5UA 4L58A 1U9VA 4N8WA 2E6RA 3O35A 3P5UA 2JMIA 4WZ0A 4BBQA 1T1HA 3N4CA 3PNRA 1JM7B 1WGMA 1KFUL 2R6NA 2OZ2A 4N4ZA 2PREA 4BS6A 4YYQA 5B75A 1JM7A 2F6JA 1ZCMA 3KWBX 1THEA 4G54A 2FTDA 2XB1A 2M1RA 2KYUA 4PADA 1ME3A 1STFE 4CZWA 1TL9A 2YYRA 2KWKA 2M3HA 1S4VA 4S3OC 3HHIA 3PDFA 2B1MA 2ACTA 4X6IA 1MS6A 1PE6A 4YATA 2FO5A 1NB5A 2MNZA 4QF3A 4BPVA 2CIOA 1TLOA 1BY8A 2DJFB 2MIQA 3ASLA 4GB0A 1EWMA 1SNKA 1X4JA 3H89A 4B7YC 4W5CA 4BQVA 4FK5A 1IWDA 2QICA 3HTKC 2PUYA 2ECGA 3K24A 3HCSA 2AVWA 4QRGA 2LV9A 4QRVA 4PI3A 4AXMA 4I7BA 2P86A 3N3KA 3LQJA 4YADA 4MSXA 2HXZA 3M62A 5H9MA 3KQIA 5C13A 1AYUA 4AVXA 4Q6FA 2K17A 2HYED 4GNEA 2YJ9A 2MA5A 5EYAF 4LKAA 3C6WA 4CDDB 4S3OB 5TDWA 4OELA 1PXVA 3HCTA 2KWOA 1U9QX 4CDEB 4WZ2A 4YC9A 2AIMA 2JMDA 2M6MA 1HUCB 3L11A 2FRAA 1X4UA 4N3WA 4X3GA 2H7JA 2OP3A 3H7DA 2CB5A 1U5IA 2AYNA 3MHSA 4PTBA 3P5VA 4FJCA 2FT2A 4YV8A 1CVZA 3D6SA 1WILA 1ICFA 3IEJA 2G45A 2AUZA 3CH2X 1MHWA 2Y6EA 2E02A 4ZDTA 5A24A 3VK6A 3ZPVE 4LK9A 4DMXA 3DF0A 2YUCA 2K4DA 2JMJA 3BPFA 5G05B 4A49A 1X4IA 4Q8HA 2YW8A 5FERA 2FYEA 2VJFB 3HWNA 3PUQA 3CH3X 4BHWA 2O6XA 4ZQLA 2VJFA 4I04A 2F6NA 3LQHA 4I05A 7PCKA 1LDJB 2R9MA 2P7UA 2JQFR 2YU4A 2ARYA 1ME4A 3U8EA 3M99A 3WXEA 2K16A 2VHSA 4R2YA 3O33A 1XWHA 3I2DA 4YBTA 1DF0A 2MD7B 5G04B 2FRQA 2VPEA 1QXPA 3HCUA 4XR7A 2ECJA 3BPMA 3N9OA 4P6EA 1WEMA 2LXPC 4FIPA 3MHHA 4I07A 2YJ8A 3O36A 3ZNIA 1U9WA 2G6DA 3SOUA 3F5VA 1G25A 2CSZA 2YSMA 2VP7A 3DPLR 5D1MB 4W4UA 3KNVA 4P5OB 3NG2A 4PPEA 2IBIA 3RVXA 3OF8A 4L7XA 1AYWA 2YSJA 5LCWB 1YK8A 5J3XA 2CKLB 3LRQA 2VPBA 2VPDA 1PPOA 1E4UA 4AXLA 1M6DA 3MTNA 4KLBA 3ERVA 1CSBB 4LJNA 9PAPA 4YYSA 3U5PA 3OISA 3KV6A 4I7CA 1WEWA 4LLBA 5CVNB 8PCHA 1U6GB 1PPNA 1DVPA 1KHQA 2KREA 2AU1A 3O70A 3LXSA 3EB6A 1CPJA 3ZUAA 3DQVR 3L1ZB 3O34A 3OVXA 5I3LA 1AU4A 3I3TA 4YVAA 3IOQA 1F29A 2KFTA 5FEYA 3P5WA 1AU0A 1CJLA 1AU2A 1CV8A 5K16A 4WZ3B 5CHTA 4CDCB 2CSYA 2DCBA 5KH7A 1NL6A 2KGIA 3T6RA 2NQAA 3QZVA 3B79A 2YHOA 4HWYA 1CTEA 2R9CA 2LN0A 1WFKA 3N3GA 4K7CA 1Y4HA 1WEQA 3OF9A 2XU1A 2YQMA 5D1LB 1AIMA 2KWNA 2YJBA 3ZTGA 3T7LA 2RI7A 1PPPA 5B79A 2RSDA 1VYXA 1JQPA 1MM3A 5B77A 1WENA 2L75A 2KE1A 1HYJA 1AU3A 2BAYA 3HD3A 1ZIVA 3NHEA 3OVZA 1YALA 2FSAA 1QMYA 4PP2E 3H8CA 2ECNA 2QIZA 2LGGA 1WEOA 2G8JA 2K1JA 3PURA 2PBHA 4PP1A 4BSQA 3V6EA 4TKPB 5C11A 3KSEA 2C2VS 4AYCB 2ECTA 2IPPB 5FB0A 3PBHA 1Q6KA 4AYCA 3O1GA 5FPWA 2LGLA 1HYIA 1Z6UA 1VD4A 1NPZA 2GFOA 2DC9A 1ZBDB 2XU4A 5AIUA 2JQGR 1N87A 2NQGA 5J94A 2AS8A 2YURA 3V43A 4CDFB 2L80A 4W5BA 2ECVA 2EGPA 1BORA 1ATKA 3RTRB 2VPGA 1LDKC 5H1VA 1KHPA 4LADB 1Z60A 5F02A 3ZYQA 4MZSA 5TRBA 3QT4A 5FB1A 1FP0A 1BQIA 4UP5A 5EF4A 5JA7A 2DC6A 1BP4A 1O0EA 3K8UA 3LQIA 4YABA 2Y43A 2H0DB 3QJ3A 3N9LA 5CHVA 4GNFA 2H0DA 1WIMA 2FUUA 3ZVYA 2FUDA 1MEGA 3IV2A 2PNSA 3F75A 2WBFX 2QJ0A 3LFYA 5TABA 4F52B 2IDAA 1DEUA 3IHPA 2LXHC 2G7YA 2LGVA 2NQDB 3AI8A 5EGWA 4C9ZA 2NQIA 1EWOA 4YBSA 2F42A 5DKAA 3KV5A 2XEUA 4IC3A 2DCDA 2VHFA 3MORA 5KH9A 2EODA 1KFXL 2KGGA 1YVBA 3IUTA
chains in the Genus database with same CATH superfamily
4QRXA 2Y1MA 4B86C 1F62A 3QSDA 1PCIA 3P5XA 2CKLA 2MKEA 1X9YA 2JRIA 1XKGA 1A6RA 4P6GA 3U5OA 2DZYA 3BOWA 2Y5BA 4X6JA 4FO9A 3GV4A 4YBMA 3M63A 1QOLA 2GHUA 3BWKA 1WESA 3PHUA 5H1UA 3PSEA 4QF2A 3E2DA 4YYRA 2CT2A 2YREA 2OULA 2KKYA 4YYWA 1PADA 3PHXA 2R9NA 4IC2A 5JZEA 1FH0A 3IMAA 4I7DA 2OXQC 2L0BA 1AYVA 4A5UA 2MUMA 2AN6A 1NQCA 4YYVA 2LDRA 4V3LC 2D8SA 2EXUA 4OGCA 4A4BA 1EF7A 1POPA 5JG6A 2UZGA 1RMDA 3FL2A 1MDWA 2FUIA 4UI9B 4CCGX 1CS8A 3USVA 3N9MA 3SOWA 3KFQA 3C5KA 2L7PA 3RVWA 3KWZA 5LKZA 1GLOA 1WEPA 1WEUA 1F2BA 1PVJA 2ATOA 2XU5A 4OEMA 3L1XA 3SOXA 4DMYA 3BB7A 2VNFA 4GNGA 2Y1NA 2DX8A 1Z2QA 2FQ9A 3S3QA 2CRWA 4YYUA 4YAXA 1IYMA 1GCBA 1V87A 5PADA 1WEVA 2C0YA 2DZZA 3PHDA 3N9QA 1EWPA 1K2FA 4UP0A 4BS5A 3O0UA 1EWLA 2CRRA 2EGMA 2JRJA 3N9NA 1MIRA 2B1NA 2R9FA 3HHAA 2CSVA 2YT5A 2EA6A 3O37A 3ZPV1 2G6QA 5LKUA 5B8DA 3V6CA 2VJEB 1FBVA 4A0CD 4AUQB 3RVVA 2LAUA 3Q1DA 4QQ4A 5TBNA 2KR4A 2VJEA 2DJGB 3GCBA 3H8BA 4MM3B 3KW9A 3EB5A 4R7EA 1CHCA 6PADA 5JH3A 2DC7A 2HHNA 3O7AA 1CQDA 1SP4B 5CVMA 2F1GA 2KIZA 1TU6A 1VSNA 2ECIA 1VFYA 3PW3A 5AITA 1NB3A 3PHWA 5H1TA 3U5MA 2LGKA 2MT5A 2DCCA 4ZTBA 4QH6A 5TDRA 5DINA 2XOYA 3O47A 5SVIB 3KX1A 2XU3A 4N79A 2ECWA 5SVIA 4QBBA 2HH5A 2ZETC 2G43A 3RPGC 2BDZA 2HD5A 1UKFA 1GECE 1QDQA 1K3BB 4A4CA 1U9XA 3U5NA 4CA1A 2YQLA 3LVQE 2R9OA 4Q8GA 2RR4A 1PIPA 2C2LA 2FE8A 1WEEA 2I50A 5G0FA 2PADA 3ZVZB 4D8EA 3SHBA 2LRIC 2YJ2A 2PNXA 3BY4A 2M85A 1BGOA 4R8PK 1F2AA 3KKUA 3I06A 4WA6A 4MZOA 2E00A 4X6HA 5LKXA 4NN2A 2E01A 1VJVA 5B76A 3E1ZB 4N4FA 1AECA 3S3RA 4BOZA 1MM2A 2E6SA 3N9PA 1ITOA 3WXFA 2E03A 4RY2A 1Y08A 5K3QA 1KXRA 3BC3A 4AP4A 1WE9A 4XI1A 2AUXA 4RNAA 3BCNA 2MA6A 3WXGA 3ZNHA 2BTWA 1NLJA 2AGAA 3RPGB 2DC8A 3PRPA 4P16A 1JOCA 5LKTA 4BOPA 3CBKA 2G8EA 2KU3A 2AYOA 3CBJA 5KH3A 2NAAA 5SVYA 5CVOB 4F1PA 2LQ6A 5E6JA 2MNYA 2YHNA 4O64A 1MEMA 2BU3A 4GNDA 1YK7A 3T9KA 1GMYA 1PPDA 2KWJA 3H6SA 2P0RA 4XUIA 2MD8C 4MVTA 2Z84A 1PBHA 1CB5A 3TNXA 2BDLA 2HDPA 3TRKA 1F2CA 2L43A 4V3KC 5D1KB 2F7DA 4ZUXU 3GL6A 2YJCA 3C9EA 2DCAA 3IFUA 1YT7A 3K9MA 5B78A 4BOQA 2L5UA 4L58A 3MJ5A 1U9VA 4N8WA 2E6RA 3O35A 3P5UA 2JMIA 3DWDA 4WZ0A 4BBQA 1T1HA 3N4CA 3PNRA 4PT5A 1JM7B 1WGMA 1KFUL 2R6NA 2OZ2A 4N4ZA 2PREA 4BS6A 4YYQA 5B75A 1JM7A 2YVRA 2F6JA 1ZCMA 3KWBX 1THEA 4WURA 4G54A 2FTDA 3RNVA 2XB1A 2M1RA 2KYUA 4PADA 1ME3A 1STFE 4Z0OA 2KKXA 4CZWA 1TL9A 2YYRA 2KWKA 2M3HA 1S4VA 4S3OC 3HHIA 3PDFA 2B1MA 2ACTA 4X6IA 3FANA 1MS6A 1PE6A 4RF1A 4YATA 2FO5A 1NB5A 2MNZA 4QF3A 4BPVA 3SUBA 2CIOA 1TLOA 1BY8A 2DJFB 2XOCA 2MIQA 3ASLA 4GB0A 1EWMA 1SNKA 4OW0A 1X4JA 3H89A 4RKXA 4B7YC 2DJAA 3LJUX 2HWKA 4M0WA 4W5CA 4FK5A 4BQVA 1IWDA 2QICA 3HTKC 2PUYA 2FD4A 2ECGA 3K24A 3HCSA 5EZQA 2AVWA 4QRGA 2LV9A 4MI7A 4QRVA 4PI3A 4AXMA 4I7BA 2P86A 3N3KA 3LQJA 2JM3A 4YADA 3MDBC 4MSXA 2HXZA 3M62A 5H9MA 3KQIA 5SVXA 5C13A 1AYUA 4OGEA 4Q6FA 4AVXA 2K17A 2HYED 4GNEA 3PT2A 2YJ9A 2MA5A 5EYAF 4LKAA 3C6WA 4CDDB 4S3OB 5TDWA 4OELA 1PXVA 3HCTA 2KWOA 1U9QX 3DDTA 4CDEB 4WZ2A 4YC9A 2AIMA 2JMDA 2M6MA 1HUCB 3L11A 2FRAA 2J7QC 1X4UA 4N3WA 4X3GA 2H7JA 2OP3A 3H7DA 2CB5A 1U5IA 2AYNA 3MHSA 4PTBA 3P5VA 4FJCA 2FT2A 4YV8A 1CVZA 3D6SA 1WILA 1ICFA 3IEJA 2G45A 2AUZA 3CH2X 4OVZB 1MHWA 2Y6EA 2E02A 4ZDTA 5A24A 3VK6A 3ZPVE 4LK9A 4DMXA 3DF0A 2YUCA 2K4DA 2JMJA 3BPFA 5G05B 4A49A 1X4IA 3MP2A 4Q8HA 2YW8A 5FERA 2FYEA 2VJFB 3HWNA 3PUQA 3CH3X 4BHWA 2O6XA 4ZQLA 2VJFA 4I04A 4R3DA 2F6NA 2JUNA 3LQHA 4I05A 3FM8C 1LDJB 1YZBA 7PCKA 2R9MA 2P7UA 2JQFR 2YU4A 2ARYA 1ME4A 3U8EA 2DSMA 3M99A 4D8IA 3WXEA 2K16A 2VHSA 4R2YA 3O33A 1XWHA 3I2DA 4YBTA 1DF0A 2MD7B 5G04B 2FRQA 2VPEA 1QXPA 3HCUA 4XR7A 2ECJA 3BPMA 3N9OA 4P6EA 1WEMA 4FIPA 2LXPC 2OWAA 3MHHA 3FEHA 4I07A 2YJ8A 3O36A 3ZNIA 1U9WA 2G6DA 3SOUA 4GUAA 4O62A 3F5VA 1G25A 2CSZA 2YSMA 4BOUA 2VP7A 3DPLR 5D1MB 4W4UA 2XOZA 3C0RA 3KNVA 4P5OB 3NG2A 4PPEA 2IBIA 3RVXA 3OF8A 4L7XA 1AYWA 2YSJA 5LCWB 1YK8A 5J3XA 2CKLB 2D8UA 3LRQA 2VPBA 3OQCA 3H7HA 2VPDA 1PPOA 1E4UA 4AXLA 3E9SA 2B0OE 1M6DA 3MTNA 4KLBA 3ERVA 1CSBB 4LJNA 9PAPA 4YYSA 3U5PA 3OISA 3KV6A 3PLWA 4I7CA 1WEWA 4LLBA 5CVNB 8PCHA 1U6GB 1PPNA 1DVPA 1DKIA 1KHQA 2KREA 2AU1A 2DOSA 3O70A 3LXSA 3EB6A 2XP0A 1CPJA 3ZUAA 3DQVR 3L1ZB 3O34A 3OVXA 5I3LA 1AU4A 3I3TA 4YVAA 3IOQA 2FFWA 3LVRE 1F29A 2KFTA 3FAOA 5FEYA 4REZA 3P5WA 1AU0A 1CJLA 1AU2A 4RF0A 1CV8A 5K16A 4WZ3B 5CHTA 4D8BA 4CDCB 2CSYA 2DCBA 5KH7A 1NL6A 2KGIA 3T6RA 2NQAA 3FJUB 3QZVA 3B79A 2YHOA 4HWYA 1CTEA 2R9CA 2LN0A 2UZJA 1WFKA 3N3GA 4K7CA 4HXDB 1Y4HA 1WEQA 3OF9A 2XU1A 2YQMA 5D1LB 1AIMA 2KWNA 2YJBA 3ZTGA 3T7LA 5KO3A 2RI7A 1PPPA 5B79A 4BOSA 2RSDA 1VYXA 1JQPA 3B21A 3PRMA 1MM3A 3O65A 4H9DA 5B77A 1WENA 2L75A 2KE1A 1HYJA 1MBMA 2BAYA 1AU3A 1ZIVA 3HD3A 3NHEA 1YALA 3BBAA 2FSAA 3OVZA 4IP3A 1QMYA 4PP2E 3H8CA 2ECNA 2QIZA 2LGGA 1WEOA 2G8JA 2K1JA 3PURA 2PBHA 4PP1A 4Z0RA 3KDEC 2M13A 4BSQA 3W31A 3V6EA 4TKPB 5C11A 2IQJA 2C2VS 3KSEA 4AYCB 2ECTA 4OVZA 3W30A 2IPPB 5FB0A 3PBHA 1Q6KA 4AYCA 3O1GA 5FPWA 2LGLA 1HYIA 2CONA 1Z6UA 1VD4A 1NPZA 2GFOA 3M7KA 1ZBDB 2DC9A 2XU4A 4XZXA 5AIUA 2JQGR 1N87A 2NQGA 5J94A 2AS8A 2YURA 3V43A 4CDFB 2L80A 4W5BA 2ECVA 2EGPA 3TMPA 1BORA 1ATKA 2P57A 3RTRB 2VPGA 1LDKC 5H1VA 1KHPA 2JTCA 4LADB 1Z60A 5F02A 3ZYQA 4MZSA 5TRBA 3QT4A 5FB1A 1FP0A 1BQIA 4UP5A 2J7QA 5EF4A 3LDYA 5JA7A 2DC6A 1BP4A 1O0EA 3K8UA 3LQIA 4YABA 2Y43A 2H0DB 3QJ3A 1DCQA 3N9LA 5CHVA 4GNFA 2H0DA 4IUMA 1WIMA 2FUUA 3ZVYA 3JUEA 2FUDA 2E61A 1MEGA 3IV2A 2PNSA 3F75A 2WBFX 2QJ0A 3LFYA 5TABA 4F52B 2IDAA 1DEUA 3IHPA 2LXHC 2BTWB 2G7YA 2LGVA 5EZSA 2NQDB 3AI8A 5EGWA 4C9ZA 2NQIA 1EWOA 4YBSA 2F42A 5DKAA 3KV5A 2XEUA 4IC3A 2DCDA 2VHFA 3MORA 5KH9A 2EODA 1KFXL 2KGGA 1YVBA 3IUTA 3MTVA
chains in the Genus database with same CATH topology
4QRXA 2Y1MA 4B86C 1F62A 3QSDA 1PCIA 3P5XA 2CKLA 1X9YA 1XKGA 1A6RA 4P6GA 3U5OA 2DZYA 3BOWA 2Y5BA 4X6JA 4FO9A 3GV4A 4YBMA 3M63A 1QOLA 2GHUA 3BWKA 1WESA 5H1UA 4QF2A 2VFCA 4YYRA 2CT2A 2YREA 2OULA 4YYWA 1PADA 2R9NA 4IC2A 1FH0A 3IMAA 4I7DA 2OXQC 2L0BA 1AYVA 2MUMA 2AN6A 1NQCA 4YYVA 2LDRA 4V3LC 2D8SA 4A4BA 1EF7A 1POPA 5JG6A 2UZGA 1RMDA 3FL2A 1MDWA 2FUIA 4UI9B 4CCGX 1CS8A 3USVA 3N9MA 3SOWA 3KFQA 3C5KA 3RVWA 3KWZA 5LKZA 1GLOA 1WEPA 1WEUA 1F2BA 2ATOA 2XU5A 4OEMA 3L1XA 3SOXA 4DMYA 2VNFA 4GNGA 2Y1NA 2DX8A 1Z2QA 2FQ9A 3S3QA 4YYUA 4YAXA 1IYMA 1GCBA 1V87A 5PADA 1WEVA 2C0YA 2DZZA 3PHDA 3N9QA 1EWPA 1K2FA 4UP0A 4BS5A 3O0UA 1EWLA 3N9NA 2JRJA 3HHAA 1MIRA 2B1NA 2R9FA 3O37A 2YT5A 2EA6A 3ZPV1 2G6QA 5LKUA 5B8DA 3V6CA 2VJEB 1FBVA 4A0CD 4AUQB 3RVVA 5TBNA 2DJGB 2KR4A 2VJEA 3GCBA 3H8BA 3KW9A 3EB5A 4R7EA 1CHCA 6PADA 5JH3A 2DC7A 2HHNA 3O7AA 1CQDA 1SP4B 5CVMA 2F1GA 2KIZA 1TU6A 1VSNA 2ECIA 1VFYA 3PW3A 5AITA 1NB3A 5H1TA 3U5MA 2LGKA 2MT5A 2DCCA 4QH6A 5TDRA 5DINA 3KX1A 2XU3A 4N79A 2ECWA 4QBBA 2HH5A 2ZETC 2G43A 3RPGC 2BDZA 2HD5A 1GECE 1QDQA 1K3BB 4A4CA 3LTWA 1U9XA 3U5NA 4GUZA 4CA1A 2YQLA 2R9OA 4Q8GA 1PIPA 2C2LA 1GX3A 1WEEA 2I50A 5G0FA 2PADA 3ZVZB 3SHBA 4NV7A 2LRIC 2YJ2A 2PNXA 2M85A 1BGOA 4R8PK 1F2AA 3KKUA 3I06A 4WA6A 4MZOA 2E00A 4X6HA 5LKXA 4NN2A 2E01A 1VJVA 5B76A 3E1ZB 4N4FA 1AECA 3S3RA 1MM2A 2E6SA 3N9PA 1ITOA 3WXFA 2E03A 4RY2A 4BGFA 1Y08A 1KXRA 3BC3A 4AP4A 1WE9A 4XI1A 2AUXA 3WXGA 3BCNA 2MA6A 1W6FA 1NLJA 3RPGB 2DC8A 1JOCA 5LKTA 3CBKA 2G8EA 2KU3A 2AYOA 3CBJA 5KH3A 2NAAA 5CVOB 2LQ6A 2MNYA 2YHNA 4O64A 1MEMA 4GNDA 1YK7A 1GMYA 1PPDA 2KWJA 3H6SA 2P0RA 4XUIA 2MD8C 4MVTA 1PBHA 1CB5A 3TNXA 2BDLA 2HDPA 1E2TA 1F2CA 2L43A 4V3KC 5D1KB 2F7DA 4ZUXU 3GL6A 2YJCA 3C9EA 2DCAA 1YT7A 3K9MA 5B78A 2L5UA 4L58A 1U9VA 4N8WA 2E6RA 3O35A 3P5UA 2JMIA 4WZ0A 4BBQA 1T1HA 3N4CA 3PNRA 1JM7B 1WGMA 1KFUL 2R6NA 2OZ2A 4N4ZA 2PREA 4BS6A 4YYQA 5B75A 1JM7A 2F6JA 1ZCMA 3KWBX 1THEA 4G54A 2FTDA 2XB1A 2M1RA 2KYUA 4PADA 1ME3A 1STFE 4CZWA 1TL9A 2YYRA 2KWKA 2M3HA 1S4VA 4S3OC 3HHIA 3PDFA 2B1MA 2ACTA 4X6IA 1MS6A 1PE6A 4YATA 2FO5A 1NB5A 2MNZA 4QF3A 4BPVA 2CIOA 1TLOA 1BY8A 2DJFB 2MIQA 3ASLA 4GB0A 1EWMA 1SNKA 1X4JA 3H89A 4B7YC 4W5CA 4BQVA 4FK5A 1IWDA 2QICA 3HTKC 2PUYA 2ECGA 3K24A 3HCSA 2AVWA 4QRGA 2LV9A 4QRVA 4PI3A 4AXMA 4I7BA 2P86A 3N3KA 3LQJA 4YADA 4MSXA 2HXZA 3M62A 5H9MA 3KQIA 5C13A 1AYUA 4AVXA 4Q6FA 2K17A 4B55A 2HYED 4GNEA 2YJ9A 2MA5A 5EYAF 4LKAA 3C6WA 4CDDB 4S3OB 5TDWA 4OELA 1PXVA 3HCTA 2KWOA 1U9QX 4CDEB 4WZ2A 4YC9A 2AIMA 2JMDA 2M6MA 1HUCB 3L11A 2FRAA 1X4UA 4N3WA 4X3GA 2H7JA 2OP3A 3H7DA 2CB5A 1U5IA 2AYNA 3MHSA 4PTBA 3P5VA 4FJCA 2FT2A 4YV8A 1CVZA 3D6SA 1WILA 1ICFA 3IEJA 2G45A 2AUZA 3CH2X 1MHWA 2Y6EA 2E02A 4ZDTA 5A24A 3VK6A 3ZPVE 4LK9A 4DMXA 3DF0A 2YUCA 2K4DA 2JMJA 3BPFA 5G05B 4A49A 1X4IA 4Q8HA 2YW8A 5FERA 2FYEA 2VJFB 3HWNA 3PUQA 3CH3X 4BHWA 2O6XA 4ZQLA 2VJFA 4I04A 2F6NA 3LQHA 4I05A 7PCKA 1LDJB 2R9MA 2P7UA 2JQFR 2YU4A 2ARYA 1ME4A 3U8EA 3M99A 4NV8A 3WXEA 2K16A 2VHSA 4R2YA 3O33A 1XWHA 3I2DA 4YBTA 1DF0A 2MD7B 5G04B 2FRQA 2VPEA 1QXPA 3HCUA 4XR7A 2ECJA 3BPMA 3N9OA 4P6EA 1WEMA 2LXPC 4FIPA 3MHHA 4I07A 2YJ8A 3O36A 3ZNIA 1U9WA 2G6DA 3SOUA 3F5VA 1G25A 2CSZA 2YSMA 2VP7A 3DPLR 5D1MB 4W4UA 3KNVA 4P5OB 3NG2A 4PPEA 2IBIA 3RVXA 3OF8A 4L7XA 1AYWA 2YSJA 5LCWB 1YK8A 5J3XA 2CKLB 3LRQA 2VPBA 2VPDA 1PPOA 1E4UA 4AXLA 1M6DA 3MTNA 4KLBA 3ERVA 1CSBB 4LJNA 9PAPA 4YYSA 3U5PA 3OISA 3KV6A 4I7CA 1WEWA 4LLBA 5CVNB 8PCHA 1U6GB 1PPNA 1DVPA 1W4TA 1KHQA 2KREA 2AU1A 3O70A 3LXSA 3EB6A 1CPJA 3ZUAA 3DQVR 3L1ZB 3O34A 3OVXA 5I3LA 1AU4A 3I3TA 4YVAA 3IOQA 1F29A 2KFTA 5FEYA 3P5WA 1AU0A 1CJLA 1AU2A 1CV8A 5K16A 4WZ3B 5CHTA 4CDCB 2CSYA 2DCBA 5KH7A 1NL6A 2KGIA 3T6RA 2NQAA 3QZVA 3B79A 3D9WA 2YHOA 4HWYA 1CTEA 2R9CA 2LN0A 1WFKA 3N3GA 4K7CA 1Y4HA 1WEQA 3OF9A 2XU1A 2YQMA 5D1LB 1AIMA 2KWNA 2YJBA 3ZTGA 3T7LA 2RI7A 1PPPA 5B79A 2RSDA 1VYXA 1JQPA 1MM3A 5B77A 1WENA 2L75A 2KE1A 1HYJA 1AU3A 2BAYA 3HD3A 1ZIVA 3NHEA 3OVZA 1YALA 2FSAA 1QMYA 4PP2E 3H8CA 2ECNA 2QIZA 2LGGA 1WEOA 2G8JA 2K1JA 3PURA 2PBHA 4PP1A 4BSQA 3V6EA 4TKPB 5C11A 3KSEA 2C2VS 4AYCB 2ECTA 2IPPB 5FB0A 3PBHA 1Q6KA 4AYCA 3O1GA 5FPWA 2LGLA 1HYIA 1Z6UA 1VD4A 1NPZA 2GFOA 2DC9A 1ZBDB 2XU4A 5AIUA 2JQGR 1N87A 2NQGA 5J94A 2AS8A 2YURA 3V43A 4C5PA 4CDFB 2L80A 2BSZA 4W5BA 2ECVA 2EGPA 1BORA 1ATKA 3RTRB 2VPGA 1LDKC 5H1VA 1KHPA 4LADB 1Z60A 5F02A 3ZYQA 4MZSA 1W5RA 5TRBA 3QT4A 5FB1A 1FP0A 1BQIA 4UP5A 5EF4A 5JA7A 2DC6A 1BP4A 1O0EA 3K8UA 3LQIA 4YABA 2Y43A 2H0DB 3QJ3A 3N9LA 5CHVA 4GNFA 2H0DA 1WIMA 2FUUA 3ZVYA 2FUDA 1MEGA 3IV2A 2PNSA 3F75A 2WBFX 2QJ0A 3LFYA 5TABA 4F52B 2IDAA 2VFBA 1DEUA 3IHPA 2LXHC 2G7YA 2LGVA 2NQDB 3AI8A 5EGWA 4C9ZA 2NQIA 1EWOA 4YBSA 2F42A 5DKAA 3KV5A 2XEUA 4IC3A 2DCDA 2VHFA 3MORA 5KH9A 2EODA 1KFXL 2KGGA 1YVBA 3IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRX A;  2Y1M A;  4B86 C;  1F62 A;  3QSD A;  1PCI A;  3P5X A;  2CKL A;  1X9Y A;  1XKG A;  1A6R A;  4P6G A;  3U5O A;  2DZY A;  3BOW A;  2Y5B A;  4X6J A;  4FO9 A;  3GV4 A;  4YBM A;  3M63 A;  1QOL A;  2GHU A;  3BWK A;  1WES A;  5H1U A;  4QF2 A;  4YYR A;  2CT2 A;  2YRE A;  2OUL A;  4YYW A;  1PAD A;  2R9N A;  4IC2 A;  1FH0 A;  3IMA A;  4I7D A;  2OXQ C;  2L0B A;  1AYV A;  2MUM A;  2AN6 A;  1NQC A;  4YYV A;  2LDR A;  4V3L C;  2D8S A;  4A4B A;  1EF7 A;  1POP A;  5JG6 A;  2UZG A;  1RMD A;  3FL2 A;  1MDW A;  2FUI A;  4UI9 B;  4CCG X;  1CS8 A;  3USV A;  3N9M A;  3SOW A;  3KFQ A;  3C5K A;  3RVW A;  3KWZ A;  5LKZ A;  1GLO A;  1WEP A;  1WEU A;  1F2B A;  2ATO A;  2XU5 A;  4OEM A;  3L1X A;  3SOX A;  4DMY A;  2VNF A;  4GNG A;  2Y1N A;  2DX8 A;  1Z2Q A;  2FQ9 A;  3S3Q A;  4YYU A;  4YAX A;  1IYM A;  1GCB A;  1V87 A;  5PAD A;  1WEV A;  2C0Y A;  2DZZ A;  3PHD A;  3N9Q A;  1EWP A;  1K2F A;  4UP0 A;  4BS5 A;  3O0U A;  1EWL A;  3N9N A;  2JRJ A;  3HHA A;  1MIR A;  2B1N A;  2R9F A;  3O37 A;  2YT5 A;  2EA6 A;  3ZPV 1;  2G6Q A;  5LKU A;  5B8D A;  3V6C A;  2VJE B;  1FBV A;  4A0C D;  4AUQ B;  3RVV A;  5TBN A;  2DJG B;  2KR4 A;  2VJE A;  3GCB A;  3H8B A;  3KW9 A;  3EB5 A;  4R7E A;  1CHC A;  6PAD A;  5JH3 A;  2DC7 A;  2HHN A;  3O7A A;  1CQD A;  1SP4 B;  5CVM A;  2F1G A;  2KIZ A;  1TU6 A;  1VSN A;  2ECI A;  1VFY A;  3PW3 A;  5AIT A;  1NB3 A;  5H1T A;  3U5M A;  2LGK A;  2MT5 A;  2DCC A;  4QH6 A;  5TDR A;  5DIN A;  3KX1 A;  2XU3 A;  4N79 A;  2ECW A;  4QBB A;  2HH5 A;  2ZET C;  2G43 A;  3RPG C;  2BDZ A;  2HD5 A;  1GEC E;  1QDQ A;  1K3B B;  4A4C A;  1U9X A;  3U5N A;  4CA1 A;  2YQL A;  2R9O A;  4Q8G A;  1PIP A;  2C2L A;  1WEE A;  2I50 A;  5G0F A;  2PAD A;  3ZVZ B;  3SHB A;  2LRI C;  2YJ2 A;  2PNX A;  2M85 A;  1BGO A;  4R8P K;  1F2A A;  3KKU A;  3I06 A;  4WA6 A;  4MZO A;  2E00 A;  4X6H A;  5LKX A;  4NN2 A;  2E01 A;  1VJV A;  5B76 A;  3E1Z B;  4N4F A;  1AEC A;  3S3R A;  1MM2 A;  2E6S A;  3N9P A;  1ITO A;  3WXF A;  2E03 A;  4RY2 A;  1Y08 A;  1KXR A;  3BC3 A;  4AP4 A;  1WE9 A;  4XI1 A;  2AUX A;  3WXG A;  3BCN A;  2MA6 A;  1NLJ A;  3RPG B;  2DC8 A;  1JOC A;  5LKT A;  3CBK A;  2G8E A;  2KU3 A;  2AYO A;  3CBJ A;  5KH3 A;  2NAA A;  5CVO B;  2LQ6 A;  2MNY A;  2YHN A;  4O64 A;  1MEM A;  4GND A;  1YK7 A;  1GMY A;  1PPD A;  2KWJ A;  3H6S A;  2P0R A;  4XUI A;  2MD8 C;  4MVT A;  1PBH A;  1CB5 A;  3TNX A;  2BDL A;  2HDP A;  1F2C A;  2L43 A;  4V3K C;  5D1K B;  2F7D A;  4ZUX U;  3GL6 A;  2YJC A;  3C9E A;  2DCA A;  1YT7 A;  3K9M A;  5B78 A;  2L5U A;  4L58 A;  1U9V A;  4N8W A;  2E6R A;  3O35 A;  3P5U A;  2JMI A;  4WZ0 A;  4BBQ A;  1T1H A;  3N4C A;  3PNR A;  1JM7 B;  1WGM A;  1KFU L;  2R6N A;  2OZ2 A;  4N4Z A;  2PRE A;  4BS6 A;  4YYQ A;  5B75 A;  1JM7 A;  2F6J A;  1ZCM A;  3KWB X;  1THE A;  4G54 A;  2FTD A;  2XB1 A;  2M1R A;  2KYU A;  4PAD A;  1ME3 A;  1STF E;  4CZW A;  1TL9 A;  2YYR A;  2KWK A;  2M3H A;  1S4V A;  4S3O C;  3HHI A;  3PDF A;  2B1M A;  2ACT A;  4X6I A;  1MS6 A;  1PE6 A;  4YAT A;  2FO5 A;  1NB5 A;  2MNZ A;  4QF3 A;  4BPV A;  2CIO A;  1TLO A;  1BY8 A;  2DJF B;  2MIQ A;  3ASL A;  4GB0 A;  1EWM A;  1SNK A;  1X4J A;  3H89 A;  4B7Y C;  4W5C A;  4BQV A;  4FK5 A;  1IWD A;  2QIC A;  3HTK C;  2PUY A;  2ECG A;  3K24 A;  3HCS A;  2AVW A;  4QRG A;  2LV9 A;  4QRV A;  4PI3 A;  4AXM A;  4I7B A;  2P86 A;  3N3K A;  3LQJ A;  4YAD A;  4MSX A;  2HXZ A;  3M62 A;  5H9M A;  3KQI A;  5C13 A;  1AYU A;  4AVX A;  4Q6F A;  2K17 A;  2HYE D;  4GNE A;  2YJ9 A;  2MA5 A;  5EYA F;  4LKA A;  3C6W A;  4CDD B;  4S3O B;  5TDW A;  4OEL A;  1PXV A;  3HCT A;  2KWO A;  1U9Q X;  4CDE B;  4WZ2 A;  4YC9 A;  2AIM A;  2JMD A;  2M6M A;  1HUC B;  3L11 A;  2FRA A;  1X4U A;  4N3W A;  4X3G A;  2H7J A;  2OP3 A;  3H7D A;  2CB5 A;  1U5I A;  2AYN A;  3MHS A;  4PTB A;  3P5V A;  4FJC A;  2FT2 A;  4YV8 A;  1CVZ A;  3D6S A;  1WIL A;  1ICF A;  3IEJ A;  2G45 A;  2AUZ A;  3CH2 X;  1MHW A;  2Y6E A;  2E02 A;  4ZDT A;  5A24 A;  3VK6 A;  3ZPV E;  4LK9 A;  4DMX A;  3DF0 A;  2YUC A;  2K4D A;  2JMJ A;  3BPF A;  5G05 B;  4A49 A;  1X4I A;  4Q8H A;  2YW8 A;  5FER A;  2FYE A;  2VJF B;  3HWN A;  3PUQ A;  3CH3 X;  4BHW A;  2O6X A;  4ZQL A;  2VJF A;  4I04 A;  2F6N A;  3LQH A;  4I05 A;  7PCK A;  1LDJ B;  2R9M A;  2P7U A;  2JQF R;  2YU4 A;  2ARY A;  1ME4 A;  3U8E A;  3M99 A;  3WXE A;  2K16 A;  2VHS A;  4R2Y A;  3O33 A;  1XWH A;  3I2D A;  4YBT A;  1DF0 A;  2MD7 B;  5G04 B;  2FRQ A;  2VPE A;  1QXP A;  3HCU A;  4XR7 A;  2ECJ A;  3BPM A;  3N9O A;  4P6E A;  1WEM A;  2LXP C;  4FIP A;  3MHH A;  4I07 A;  2YJ8 A;  3O36 A;  3ZNI A;  1U9W A;  2G6D A;  3SOU A;  3F5V A;  1G25 A;  2CSZ A;  2YSM A;  2VP7 A;  3DPL R;  5D1M B;  4W4U A;  3KNV A;  4P5O B;  3NG2 A;  4PPE A;  2IBI A;  3RVX A;  3OF8 A;  4L7X A;  1AYW A;  2YSJ A;  5LCW B;  1YK8 A;  5J3X A;  2CKL B;  3LRQ A;  2VPB A;  2VPD A;  1PPO A;  1E4U A;  4AXL A;  1M6D A;  3MTN A;  4KLB A;  3ERV A;  1CSB B;  4LJN A;  9PAP A;  4YYS A;  3U5P A;  3OIS A;  3KV6 A;  4I7C A;  1WEW A;  4LLB A;  5CVN B;  8PCH A;  1U6G B;  1PPN A;  1DVP A;  1KHQ A;  2KRE A;  2AU1 A;  3O70 A;  3LXS A;  3EB6 A;  1CPJ A;  3ZUA A;  3DQV R;  3L1Z B;  3O34 A;  3OVX A;  5I3L A;  1AU4 A;  3I3T A;  4YVA A;  3IOQ A;  1F29 A;  2KFT A;  5FEY A;  3P5W A;  1AU0 A;  1CJL A;  1AU2 A;  1CV8 A;  5K16 A;  4WZ3 B;  5CHT A;  4CDC B;  2CSY A;  2DCB A;  5KH7 A;  1NL6 A;  2KGI A;  3T6R A;  2NQA A;  3QZV A;  3B79 A;  2YHO A;  4HWY A;  1CTE A;  2R9C A;  2LN0 A;  1WFK A;  3N3G A;  4K7C A;  1Y4H A;  1WEQ A;  3OF9 A;  2XU1 A;  2YQM A;  5D1L B;  1AIM A;  2KWN A;  2YJB A;  3ZTG A;  3T7L A;  2RI7 A;  1PPP A;  5B79 A;  2RSD A;  1VYX A;  1JQP A;  1MM3 A;  5B77 A;  1WEN A;  2L75 A;  2KE1 A;  1HYJ A;  1AU3 A;  2BAY A;  3HD3 A;  1ZIV A;  3NHE A;  3OVZ A;  1YAL A;  2FSA A;  1QMY A;  4PP2 E;  3H8C A;  2ECN A;  2QIZ A;  2LGG A;  1WEO A;  2G8J A;  2K1J A;  3PUR A;  2PBH A;  4PP1 A;  4BSQ A;  3V6E A;  4TKP B;  5C11 A;  3KSE A;  2C2V S;  4AYC B;  2ECT A;  2IPP B;  5FB0 A;  3PBH A;  1Q6K A;  4AYC A;  3O1G A;  5FPW A;  2LGL A;  1HYI A;  1Z6U A;  1VD4 A;  1NPZ A;  2GFO A;  2DC9 A;  1ZBD B;  2XU4 A;  5AIU A;  2JQG R;  1N87 A;  2NQG A;  5J94 A;  2AS8 A;  2YUR A;  3V43 A;  4CDF B;  2L80 A;  4W5B A;  2ECV A;  2EGP A;  1BOR A;  1ATK A;  3RTR B;  2VPG A;  1LDK C;  5H1V A;  1KHP A;  4LAD B;  1Z60 A;  5F02 A;  3ZYQ A;  4MZS A;  5TRB A;  3QT4 A;  5FB1 A;  1FP0 A;  1BQI A;  4UP5 A;  5EF4 A;  5JA7 A;  2DC6 A;  1BP4 A;  1O0E A;  3K8U A;  3LQI A;  4YAB A;  2Y43 A;  2H0D B;  3QJ3 A;  3N9L A;  5CHV A;  4GNF A;  2H0D A;  1WIM A;  2FUU A;  3ZVY A;  2FUD A;  1MEG A;  3IV2 A;  2PNS A;  3F75 A;  2WBF X;  2QJ0 A;  3LFY A;  5TAB A;  4F52 B;  2IDA A;  1DEU A;  3IHP A;  2LXH C;  2G7Y A;  2LGV A;  2NQD B;  3AI8 A;  5EGW A;  4C9Z A;  2NQI A;  1EWO A;  4YBS A;  2F42 A;  5DKA A;  3KV5 A;  2XEU A;  4IC3 A;  2DCD A;  2VHF A;  3MOR A;  5KH9 A;  2EOD A;  1KFX L;  2KGG A;  1YVB A;  3IUT A; 
#chains in the Genus database with same CATH topology
 4QRX A;  2Y1M A;  4B86 C;  1F62 A;  3QSD A;  1PCI A;  3P5X A;  2CKL A;  2MKE A;  1X9Y A;  2JRI A;  1XKG A;  1A6R A;  4P6G A;  3U5O A;  2DZY A;  3BOW A;  2Y5B A;  4X6J A;  4FO9 A;  3GV4 A;  4YBM A;  3M63 A;  1QOL A;  2GHU A;  3BWK A;  1WES A;  3PHU A;  5H1U A;  3PSE A;  4QF2 A;  3E2D A;  4YYR A;  2CT2 A;  2YRE A;  2OUL A;  2KKY A;  4YYW A;  1PAD A;  3PHX A;  2R9N A;  4IC2 A;  5JZE A;  1FH0 A;  3IMA A;  4I7D A;  2OXQ C;  2L0B A;  1AYV A;  4A5U A;  2MUM A;  2AN6 A;  1NQC A;  4YYV A;  2LDR A;  4V3L C;  2D8S A;  2EXU A;  4OGC A;  4A4B A;  1EF7 A;  1POP A;  5JG6 A;  2UZG A;  1RMD A;  3FL2 A;  1MDW A;  2FUI A;  4UI9 B;  4CCG X;  1CS8 A;  3USV A;  3N9M A;  3SOW A;  3KFQ A;  3C5K A;  2L7P A;  3RVW A;  3KWZ A;  5LKZ A;  1GLO A;  1WEP A;  1WEU A;  1F2B A;  1PVJ A;  2ATO A;  2XU5 A;  4OEM A;  3L1X A;  3SOX A;  4DMY A;  3BB7 A;  2VNF A;  4GNG A;  2Y1N A;  2DX8 A;  1Z2Q A;  2FQ9 A;  3S3Q A;  2CRW A;  4YYU A;  4YAX A;  1IYM A;  1GCB A;  1V87 A;  5PAD A;  1WEV A;  2C0Y A;  2DZZ A;  3PHD A;  3N9Q A;  1EWP A;  1K2F A;  4UP0 A;  4BS5 A;  3O0U A;  1EWL A;  2CRR A;  2EGM A;  2JRJ A;  3N9N A;  1MIR A;  2B1N A;  2R9F A;  3HHA A;  2CSV A;  2YT5 A;  2EA6 A;  3O37 A;  3ZPV 1;  2G6Q A;  5LKU A;  5B8D A;  3V6C A;  2VJE B;  1FBV A;  4A0C D;  4AUQ B;  3RVV A;  2LAU A;  3Q1D A;  4QQ4 A;  5TBN A;  2KR4 A;  2VJE A;  2DJG B;  3GCB A;  3H8B A;  4MM3 B;  3KW9 A;  3EB5 A;  4R7E A;  1CHC A;  6PAD A;  5JH3 A;  2DC7 A;  2HHN A;  3O7A A;  1CQD A;  1SP4 B;  5CVM A;  2F1G A;  2KIZ A;  1TU6 A;  1VSN A;  2ECI A;  1VFY A;  3PW3 A;  5AIT A;  1NB3 A;  3PHW A;  5H1T A;  3U5M A;  2LGK A;  2MT5 A;  2DCC A;  4ZTB A;  4QH6 A;  5TDR A;  5DIN A;  2XOY A;  3O47 A;  5SVI B;  3KX1 A;  2XU3 A;  4N79 A;  2ECW A;  5SVI A;  4QBB A;  2HH5 A;  2ZET C;  2G43 A;  3RPG C;  2BDZ A;  2HD5 A;  1UKF A;  1GEC E;  1QDQ A;  1K3B B;  4A4C A;  1U9X A;  3U5N A;  4CA1 A;  2YQL A;  3LVQ E;  2R9O A;  4Q8G A;  2RR4 A;  1PIP A;  2C2L A;  2FE8 A;  1WEE A;  2I50 A;  5G0F A;  2PAD A;  3ZVZ B;  4D8E A;  3SHB A;  2LRI C;  2YJ2 A;  2PNX A;  3BY4 A;  2M85 A;  1BGO A;  4R8P K;  1F2A A;  3KKU A;  3I06 A;  4WA6 A;  4MZO A;  2E00 A;  4X6H A;  5LKX A;  4NN2 A;  2E01 A;  1VJV A;  5B76 A;  3E1Z B;  4N4F A;  1AEC A;  3S3R A;  4BOZ A;  1MM2 A;  2E6S A;  3N9P A;  1ITO A;  3WXF A;  2E03 A;  4RY2 A;  1Y08 A;  5K3Q A;  1KXR A;  3BC3 A;  4AP4 A;  1WE9 A;  4XI1 A;  2AUX A;  4RNA A;  3BCN A;  2MA6 A;  3WXG A;  3ZNH A;  2BTW A;  1NLJ A;  2AGA A;  3RPG B;  2DC8 A;  3PRP A;  4P16 A;  1JOC A;  5LKT A;  4BOP A;  3CBK A;  2G8E A;  2KU3 A;  2AYO A;  3CBJ A;  5KH3 A;  2NAA A;  5SVY A;  5CVO B;  4F1P A;  2LQ6 A;  5E6J A;  2MNY A;  2YHN A;  4O64 A;  1MEM A;  2BU3 A;  4GND A;  1YK7 A;  3T9K A;  1GMY A;  1PPD A;  2KWJ A;  3H6S A;  2P0R A;  4XUI A;  2MD8 C;  4MVT A;  2Z84 A;  1PBH A;  1CB5 A;  3TNX A;  2BDL A;  2HDP A;  3TRK A;  1F2C A;  2L43 A;  4V3K C;  5D1K B;  2F7D A;  4ZUX U;  3GL6 A;  2YJC A;  3C9E A;  2DCA A;  3IFU A;  1YT7 A;  3K9M A;  5B78 A;  4BOQ A;  2L5U A;  4L58 A;  3MJ5 A;  1U9V A;  4N8W A;  2E6R A;  3O35 A;  3P5U A;  2JMI A;  3DWD A;  4WZ0 A;  4BBQ A;  1T1H A;  3N4C A;  3PNR A;  4PT5 A;  1JM7 B;  1WGM A;  1KFU L;  2R6N A;  2OZ2 A;  4N4Z A;  2PRE A;  4BS6 A;  4YYQ A;  5B75 A;  1JM7 A;  2YVR A;  2F6J A;  1ZCM A;  3KWB X;  1THE A;  4WUR A;  4G54 A;  2FTD A;  3RNV A;  2XB1 A;  2M1R A;  2KYU A;  4PAD A;  1ME3 A;  1STF E;  4Z0O A;  2KKX A;  4CZW A;  1TL9 A;  2YYR A;  2KWK A;  2M3H A;  1S4V A;  4S3O C;  3HHI A;  3PDF A;  2B1M A;  2ACT A;  4X6I A;  3FAN A;  1MS6 A;  1PE6 A;  4RF1 A;  4YAT A;  2FO5 A;  1NB5 A;  2MNZ A;  4QF3 A;  4BPV A;  3SUB A;  2CIO A;  1TLO A;  1BY8 A;  2DJF B;  2XOC A;  2MIQ A;  3ASL A;  4GB0 A;  1EWM A;  1SNK A;  4OW0 A;  1X4J A;  3H89 A;  4RKX A;  4B7Y C;  2DJA A;  3LJU X;  2HWK A;  4M0W A;  4W5C A;  4FK5 A;  4BQV A;  1IWD A;  2QIC A;  3HTK C;  2PUY A;  2FD4 A;  2ECG A;  3K24 A;  3HCS A;  5EZQ A;  2AVW A;  4QRG A;  2LV9 A;  4MI7 A;  4QRV A;  4PI3 A;  4AXM A;  4I7B A;  2P86 A;  3N3K A;  3LQJ A;  2JM3 A;  4YAD A;  3MDB C;  4MSX A;  2HXZ A;  3M62 A;  5H9M A;  3KQI A;  5SVX A;  5C13 A;  1AYU A;  4OGE A;  4Q6F A;  4AVX A;  2K17 A;  2HYE D;  4GNE A;  3PT2 A;  2YJ9 A;  2MA5 A;  5EYA F;  4LKA A;  3C6W A;  4CDD B;  4S3O B;  5TDW A;  4OEL A;  1PXV A;  3HCT A;  2KWO A;  1U9Q X;  3DDT A;  4CDE B;  4WZ2 A;  4YC9 A;  2AIM A;  2JMD A;  2M6M A;  1HUC B;  3L11 A;  2FRA A;  2J7Q C;  1X4U A;  4N3W A;  4X3G A;  2H7J A;  2OP3 A;  3H7D A;  2CB5 A;  1U5I A;  2AYN A;  3MHS A;  4PTB A;  3P5V A;  4FJC A;  2FT2 A;  4YV8 A;  1CVZ A;  3D6S A;  1WIL A;  1ICF A;  3IEJ A;  2G45 A;  2AUZ A;  3CH2 X;  4OVZ B;  1MHW A;  2Y6E A;  2E02 A;  4ZDT A;  5A24 A;  3VK6 A;  3ZPV E;  4LK9 A;  4DMX A;  3DF0 A;  2YUC A;  2K4D A;  2JMJ A;  3BPF A;  5G05 B;  4A49 A;  1X4I A;  3MP2 A;  4Q8H A;  2YW8 A;  5FER A;  2FYE A;  2VJF B;  3HWN A;  3PUQ A;  3CH3 X;  4BHW A;  2O6X A;  4ZQL A;  2VJF A;  4I04 A;  4R3D A;  2F6N A;  2JUN A;  3LQH A;  4I05 A;  3FM8 C;  1LDJ B;  1YZB A;  7PCK A;  2R9M A;  2P7U A;  2JQF R;  2YU4 A;  2ARY A;  1ME4 A;  3U8E A;  2DSM A;  3M99 A;  4D8I A;  3WXE A;  2K16 A;  2VHS A;  4R2Y A;  3O33 A;  1XWH A;  3I2D A;  4YBT A;  1DF0 A;  2MD7 B;  5G04 B;  2FRQ A;  2VPE A;  1QXP A;  3HCU A;  4XR7 A;  2ECJ A;  3BPM A;  3N9O A;  4P6E A;  1WEM A;  4FIP A;  2LXP C;  2OWA A;  3MHH A;  3FEH A;  4I07 A;  2YJ8 A;  3O36 A;  3ZNI A;  1U9W A;  2G6D A;  3SOU A;  4GUA A;  4O62 A;  3F5V A;  1G25 A;  2CSZ A;  2YSM A;  4BOU A;  2VP7 A;  3DPL R;  5D1M B;  4W4U A;  2XOZ A;  3C0R A;  3KNV A;  4P5O B;  3NG2 A;  4PPE A;  2IBI A;  3RVX A;  3OF8 A;  4L7X A;  1AYW A;  2YSJ A;  5LCW B;  1YK8 A;  5J3X A;  2CKL B;  2D8U A;  3LRQ A;  2VPB A;  3OQC A;  3H7H A;  2VPD A;  1PPO A;  1E4U A;  4AXL A;  3E9S A;  2B0O E;  1M6D A;  3MTN A;  4KLB A;  3ERV A;  1CSB B;  4LJN A;  9PAP A;  4YYS A;  3U5P A;  3OIS A;  3KV6 A;  3PLW A;  4I7C A;  1WEW A;  4LLB A;  5CVN B;  8PCH A;  1U6G B;  1PPN A;  1DVP A;  1DKI A;  1KHQ A;  2KRE A;  2AU1 A;  2DOS A;  3O70 A;  3LXS A;  3EB6 A;  2XP0 A;  1CPJ A;  3ZUA A;  3DQV R;  3L1Z B;  3O34 A;  3OVX A;  5I3L A;  1AU4 A;  3I3T A;  4YVA A;  3IOQ A;  2FFW A;  3LVR E;  1F29 A;  2KFT A;  3FAO A;  5FEY A;  4REZ A;  3P5W A;  1AU0 A;  1CJL A;  1AU2 A;  4RF0 A;  1CV8 A;  5K16 A;  4WZ3 B;  5CHT A;  4D8B A;  4CDC B;  2CSY A;  2DCB A;  5KH7 A;  1NL6 A;  2KGI A;  3T6R A;  2NQA A;  3FJU B;  3QZV A;  3B79 A;  2YHO A;  4HWY A;  1CTE A;  2R9C A;  2LN0 A;  2UZJ A;  1WFK A;  3N3G A;  4K7C A;  4HXD B;  1Y4H A;  1WEQ A;  3OF9 A;  2XU1 A;  2YQM A;  5D1L B;  1AIM A;  2KWN A;  2YJB A;  3ZTG A;  3T7L A;  5KO3 A;  2RI7 A;  1PPP A;  5B79 A;  4BOS A;  2RSD A;  1VYX A;  1JQP A;  3B21 A;  3PRM A;  1MM3 A;  3O65 A;  4H9D A;  5B77 A;  1WEN A;  2L75 A;  2KE1 A;  1HYJ A;  1MBM A;  2BAY A;  1AU3 A;  1ZIV A;  3HD3 A;  3NHE A;  1YAL A;  3BBA A;  2FSA A;  3OVZ A;  4IP3 A;  1QMY A;  4PP2 E;  3H8C A;  2ECN A;  2QIZ A;  2LGG A;  1WEO A;  2G8J A;  2K1J A;  3PUR A;  2PBH A;  4PP1 A;  4Z0R A;  3KDE C;  2M13 A;  4BSQ A;  3W31 A;  3V6E A;  4TKP B;  5C11 A;  2IQJ A;  2C2V S;  3KSE A;  4AYC B;  2ECT A;  4OVZ A;  3W30 A;  2IPP B;  5FB0 A;  3PBH A;  1Q6K A;  4AYC A;  3O1G A;  5FPW A;  2LGL A;  1HYI A;  2CON A;  1Z6U A;  1VD4 A;  1NPZ A;  2GFO A;  3M7K A;  1ZBD B;  2DC9 A;  2XU4 A;  4XZX A;  5AIU A;  2JQG R;  1N87 A;  2NQG A;  5J94 A;  2AS8 A;  2YUR A;  3V43 A;  4CDF B;  2L80 A;  4W5B A;  2ECV A;  2EGP A;  3TMP A;  1BOR A;  1ATK A;  2P57 A;  3RTR B;  2VPG A;  1LDK C;  5H1V A;  1KHP A;  2JTC A;  4LAD B;  1Z60 A;  5F02 A;  3ZYQ A;  4MZS A;  5TRB A;  3QT4 A;  5FB1 A;  1FP0 A;  1BQI A;  4UP5 A;  2J7Q A;  5EF4 A;  3LDY A;  5JA7 A;  2DC6 A;  1BP4 A;  1O0E A;  3K8U A;  3LQI A;  4YAB A;  2Y43 A;  2H0D B;  3QJ3 A;  1DCQ A;  3N9L A;  5CHV A;  4GNF A;  2H0D A;  4IUM A;  1WIM A;  2FUU A;  3ZVY A;  3JUE A;  2FUD A;  2E61 A;  1MEG A;  3IV2 A;  2PNS A;  3F75 A;  2WBF X;  2QJ0 A;  3LFY A;  5TAB A;  4F52 B;  2IDA A;  1DEU A;  3IHP A;  2LXH C;  2BTW B;  2G7Y A;  2LGV A;  5EZS A;  2NQD B;  3AI8 A;  5EGW A;  4C9Z A;  2NQI A;  1EWO A;  4YBS A;  2F42 A;  5DKA A;  3KV5 A;  2XEU A;  4IC3 A;  2DCD A;  2VHF A;  3MOR A;  5KH9 A;  2EOD A;  1KFX L;  2KGG A;  1YVB A;  3IUT A;  3MTV A; 
#chains in the Genus database with same CATH homology
 4QRX A;  2Y1M A;  4B86 C;  1F62 A;  3QSD A;  1PCI A;  3P5X A;  2CKL A;  1X9Y A;  1XKG A;  1A6R A;  4P6G A;  3U5O A;  2DZY A;  3BOW A;  2Y5B A;  4X6J A;  4FO9 A;  3GV4 A;  4YBM A;  3M63 A;  1QOL A;  2GHU A;  3BWK A;  1WES A;  5H1U A;  4QF2 A;  2VFC A;  4YYR A;  2CT2 A;  2YRE A;  2OUL A;  4YYW A;  1PAD A;  2R9N A;  4IC2 A;  1FH0 A;  3IMA A;  4I7D A;  2OXQ C;  2L0B A;  1AYV A;  2MUM A;  2AN6 A;  1NQC A;  4YYV A;  2LDR A;  4V3L C;  2D8S A;  4A4B A;  1EF7 A;  1POP A;  5JG6 A;  2UZG A;  1RMD A;  3FL2 A;  1MDW A;  2FUI A;  4UI9 B;  4CCG X;  1CS8 A;  3USV A;  3N9M A;  3SOW A;  3KFQ A;  3C5K A;  3RVW A;  3KWZ A;  5LKZ A;  1GLO A;  1WEP A;  1WEU A;  1F2B A;  2ATO A;  2XU5 A;  4OEM A;  3L1X A;  3SOX A;  4DMY A;  2VNF A;  4GNG A;  2Y1N A;  2DX8 A;  1Z2Q A;  2FQ9 A;  3S3Q A;  4YYU A;  4YAX A;  1IYM A;  1GCB A;  1V87 A;  5PAD A;  1WEV A;  2C0Y A;  2DZZ A;  3PHD A;  3N9Q A;  1EWP A;  1K2F A;  4UP0 A;  4BS5 A;  3O0U A;  1EWL A;  3N9N A;  2JRJ A;  3HHA A;  1MIR A;  2B1N A;  2R9F A;  3O37 A;  2YT5 A;  2EA6 A;  3ZPV 1;  2G6Q A;  5LKU A;  5B8D A;  3V6C A;  2VJE B;  1FBV A;  4A0C D;  4AUQ B;  3RVV A;  5TBN A;  2DJG B;  2KR4 A;  2VJE A;  3GCB A;  3H8B A;  3KW9 A;  3EB5 A;  4R7E A;  1CHC A;  6PAD A;  5JH3 A;  2DC7 A;  2HHN A;  3O7A A;  1CQD A;  1SP4 B;  5CVM A;  2F1G A;  2KIZ A;  1TU6 A;  1VSN A;  2ECI A;  1VFY A;  3PW3 A;  5AIT A;  1NB3 A;  5H1T A;  3U5M A;  2LGK A;  2MT5 A;  2DCC A;  4QH6 A;  5TDR A;  5DIN A;  3KX1 A;  2XU3 A;  4N79 A;  2ECW A;  4QBB A;  2HH5 A;  2ZET C;  2G43 A;  3RPG C;  2BDZ A;  2HD5 A;  1GEC E;  1QDQ A;  1K3B B;  4A4C A;  3LTW A;  1U9X A;  3U5N A;  4GUZ A;  4CA1 A;  2YQL A;  2R9O A;  4Q8G A;  1PIP A;  2C2L A;  1GX3 A;  1WEE A;  2I50 A;  5G0F A;  2PAD A;  3ZVZ B;  3SHB A;  4NV7 A;  2LRI C;  2YJ2 A;  2PNX A;  2M85 A;  1BGO A;  4R8P K;  1F2A A;  3KKU A;  3I06 A;  4WA6 A;  4MZO A;  2E00 A;  4X6H A;  5LKX A;  4NN2 A;  2E01 A;  1VJV A;  5B76 A;  3E1Z B;  4N4F A;  1AEC A;  3S3R A;  1MM2 A;  2E6S A;  3N9P A;  1ITO A;  3WXF A;  2E03 A;  4RY2 A;  4BGF A;  1Y08 A;  1KXR A;  3BC3 A;  4AP4 A;  1WE9 A;  4XI1 A;  2AUX A;  3WXG A;  3BCN A;  2MA6 A;  1W6F A;  1NLJ A;  3RPG B;  2DC8 A;  1JOC A;  5LKT A;  3CBK A;  2G8E A;  2KU3 A;  2AYO A;  3CBJ A;  5KH3 A;  2NAA A;  5CVO B;  2LQ6 A;  2MNY A;  2YHN A;  4O64 A;  1MEM A;  4GND A;  1YK7 A;  1GMY A;  1PPD A;  2KWJ A;  3H6S A;  2P0R A;  4XUI A;  2MD8 C;  4MVT A;  1PBH A;  1CB5 A;  3TNX A;  2BDL A;  2HDP A;  1E2T A;  1F2C A;  2L43 A;  4V3K C;  5D1K B;  2F7D A;  4ZUX U;  3GL6 A;  2YJC A;  3C9E A;  2DCA A;  1YT7 A;  3K9M A;  5B78 A;  2L5U A;  4L58 A;  1U9V A;  4N8W A;  2E6R A;  3O35 A;  3P5U A;  2JMI A;  4WZ0 A;  4BBQ A;  1T1H A;  3N4C A;  3PNR A;  1JM7 B;  1WGM A;  1KFU L;  2R6N A;  2OZ2 A;  4N4Z A;  2PRE A;  4BS6 A;  4YYQ A;  5B75 A;  1JM7 A;  2F6J A;  1ZCM A;  3KWB X;  1THE A;  4G54 A;  2FTD A;  2XB1 A;  2M1R A;  2KYU A;  4PAD A;  1ME3 A;  1STF E;  4CZW A;  1TL9 A;  2YYR A;  2KWK A;  2M3H A;  1S4V A;  4S3O C;  3HHI A;  3PDF A;  2B1M A;  2ACT A;  4X6I A;  1MS6 A;  1PE6 A;  4YAT A;  2FO5 A;  1NB5 A;  2MNZ A;  4QF3 A;  4BPV A;  2CIO A;  1TLO A;  1BY8 A;  2DJF B;  2MIQ A;  3ASL A;  4GB0 A;  1EWM A;  1SNK A;  1X4J A;  3H89 A;  4B7Y C;  4W5C A;  4BQV A;  4FK5 A;  1IWD A;  2QIC A;  3HTK C;  2PUY A;  2ECG A;  3K24 A;  3HCS A;  2AVW A;  4QRG A;  2LV9 A;  4QRV A;  4PI3 A;  4AXM A;  4I7B A;  2P86 A;  3N3K A;  3LQJ A;  4YAD A;  4MSX A;  2HXZ A;  3M62 A;  5H9M A;  3KQI A;  5C13 A;  1AYU A;  4AVX A;  4Q6F A;  2K17 A;  4B55 A;  2HYE D;  4GNE A;  2YJ9 A;  2MA5 A;  5EYA F;  4LKA A;  3C6W A;  4CDD B;  4S3O B;  5TDW A;  4OEL A;  1PXV A;  3HCT A;  2KWO A;  1U9Q X;  4CDE B;  4WZ2 A;  4YC9 A;  2AIM A;  2JMD A;  2M6M A;  1HUC B;  3L11 A;  2FRA A;  1X4U A;  4N3W A;  4X3G A;  2H7J A;  2OP3 A;  3H7D A;  2CB5 A;  1U5I A;  2AYN A;  3MHS A;  4PTB A;  3P5V A;  4FJC A;  2FT2 A;  4YV8 A;  1CVZ A;  3D6S A;  1WIL A;  1ICF A;  3IEJ A;  2G45 A;  2AUZ A;  3CH2 X;  1MHW A;  2Y6E A;  2E02 A;  4ZDT A;  5A24 A;  3VK6 A;  3ZPV E;  4LK9 A;  4DMX A;  3DF0 A;  2YUC A;  2K4D A;  2JMJ A;  3BPF A;  5G05 B;  4A49 A;  1X4I A;  4Q8H A;  2YW8 A;  5FER A;  2FYE A;  2VJF B;  3HWN A;  3PUQ A;  3CH3 X;  4BHW A;  2O6X A;  4ZQL A;  2VJF A;  4I04 A;  2F6N A;  3LQH A;  4I05 A;  7PCK A;  1LDJ B;  2R9M A;  2P7U A;  2JQF R;  2YU4 A;  2ARY A;  1ME4 A;  3U8E A;  3M99 A;  4NV8 A;  3WXE A;  2K16 A;  2VHS A;  4R2Y A;  3O33 A;  1XWH A;  3I2D A;  4YBT A;  1DF0 A;  2MD7 B;  5G04 B;  2FRQ A;  2VPE A;  1QXP A;  3HCU A;  4XR7 A;  2ECJ A;  3BPM A;  3N9O A;  4P6E A;  1WEM A;  2LXP C;  4FIP A;  3MHH A;  4I07 A;  2YJ8 A;  3O36 A;  3ZNI A;  1U9W A;  2G6D A;  3SOU A;  3F5V A;  1G25 A;  2CSZ A;  2YSM A;  2VP7 A;  3DPL R;  5D1M B;  4W4U A;  3KNV A;  4P5O B;  3NG2 A;  4PPE A;  2IBI A;  3RVX A;  3OF8 A;  4L7X A;  1AYW A;  2YSJ A;  5LCW B;  1YK8 A;  5J3X A;  2CKL B;  3LRQ A;  2VPB A;  2VPD A;  1PPO A;  1E4U A;  4AXL A;  1M6D A;  3MTN A;  4KLB A;  3ERV A;  1CSB B;  4LJN A;  9PAP A;  4YYS A;  3U5P A;  3OIS A;  3KV6 A;  4I7C A;  1WEW A;  4LLB A;  5CVN B;  8PCH A;  1U6G B;  1PPN A;  1DVP A;  1W4T A;  1KHQ A;  2KRE A;  2AU1 A;  3O70 A;  3LXS A;  3EB6 A;  1CPJ A;  3ZUA A;  3DQV R;  3L1Z B;  3O34 A;  3OVX A;  5I3L A;  1AU4 A;  3I3T A;  4YVA A;  3IOQ A;  1F29 A;  2KFT A;  5FEY A;  3P5W A;  1AU0 A;  1CJL A;  1AU2 A;  1CV8 A;  5K16 A;  4WZ3 B;  5CHT A;  4CDC B;  2CSY A;  2DCB A;  5KH7 A;  1NL6 A;  2KGI A;  3T6R A;  2NQA A;  3QZV A;  3B79 A;  3D9W A;  2YHO A;  4HWY A;  1CTE A;  2R9C A;  2LN0 A;  1WFK A;  3N3G A;  4K7C A;  1Y4H A;  1WEQ A;  3OF9 A;  2XU1 A;  2YQM A;  5D1L B;  1AIM A;  2KWN A;  2YJB A;  3ZTG A;  3T7L A;  2RI7 A;  1PPP A;  5B79 A;  2RSD A;  1VYX A;  1JQP A;  1MM3 A;  5B77 A;  1WEN A;  2L75 A;  2KE1 A;  1HYJ A;  1AU3 A;  2BAY A;  3HD3 A;  1ZIV A;  3NHE A;  3OVZ A;  1YAL A;  2FSA A;  1QMY A;  4PP2 E;  3H8C A;  2ECN A;  2QIZ A;  2LGG A;  1WEO A;  2G8J A;  2K1J A;  3PUR A;  2PBH A;  4PP1 A;  4BSQ A;  3V6E A;  4TKP B;  5C11 A;  3KSE A;  2C2V S;  4AYC B;  2ECT A;  2IPP B;  5FB0 A;  3PBH A;  1Q6K A;  4AYC A;  3O1G A;  5FPW A;  2LGL A;  1HYI A;  1Z6U A;  1VD4 A;  1NPZ A;  2GFO A;  2DC9 A;  1ZBD B;  2XU4 A;  5AIU A;  2JQG R;  1N87 A;  2NQG A;  5J94 A;  2AS8 A;  2YUR A;  3V43 A;  4C5P A;  4CDF B;  2L80 A;  2BSZ A;  4W5B A;  2ECV A;  2EGP A;  1BOR A;  1ATK A;  3RTR B;  2VPG A;  1LDK C;  5H1V A;  1KHP A;  4LAD B;  1Z60 A;  5F02 A;  3ZYQ A;  4MZS A;  1W5R A;  5TRB A;  3QT4 A;  5FB1 A;  1FP0 A;  1BQI A;  4UP5 A;  5EF4 A;  5JA7 A;  2DC6 A;  1BP4 A;  1O0E A;  3K8U A;  3LQI A;  4YAB A;  2Y43 A;  2H0D B;  3QJ3 A;  3N9L A;  5CHV A;  4GNF A;  2H0D A;  1WIM A;  2FUU A;  3ZVY A;  2FUD A;  1MEG A;  3IV2 A;  2PNS A;  3F75 A;  2WBF X;  2QJ0 A;  3LFY A;  5TAB A;  4F52 B;  2IDA A;  2VFB A;  1DEU A;  3IHP A;  2LXH C;  2G7Y A;  2LGV A;  2NQD B;  3AI8 A;  5EGW A;  4C9Z A;  2NQI A;  1EWO A;  4YBS A;  2F42 A;  5DKA A;  3KV5 A;  2XEU A;  4IC3 A;  2DCD A;  2VHF A;  3MOR A;  5KH9 A;  2EOD A;  1KFX L;  2KGG A;  1YVB A;  3IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...