3M99A

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
470
structure length
422
Chain Sequence
SICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQDAHEFWQFIINQIHQSYVLDLPNAKNNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 111
structure length 422
sequence length 470
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3m99A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3m99A02
2K16A 4V3LC 1K3BB 2R9NA 9PAPA 1AYUA 2CKLA 3NHEA 2G6QA 4YBSA 3O37A 2YJCA 5G05B 5FERA 5B76A 1U9VA 2M85A 2E6RA 2KGGA 2VPGA 3DQVR 2ECGA 3T6RA 1CHCA 2HXZA 3OVZA 2DJFB 1NL6A 3H7DA 2VP7A 3P5XA 4FIPA 4BSQA 2C2VS 2VHFA 4WZ3B 3HD3A 2DCDA 2HD5A 2JRJA 4GNDA 5G0FA 4YYWA 2KREA 4PADA 1PPPA 1NQCA 4IC2A 3P5WA 2YT5A 4YYUA 4AXMA 2M1RA 4K7CA 1POPA 2P7UA 5I3LA 1CJLA 5CVOB 4WA6A 1Z6UA 2MT5A 3H6SA 4W4UA 4OEMA 4P6GA 4DMXA 3QT4A 2AUXA 3I3TA 2L0BA 3F75A 3IEJA 2VJEA 2FT2A 3LRQA 2JMJA 2GFOA 5KH3A 2CKLB 2OULA 3B79A 1LDJB 1PCIA 1X9YA 2YJ8A 2EGPA 2G8EA 3WXFA 2LV9A 4DMYA 3H8CA 2Y1NA 4WZ0A 3K9MA 4IC3A 4N3WA 2IDAA 1WEUA 3MHSA 4AVXA 3RPGB 3D6SA 1WEEA 2FSAA 1CQDA 1Z60A 3PDFA 1ME3A 1WENA 3PURA 5TDWA 3SOXA 1BY8A 2B1MA 2MNYA 3IUTA 4A0CD 2RI7A 1EWOA 3PUQA 4UP0A 4ZQLA 2CB5A 4YV8A 2YHNA 2ZETC 4HWYA 1ICFA 4A49A 4BS6A 5B8DA 1CSBB 4GNFA 3HCUA 1DVPA 2YJ9A 3BPFA 1VD4A 2QICA 4L58A 4ZUXU 2BDLA 2IPPB 3KQIA 2JQFR 4GNGA 1K2FA 4Q8HA 5EF4A 1U5IA 1PBHA 2LXPC 3IV2A 5CVMA 2AU1A 4YAXA 2I50A 3S3QA 2ECVA 2KWJA 1PPDA 1WEWA 2DCAA 5CHTA 4G54A 5D1LB 3HWNA 1GECE 1AU3A 3U5MA 1ME4A 3ZPV1 2DC6A 2KU3A 2VPBA 4N4ZA 2VJEB 2AYOA 2NAAA 2L80A 3SOUA 5LCWB 4W5BA 3TNXA 5FEYA 5CHVA 4W5CA 3HCTA 1JM7B 4LJNA 1BP4A 3H89A 4BBQA 2MIQA 2YUCA 1XKGA 4CCGX 4Q6FA 2ARYA 2R9OA 5LKUA 3LQHA 2E01A 4KLBA 5C11A 3V6EA 2KFTA 2ECJA 1MDWA 5F02A 2PADA 3M62A 3PW3A 4PP1A 3KV6A 3KW9A 3RVXA 4WZ2A 2G43A 4ZDTA 3GV4A 5B75A 1VJVA 4YYRA 5CVNB 1CPJA 1KFXL 3LQIA 2EA6A 3ASLA 4I7BA 1Y08A 2K17A 3C9EA 2O6XA 3EB6A 2MUMA 2KWOA 2B1NA 1NB5A 2EODA 2HYED 1KXRA 1WEMA 2C2LA 2XB1A 1HYJA 4PP2E 4QH6A 1NPZA 2DZZA 3M63A 4R8PK 3E1ZB 4X6HA 3P5VA 5G04B 3QZVA 5J3XA 4C9ZA 2NQDB 4R7EA 4CZWA 2KE1A 4OELA 2E02A 2G7YA 1Z2QA 4P5OB 5B78A 1FP0A 5DKAA 4CDFB 2F6NA 1BGOA 2E6SA 2YSJA 2K1JA 3NG2A 2CT2A 5FPWA 1NB3A 4V3KC 3BPMA 4LK9A 3QSDA 1ZBDB 1SP4B 1EWLA 4BPVA 2ACTA 1MM2A 1VYXA 1Q6KA 4N8WA 3DPLR 3BCNA 4B86C 2G6DA 2YJ2A 1SNKA 1AYVA 4QBBA 4X6IA 2BAYA 3C6WA 1WESA 3KSEA 1QXPA 3IMAA 3BWKA 4FO9A 3KFQA 5TRBA 4I05A 2L5UA 1XWHA 5D1KB 1MM3A 1PIPA 1V87A 3K8UA 4MZSA 1WFKA 4TKPB 2AIMA 1G25A 3CBKA 4YYSA 1KFUL 1FBVA 1X4UA 5DINA 1WIMA 2PREA 2DCCA 4YABA 1F62A 4BHWA 2E03A 3HCSA 1U9XA 2DCBA 3MORA 4GB0A 1JM7A 4CDCB 1WGMA 3N9QA 5H1UA 1AU2A 1S4VA 2F42A 1WILA 1O0EA 4XUIA 2XU4A 2WBFX 4I07A 2YREA 4LKAA 3S3RA 1CTEA 1HUCB 1TU6A 2MD7B 4R2YA 4O64A 2C0YA 2H0DB 5C13A 3O36A 4YVAA 4LADB 5H9MA 5H1VA 1PE6A 2YQMA 3ZVZB 2OXQC 2CIOA 2KGIA 1AU0A 1JQPA 2OZ2A 1BQIA 2YURA 2H7JA 5B77A 3ZTGA 1EWPA 4X3GA 4A4CA 1FH0A 3KNVA 6PADA 3T7LA 3LXSA 3CBJA 5TDRA 4B7YC 1F2CA 1QOLA 3N3KA 1U6GB 2FYEA 2YU4A 2DX8A 2AYNA 2DC8A 2DJGB 4YBTA 2XU1A 2Y6EA 4BS5A 1DF0A 3K24A 3U5NA 3OF8A 3O33A 1ZCMA 1N87A 2M6MA 1ITOA 2ECWA 3QJ3A 3I06A 2AS8A 3O34A 1WEOA 3O0UA 1YALA 2RSDA 4MVTA 3CH2X 3IOQA 1BORA 5AIUA 2NQIA 2FQ9A 4CDEB 4CA1A 3ZYQA 2VNFA 1AYWA 2JMIA 2L43A 2QIZA 5JA7A 2R9FA 1GMYA 5EYAF 1YVBA 1PPOA 3OVXA 2HHNA 2YSMA 2G8JA 4FK5A 2LGKA 2MA6A 4NN2A 3N9OA 1EF7A 1T1HA 4PPEA 2VHSA 3ZPVE 3HTKC 3BOWA 4LLBA 1DEUA 8PCHA 2F7DA 2YJBA 2YHOA 4XI1A 1CS8A 3I2DA 1AU4A 3GCBA 3M99A 1CB5A 4UP5A 4CDDB 2HDPA 3CH3X 3USVA 4BQVA 3N9NA 3SOWA 3O7AA 3AI8A 5J94A 4PI3A 2E00A 4QRVA 2MNZA 3KKUA 2NQGA 2M3HA 4X6JA 2VJFA 4FJCA 3H8BA 4YYQA 1AIMA 3O70A 1A6RA 4UI9B 1U9WA 2FTDA 2PBHA 2XU3A 3KWBX 2R9MA 2K4DA 3L11A 2DZYA 3RVVA 2ECIA 2G45A 3O1GA 3ZNIA 3PBHA 5JH3A 2R6NA 5KH7A 3N4CA 1M6DA 5TABA 3N9PA 2JMDA 1CV8A 3KX1A 2AN6A 1KHQA 1PXVA 1MEGA 1THEA 4S3OB 2XEUA 1QMYA 3U5PA 5FB1A 2VPDA 2XU5A 2P0RA 3KWZA 5H1TA 4AUQB 2JQGR 5EGWA 3HHAA 1MS6A 2NQAA 2PUYA 5AITA 2PNXA 2LRIC 2QJ0A 4QF2A 3MTNA 3U8EA 3P5UA 1JOCA 3LQJA 2IBIA 2KYUA 4QF3A 1IWDA 3RPGC 3V43A 3HHIA 1F2AA 1KHPA 2YW8A 4YBMA 4I7DA 5LKTA 4L7XA 1E4UA 4N79A 2CSZA 1WEQA 2F1GA 4AXLA 5JG6A 4QRGA 1PPNA 2UZGA 2MA5A 3BC3A 5B79A 2KWKA 1GCBA 5K16A 3OF9A 3ZUAA 1X4JA 1YT7A 2H0DA 1HYIA 1CVZA 3PNRA 4Q8GA 1NLJA 1X4IA 1QDQA 3EB5A 2OP3A 4N4FA 1STFE 2Y43A 3O35A 1TL9A 1AECA 2ECTA 3N9LA 4S3OC 2LGLA 2DC7A 4AYCB 2Y5BA 3GL6A 4F52B 1VSNA 1MEMA 2CSYA 2FUDA 1MHWA 2DC9A 5FB0A 3F5VA 2KIZA 3V6CA 2PNSA 2YQLA 4I04A 3VK6A 3WXGA 2ATOA 2KWNA 4MZOA 3C5KA 4I7CA 5LKXA 3PHDA 1Y4HA 3N9MA 1U9QX 3WXEA 1YK8A 4YADA 2D8SA 1TLOA 2FUUA 2LDRA 2FRQA 4AP4A 2Y1MA 1WEPA 1RMDA 3N3GA 2LN0A 4AYCA 2KR4A 3KV5A 3IHPA 1ZIVA 3DF0A 2AUZA 4A4BA 4YC9A 2FRAA 5TBNA 4QRXA 2F6JA 5D1MB 2YYRA 1WEVA 4MSXA 2AVWA 1WE9A 4PTBA 4XR7A 3FL2A 2VPEA 5A24A 5PADA 5KH9A 2FUIA 1LDKC 1PADA 2MD8C 5LKZA 1EWMA 3LFYA 2GHUA 1F2BA 2P86A 2R9CA 3RTRB 1MIRA 2L75A 3SHBA 2VJFB 4YATA 3U5OA 2ECNA 2FO5A 4YYVA 1YK7A 2LGGA 3MHHA 3OISA 1IYMA 2LQ6A 2LGVA 3RVWA 3ERVA 7PCKA 3ZVYA 1GLOA 4P6EA 1VFYA 2HH5A 4RY2A 1F29A 3L1XA 2LXHC 2BDZA 4GNEA 1ATKA 3L1ZB
chains in the Genus database with same CATH superfamily
2K16A 4V3LC 1K3BB 2J7QA 2R9NA 3MTVA 9PAPA 1AYUA 2CKLA 3NHEA 2G6QA 4YBSA 3O37A 2YJCA 5G05B 5FERA 3FAOA 5B76A 1U9VA 2M85A 2E6RA 2KGGA 2VPGA 3DQVR 4REZA 2ECGA 3T6RA 1CHCA 2HXZA 3OVZA 2DJFB 3PHXA 1NL6A 3H7DA 2VP7A 3P5XA 4FIPA 4BSQA 2M13A 4OVZA 2C2VS 2VHFA 4WZ3B 3HD3A 2DCDA 2HD5A 2JRJA 2FFWA 4GNDA 5G0FA 2KREA 4PADA 4YYWA 1PPPA 4BOZA 1NQCA 4IC2A 3BBAA 2YT5A 3P5WA 4YYUA 3M7KA 3FM8C 4AXMA 2M1RA 4K7CA 1POPA 2P7UA 2P57A 5I3LA 1CJLA 5CVOB 2KKXA 4WA6A 1Z6UA 2MT5A 3H6SA 4W4UA 4OEMA 4P6GA 4DMXA 3QT4A 2AUXA 2BTWB 2YVRA 3I3TA 2L0BA 3F75A 3IEJA 2VJEA 2FT2A 3LRQA 2JMJA 2GFOA 5KH3A 2CKLB 2OULA 3B79A 1LDJB 1PCIA 1X9YA 2YJ8A 3BB7A 2EGPA 2UZJA 2RR4A 2G8EA 3WXFA 2LV9A 4DMYA 3H8CA 2Y1NA 4WZ0A 3C0RA 3K9MA 4IC3A 4N3WA 2IDAA 1WEUA 3MHSA 4OGEA 4AVXA 3W31A 3RPGB 3D6SA 2EXUA 1WEEA 2FSAA 4P16A 1CQDA 1Z60A 3PDFA 1ME3A 4D8IA 1WENA 3PURA 5TDWA 3SOXA 1BY8A 2B1MA 2MNYA 3IUTA 2CRRA 4A0CD 2RI7A 1EWOA 3PUQA 4UP0A 4ZQLA 2CB5A 4YV8A 2YHNA 2ZETC 4HWYA 2IQJA 1ICFA 4A49A 4BS6A 4BOPA 5B8DA 1CSBB 3PHWA 4GNFA 3HCUA 1DVPA 2CRWA 2YJ9A 3BPFA 1VD4A 2QICA 4L58A 4ZUXU 2BDLA 2IPPB 4IP3A 3KQIA 2BTWA 2JQFR 4GNGA 2JM3A 1K2FA 4Q8HA 5EF4A 1U5IA 1PBHA 2LXPC 3IV2A 5CVMA 2AU1A 4YAXA 2I50A 3S3QA 2ECVA 2KWJA 1PPDA 1WEWA 2LAUA 3BY4A 2DCAA 3PT2A 5CHTA 4G54A 5D1LB 5EZQA 3HWNA 2D8UA 4IUMA 1GECE 1AU3A 3U5MA 1ME4A 4Z0RA 3ZPV1 2DC6A 2KU3A 2VPBA 4N4ZA 2VJEB 2AYOA 2NAAA 2L80A 3SOUA 5LCWB 4W5BA 3TNXA 5FEYA 5CHVA 4W5CA 3HCTA 1JM7B 4LJNA 1BP4A 3H89A 4PT5A 4BBQA 2MIQA 2YUCA 1XKGA 4CCGX 4Q6FA 2ARYA 2R9OA 3MDBC 3LQHA 5LKUA 2E01A 5C11A 4KLBA 3V6EA 2KFTA 2ECJA 1MDWA 5F02A 2PADA 3H7HA 3M62A 3PW3A 4PP1A 3KV6A 3SUBA 3KW9A 3RVXA 4WZ2A 2G43A 4ZDTA 3GV4A 5B75A 1VJVA 4MM3B 4YYRA 5CVNB 1CPJA 1KFXL 3LQIA 2EA6A 3ASLA 4I7BA 1Y08A 2K17A 3C9EA 2O6XA 3EB6A 2MUMA 2KWOA 2B1NA 1NB5A 2EODA 2HYED 1KXRA 1WEMA 2C2LA 2XB1A 1HYJA 2OWAA 1MBMA 4PP2E 4QH6A 4RKXA 1NPZA 1DKIA 2J7QC 2DZZA 3M63A 4R8PK 3E1ZB 4X6HA 3P5VA 5G04B 3QZVA 5J3XA 4C9ZA 5SVYA 2NQDB 4R7EA 4CZWA 2KE1A 4OELA 2E02A 2G7YA 1Z2QA 4P5OB 5B78A 3OQCA 1FP0A 5DKAA 4CDFB 2F6NA 1BGOA 2E6SA 2YSJA 2K1JA 3NG2A 2CT2A 5FPWA 1NB3A 4V3KC 3BPMA 4LK9A 3QSDA 3PRPA 1ZBDB 1SP4B 1EWLA 2JRIA 3FJUB 4BPVA 2ACTA 1MM2A 1VYXA 2HWKA 1Q6KA 4N8WA 3DPLR 3BCNA 4B86C 3O47A 2G6DA 2YJ2A 1SNKA 1AYVA 4QBBA 4X6IA 2BAYA 3C6WA 1WESA 3E9SA 3KSEA 1QXPA 3IMAA 3BWKA 4FO9A 3KFQA 5TRBA 4I05A 2L5UA 5D1KB 1XWHA 1MM3A 1PIPA 1V87A 3JUEA 3K8UA 1WFKA 4TKPB 4MZSA 4RNAA 2AIMA 4D8EA 1G25A 5EZSA 3CBKA 4YYSA 4OGCA 1KFUL 1FBVA 1X4UA 5DINA 1WIMA 2PREA 2DCCA 2EGMA 2DOSA 2B0OE 4YABA 1F62A 4BHWA 1UKFA 2E03A 3HCSA 1U9XA 2DCBA 3MORA 4GB0A 1JM7A 3MJ5A 4CDCB 1WGMA 3N9QA 1PVJA 5H1UA 1AU2A 1S4VA 2F42A 2L7PA 1WILA 1O0EA 4XUIA 2XU4A 2WBFX 4I07A 2YREA 3LDYA 4LKAA 3S3RA 1CTEA 1HUCB 1TU6A 2MD7B 4R2YA 4O64A 5JZEA 5SVIB 3KDEC 2C0YA 2H0DB 5C13A 3O36A 4YVAA 4LADB 5H9MA 5H1VA 1PE6A 2FE8A 2YQMA 3ZVZB 2OXQC 2CIOA 2KGIA 1AU0A 1JQPA 2OZ2A 1BQIA 2YURA 2H7JA 2BU3A 5B77A 4HXDB 3ZTGA 1EWPA 4BOSA 4X3GA 4A4CA 1FH0A 3KNVA 3DDTA 6PADA 3T7LA 3LXSA 3CBJA 4ZTBA 5TDRA 4B7YC 1F2CA 1QOLA 3N3KA 1U6GB 2DJAA 2YU4A 2DX8A 2AYNA 2DC8A 2JUNA 4YBTA 2DJGB 2FYEA 2XU1A 2Y6EA 4BS5A 3FEHA 1DF0A 3TMPA 3K24A 3U5NA 3OF8A 3O33A 1ZCMA 1N87A 2M6MA 1ITOA 2ECWA 3QJ3A 3I06A 2AS8A 3O34A 1WEOA 3O0UA 1YALA 2RSDA 4MVTA 3CH2X 3IOQA 3LVRE 1BORA 5AIUA 2NQIA 2FQ9A 4CDEB 4CA1A 3ZYQA 2VNFA 1AYWA 2JMIA 2L43A 2QIZA 5JA7A 2R9FA 2XOYA 3O65A 5K3QA 1GMYA 3MP2A 5EYAF 4D8BA 1YVBA 1PPOA 3OVXA 2HHNA 2YSMA 2G8JA 4FK5A 4BOQA 3LJUX 2LGKA 2MA6A 4NN2A 3N9OA 1EF7A 1T1HA 3PLWA 4PPEA 2VHSA 3ZPVE 1DCQA 3HTKC 3B21A 3BOWA 4LLBA 1DEUA 8PCHA 2F7DA 2YJBA 2YHOA 4XI1A 1CS8A 3I2DA 1AU4A 3GCBA 3M99A 1CB5A 4UP5A 4CDDB 2HDPA 3CH3X 3USVA 4BQVA 3N9NA 3SOWA 3O7AA 3AI8A 5J94A 4PI3A 2E00A 3PHUA 4QRVA 2MNZA 3KKUA 2NQGA 2M3HA 4X6JA 2VJFA 4FJCA 3H8BA 4YYQA 1AIMA 3ZNHA 3O70A 1A6RA 4QQ4A 4Z0OA 4UI9B 1U9WA 2FTDA 2PBHA 2XU3A 3KWBX 2R9MA 2K4DA 3L11A 2DZYA 4M0WA 4OVZB 2ECIA 3RVVA 2G45A 4R3DA 3O1GA 3ZNIA 3PBHA 5JH3A 2R6NA 5KH7A 3N4CA 1M6DA 5TABA 4XZXA 3N9PA 2JMDA 1CV8A 3KX1A 3E2DA 2AN6A 1KHQA 1PXVA 1MEGA 1THEA 4S3OB 2XEUA 1QMYA 3U5PA 4H9DA 5FB1A 2VPDA 2XU5A 3PSEA 2P0RA 3KWZA 5H1TA 4MI7A 4AUQB 2JQGR 5EGWA 3HHAA 1MS6A 2AGAA 2NQAA 3W30A 2PUYA 4BOUA 5AITA 2PNXA 2LRIC 2QJ0A 4QF2A 2Z84A 3MTNA 3U8EA 4F1PA 3P5UA 1JOCA 3LQJA 2IBIA 2KYUA 4QF3A 1IWDA 3RNVA 3RPGC 3V43A 5E6JA 3HHIA 1F2AA 1KHPA 2YW8A 3Q1DA 4YBMA 4I7DA 5LKTA 4L7XA 1E4UA 4N79A 2CSZA 1WEQA 4RF1A 2F1GA 4AXLA 5JG6A 4QRGA 1PPNA 2UZGA 2MA5A 3BC3A 5B79A 4OW0A 2KWKA 1GCBA 5K16A 5SVIA 3OF9A 3ZUAA 1X4JA 2MKEA 1YT7A 4O62A 2H0DA 1HYIA 1CVZA 3PNRA 4Q8GA 1NLJA 1X4IA 1QDQA 3LVQE 3EB5A 2OP3A 4N4FA 1STFE 2Y43A 3O35A 1TL9A 1AECA 2ECTA 3T9KA 3N9LA 4S3OC 2CONA 2LGLA 2DC7A 4AYCB 2Y5BA 3GL6A 4F52B 1VSNA 3DWDA 3FANA 1MEMA 2CSYA 3IFUA 2FUDA 1MHWA 2DC9A 5FB0A 2FD4A 3F5VA 2KIZA 2XOZA 3V6CA 2PNSA 2YQLA 4I04A 3VK6A 3WXGA 4RF0A 2ATOA 2KWNA 1YZBA 3C5KA 4I7CA 5LKXA 4MZOA 2DSMA 3PHDA 1Y4HA 3N9MA 1U9QX 3WXEA 1YK8A 4YADA 2D8SA 1TLOA 2FUUA 2LDRA 2FRQA 4AP4A 2Y1MA 1WEPA 1RMDA 3N3GA 2LN0A 4AYCA 4A5UA 2KR4A 3KV5A 3IHPA 3PRMA 1ZIVA 3DF0A 2AUZA 4A4BA 4YC9A 2FRAA 5TBNA 4QRXA 2F6JA 5D1MB 2YYRA 1WEVA 4MSXA 2AVWA 1WE9A 4PTBA 4XR7A 3FL2A 2VPEA 5A24A 5PADA 5KH9A 2FUIA 1LDKC 1PADA 2E61A 2MD8C 5LKZA 1EWMA 3LFYA 2GHUA 1F2BA 2P86A 2R9CA 4WURA 3RTRB 1MIRA 3TRKA 2L75A 3SHBA 2VJFB 4YATA 3U5OA 2KKYA 2XP0A 2ECNA 2FO5A 4YYVA 1YK7A 2LGGA 2XOCA 3MHHA 2JTCA 3OISA 1IYMA 2LQ6A 5KO3A 2CSVA 2LGVA 3RVWA 3ERVA 7PCKA 3ZVYA 1GLOA 4P6EA 4GUAA 1VFYA 2HH5A 4RY2A 1F29A 3L1XA 2LXHC 2BDZA 5SVXA 4GNEA 1ATKA 3L1ZB
chains in the Genus database with same CATH topology
2K16A 4V3LC 1K3BB 2R9NA 9PAPA 1AYUA 2CKLA 3NHEA 2G6QA 4YBSA 3O37A 2YJCA 5G05B 5FERA 5B76A 1U9VA 2M85A 2E6RA 2KGGA 2VPGA 3DQVR 2ECGA 3T6RA 1CHCA 2HXZA 3OVZA 2DJFB 1NL6A 3H7DA 2VP7A 3P5XA 4FIPA 4BSQA 2C2VS 2VHFA 4WZ3B 3HD3A 2DCDA 2HD5A 2JRJA 4GNDA 5G0FA 2VFCA 2KREA 4PADA 4YYWA 1PPPA 1NQCA 4IC2A 3P5WA 2YT5A 4YYUA 4AXMA 2M1RA 4K7CA 1POPA 2P7UA 4B55A 5I3LA 1CJLA 5CVOB 4WA6A 1Z6UA 2MT5A 3H6SA 4W4UA 4OEMA 4P6GA 4DMXA 3QT4A 2AUXA 3I3TA 2L0BA 3F75A 3IEJA 2VJEA 2FT2A 3LRQA 2JMJA 2GFOA 5KH3A 2CKLB 2OULA 3B79A 1LDJB 1PCIA 1X9YA 2YJ8A 2EGPA 2G8EA 3WXFA 2LV9A 4DMYA 3H8CA 2Y1NA 4WZ0A 3K9MA 4IC3A 4N3WA 2IDAA 1WEUA 3MHSA 4AVXA 4NV7A 3RPGB 3D6SA 1WEEA 2FSAA 1CQDA 1Z60A 3PDFA 1ME3A 1WENA 3PURA 5TDWA 3SOXA 1BY8A 2B1MA 2MNYA 3IUTA 4A0CD 2RI7A 1EWOA 3PUQA 4UP0A 4ZQLA 2CB5A 4YV8A 2VFBA 2YHNA 2ZETC 4HWYA 1ICFA 4A49A 4BS6A 5B8DA 1CSBB 4GNFA 3HCUA 1DVPA 2YJ9A 3BPFA 1VD4A 2QICA 4L58A 4ZUXU 2BDLA 2IPPB 3KQIA 2JQFR 4GNGA 1K2FA 4Q8HA 5EF4A 1U5IA 1PBHA 2LXPC 3IV2A 5CVMA 2AU1A 4YAXA 2I50A 3S3QA 2ECVA 2KWJA 1PPDA 1WEWA 2DCAA 5CHTA 4G54A 5D1LB 3HWNA 1GECE 1AU3A 3U5MA 1ME4A 3ZPV1 2DC6A 2KU3A 2VPBA 4N4ZA 2VJEB 2AYOA 2NAAA 2L80A 3SOUA 5LCWB 4W5BA 3TNXA 5FEYA 5CHVA 3LTWA 4W5CA 3HCTA 1JM7B 4LJNA 1BP4A 3H89A 4BBQA 2MIQA 2YUCA 1XKGA 4CCGX 4Q6FA 2ARYA 2R9OA 5LKUA 3LQHA 2E01A 4KLBA 5C11A 3V6EA 2KFTA 2ECJA 1MDWA 5F02A 2PADA 3M62A 3PW3A 4PP1A 3KV6A 3KW9A 3RVXA 4WZ2A 2G43A 4ZDTA 3GV4A 5B75A 1VJVA 4YYRA 5CVNB 1CPJA 1KFXL 3LQIA 2EA6A 3ASLA 4I7BA 1Y08A 2K17A 3C9EA 2O6XA 3EB6A 2MUMA 2KWOA 2B1NA 1NB5A 2EODA 2HYED 1KXRA 1WEMA 2C2LA 2XB1A 1HYJA 4PP2E 4QH6A 1NPZA 4C5PA 2DZZA 3M63A 4R8PK 3E1ZB 4X6HA 3P5VA 5G04B 3QZVA 5J3XA 4C9ZA 4BGFA 2NQDB 4R7EA 4CZWA 2KE1A 4OELA 2E02A 2G7YA 1Z2QA 4P5OB 5B78A 1FP0A 5DKAA 4CDFB 2F6NA 1BGOA 2E6SA 2YSJA 2K1JA 3NG2A 2CT2A 5FPWA 1NB3A 4V3KC 3BPMA 4LK9A 3QSDA 1ZBDB 1SP4B 1EWLA 4BPVA 2ACTA 1MM2A 1VYXA 1Q6KA 4N8WA 3DPLR 1W6FA 3BCNA 4B86C 2G6DA 2YJ2A 1SNKA 1AYVA 4QBBA 4X6IA 2BAYA 3C6WA 1WESA 3KSEA 1QXPA 3IMAA 3BWKA 4FO9A 3KFQA 5TRBA 4I05A 2L5UA 1XWHA 5D1KB 1MM3A 1PIPA 1V87A 3K8UA 4MZSA 1WFKA 4TKPB 2AIMA 1G25A 3CBKA 4YYSA 1KFUL 1FBVA 1X4UA 5DINA 1WIMA 2PREA 2DCCA 4YABA 1F62A 4BHWA 1GX3A 2E03A 3HCSA 1U9XA 2DCBA 3MORA 4GB0A 1JM7A 4CDCB 1WGMA 3N9QA 5H1UA 1AU2A 1S4VA 2F42A 1WILA 1O0EA 4XUIA 2XU4A 2WBFX 4I07A 2YREA 4LKAA 3S3RA 1CTEA 1HUCB 1TU6A 2MD7B 4R2YA 4O64A 2C0YA 2H0DB 5C13A 3O36A 4YVAA 4LADB 5H9MA 5H1VA 1PE6A 2YQMA 3ZVZB 2OXQC 2CIOA 2KGIA 1AU0A 1JQPA 2OZ2A 1BQIA 2YURA 2H7JA 5B77A 3ZTGA 1EWPA 4X3GA 4A4CA 1FH0A 3KNVA 6PADA 3T7LA 3LXSA 3CBJA 5TDRA 4B7YC 1F2CA 1QOLA 3N3KA 1U6GB 2FYEA 2YU4A 2DX8A 2AYNA 2DC8A 2DJGB 4YBTA 2XU1A 2Y6EA 4BS5A 1DF0A 3K24A 3U5NA 3OF8A 3O33A 1ZCMA 1N87A 2M6MA 1W4TA 1ITOA 2ECWA 3QJ3A 3I06A 2AS8A 3O34A 1WEOA 3O0UA 1YALA 2RSDA 4MVTA 3CH2X 3IOQA 1BORA 5AIUA 2NQIA 2FQ9A 4CDEB 4CA1A 3ZYQA 2VNFA 1AYWA 2JMIA 2L43A 2QIZA 5JA7A 2R9FA 1GMYA 5EYAF 1YVBA 1PPOA 4NV8A 3OVXA 2HHNA 2YSMA 2G8JA 4GUZA 4FK5A 2LGKA 2MA6A 4NN2A 3N9OA 2BSZA 1EF7A 1T1HA 4PPEA 2VHSA 3ZPVE 3HTKC 3BOWA 4LLBA 1DEUA 8PCHA 2F7DA 2YJBA 2YHOA 4XI1A 1CS8A 3I2DA 1AU4A 3GCBA 3M99A 1CB5A 4UP5A 4CDDB 2HDPA 3CH3X 3USVA 4BQVA 3N9NA 3SOWA 3O7AA 3AI8A 5J94A 4PI3A 2E00A 4QRVA 2MNZA 3KKUA 2NQGA 2M3HA 4X6JA 2VJFA 4FJCA 3H8BA 4YYQA 1AIMA 3O70A 1A6RA 4UI9B 1U9WA 2FTDA 2PBHA 2XU3A 3KWBX 2R9MA 2K4DA 3L11A 2DZYA 3RVVA 2ECIA 2G45A 3O1GA 3ZNIA 3PBHA 5JH3A 2R6NA 5KH7A 3N4CA 1M6DA 5TABA 3N9PA 2JMDA 1CV8A 3KX1A 2AN6A 1KHQA 1PXVA 1MEGA 1THEA 4S3OB 2XEUA 1QMYA 3U5PA 5FB1A 2VPDA 2XU5A 2P0RA 3KWZA 5H1TA 4AUQB 2JQGR 5EGWA 3HHAA 1MS6A 2NQAA 2PUYA 5AITA 2PNXA 2LRIC 2QJ0A 4QF2A 3MTNA 3U8EA 3P5UA 1JOCA 3LQJA 2IBIA 2KYUA 4QF3A 1IWDA 3RPGC 3V43A 3HHIA 1F2AA 1KHPA 2YW8A 4YBMA 4I7DA 5LKTA 4L7XA 1E4UA 4N79A 2CSZA 1WEQA 2F1GA 4AXLA 5JG6A 4QRGA 1PPNA 2UZGA 2MA5A 3BC3A 5B79A 2KWKA 1GCBA 5K16A 3OF9A 3ZUAA 1X4JA 1YT7A 2H0DA 1HYIA 1CVZA 3PNRA 4Q8GA 1NLJA 1X4IA 1QDQA 3EB5A 2OP3A 4N4FA 1STFE 2Y43A 3O35A 1TL9A 1AECA 2ECTA 3N9LA 4S3OC 2LGLA 2DC7A 4AYCB 2Y5BA 3GL6A 4F52B 1VSNA 1MEMA 2CSYA 2FUDA 1MHWA 2DC9A 5FB0A 3F5VA 2KIZA 3V6CA 2PNSA 2YQLA 4I04A 3VK6A 3WXGA 2ATOA 2KWNA 4MZOA 3C5KA 4I7CA 5LKXA 3PHDA 1Y4HA 3N9MA 1U9QX 3WXEA 1YK8A 4YADA 2D8SA 1TLOA 2FUUA 2LDRA 2FRQA 4AP4A 2Y1MA 1WEPA 1RMDA 3N3GA 2LN0A 4AYCA 2KR4A 3KV5A 3IHPA 1ZIVA 3DF0A 2AUZA 4A4BA 4YC9A 2FRAA 5TBNA 4QRXA 3D9WA 2F6JA 5D1MB 1W5RA 2YYRA 1WEVA 4MSXA 2AVWA 1WE9A 4PTBA 4XR7A 3FL2A 2VPEA 5A24A 5PADA 5KH9A 2FUIA 1LDKC 1PADA 1E2TA 2MD8C 5LKZA 1EWMA 3LFYA 2GHUA 1F2BA 2P86A 2R9CA 3RTRB 1MIRA 2L75A 3SHBA 2VJFB 4YATA 3U5OA 2ECNA 2FO5A 4YYVA 1YK7A 2LGGA 3MHHA 3OISA 1IYMA 2LQ6A 2LGVA 3RVWA 3ERVA 7PCKA 3ZVYA 1GLOA 4P6EA 1VFYA 2HH5A 4RY2A 1F29A 3L1XA 2LXHC 2BDZA 4GNEA 1ATKA 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K16 A;  4V3L C;  1K3B B;  2R9N A;  9PAP A;  1AYU A;  2CKL A;  3NHE A;  2G6Q A;  4YBS A;  3O37 A;  2YJC A;  5G05 B;  5FER A;  5B76 A;  1U9V A;  2M85 A;  2E6R A;  2KGG A;  2VPG A;  3DQV R;  2ECG A;  3T6R A;  1CHC A;  2HXZ A;  3OVZ A;  2DJF B;  1NL6 A;  3H7D A;  2VP7 A;  3P5X A;  4FIP A;  4BSQ A;  2C2V S;  2VHF A;  4WZ3 B;  3HD3 A;  2DCD A;  2HD5 A;  2JRJ A;  4GND A;  5G0F A;  4YYW A;  2KRE A;  4PAD A;  1PPP A;  1NQC A;  4IC2 A;  3P5W A;  2YT5 A;  4YYU A;  4AXM A;  2M1R A;  4K7C A;  1POP A;  2P7U A;  5I3L A;  1CJL A;  5CVO B;  4WA6 A;  1Z6U A;  2MT5 A;  3H6S A;  4W4U A;  4OEM A;  4P6G A;  4DMX A;  3QT4 A;  2AUX A;  3I3T A;  2L0B A;  3F75 A;  3IEJ A;  2VJE A;  2FT2 A;  3LRQ A;  2JMJ A;  2GFO A;  5KH3 A;  2CKL B;  2OUL A;  3B79 A;  1LDJ B;  1PCI A;  1X9Y A;  2YJ8 A;  2EGP A;  2G8E A;  3WXF A;  2LV9 A;  4DMY A;  3H8C A;  2Y1N A;  4WZ0 A;  3K9M A;  4IC3 A;  4N3W A;  2IDA A;  1WEU A;  3MHS A;  4AVX A;  3RPG B;  3D6S A;  1WEE A;  2FSA A;  1CQD A;  1Z60 A;  3PDF A;  1ME3 A;  1WEN A;  3PUR A;  5TDW A;  3SOX A;  1BY8 A;  2B1M A;  2MNY A;  3IUT A;  4A0C D;  2RI7 A;  1EWO A;  3PUQ A;  4UP0 A;  4ZQL A;  2CB5 A;  4YV8 A;  2YHN A;  2ZET C;  4HWY A;  1ICF A;  4A49 A;  4BS6 A;  5B8D A;  1CSB B;  4GNF A;  3HCU A;  1DVP A;  2YJ9 A;  3BPF A;  1VD4 A;  2QIC A;  4L58 A;  4ZUX U;  2BDL A;  2IPP B;  3KQI A;  2JQF R;  4GNG A;  1K2F A;  4Q8H A;  5EF4 A;  1U5I A;  1PBH A;  2LXP C;  3IV2 A;  5CVM A;  2AU1 A;  4YAX A;  2I50 A;  3S3Q A;  2ECV A;  2KWJ A;  1PPD A;  1WEW A;  2DCA A;  5CHT A;  4G54 A;  5D1L B;  3HWN A;  1GEC E;  1AU3 A;  3U5M A;  1ME4 A;  3ZPV 1;  2DC6 A;  2KU3 A;  2VPB A;  4N4Z A;  2VJE B;  2AYO A;  2NAA A;  2L80 A;  3SOU A;  5LCW B;  4W5B A;  3TNX A;  5FEY A;  5CHV A;  4W5C A;  3HCT A;  1JM7 B;  4LJN A;  1BP4 A;  3H89 A;  4BBQ A;  2MIQ A;  2YUC A;  1XKG A;  4CCG X;  4Q6F A;  2ARY A;  2R9O A;  5LKU A;  3LQH A;  2E01 A;  4KLB A;  5C11 A;  3V6E A;  2KFT A;  2ECJ A;  1MDW A;  5F02 A;  2PAD A;  3M62 A;  3PW3 A;  4PP1 A;  3KV6 A;  3KW9 A;  3RVX A;  4WZ2 A;  2G43 A;  4ZDT A;  3GV4 A;  5B75 A;  1VJV A;  4YYR A;  5CVN B;  1CPJ A;  1KFX L;  3LQI A;  2EA6 A;  3ASL A;  4I7B A;  1Y08 A;  2K17 A;  3C9E A;  2O6X A;  3EB6 A;  2MUM A;  2KWO A;  2B1N A;  1NB5 A;  2EOD A;  2HYE D;  1KXR A;  1WEM A;  2C2L A;  2XB1 A;  1HYJ A;  4PP2 E;  4QH6 A;  1NPZ A;  2DZZ A;  3M63 A;  4R8P K;  3E1Z B;  4X6H A;  3P5V A;  5G04 B;  3QZV A;  5J3X A;  4C9Z A;  2NQD B;  4R7E A;  4CZW A;  2KE1 A;  4OEL A;  2E02 A;  2G7Y A;  1Z2Q A;  4P5O B;  5B78 A;  1FP0 A;  5DKA A;  4CDF B;  2F6N A;  1BGO A;  2E6S A;  2YSJ A;  2K1J A;  3NG2 A;  2CT2 A;  5FPW A;  1NB3 A;  4V3K C;  3BPM A;  4LK9 A;  3QSD A;  1ZBD B;  1SP4 B;  1EWL A;  4BPV A;  2ACT A;  1MM2 A;  1VYX A;  1Q6K A;  4N8W A;  3DPL R;  3BCN A;  4B86 C;  2G6D A;  2YJ2 A;  1SNK A;  1AYV A;  4QBB A;  4X6I A;  2BAY A;  3C6W A;  1WES A;  3KSE A;  1QXP A;  3IMA A;  3BWK A;  4FO9 A;  3KFQ A;  5TRB A;  4I05 A;  2L5U A;  1XWH A;  5D1K B;  1MM3 A;  1PIP A;  1V87 A;  3K8U A;  4MZS A;  1WFK A;  4TKP B;  2AIM A;  1G25 A;  3CBK A;  4YYS A;  1KFU L;  1FBV A;  1X4U A;  5DIN A;  1WIM A;  2PRE A;  2DCC A;  4YAB A;  1F62 A;  4BHW A;  2E03 A;  3HCS A;  1U9X A;  2DCB A;  3MOR A;  4GB0 A;  1JM7 A;  4CDC B;  1WGM A;  3N9Q A;  5H1U A;  1AU2 A;  1S4V A;  2F42 A;  1WIL A;  1O0E A;  4XUI A;  2XU4 A;  2WBF X;  4I07 A;  2YRE A;  4LKA A;  3S3R A;  1CTE A;  1HUC B;  1TU6 A;  2MD7 B;  4R2Y A;  4O64 A;  2C0Y A;  2H0D B;  5C13 A;  3O36 A;  4YVA A;  4LAD B;  5H9M A;  5H1V A;  1PE6 A;  2YQM A;  3ZVZ B;  2OXQ C;  2CIO A;  2KGI A;  1AU0 A;  1JQP A;  2OZ2 A;  1BQI A;  2YUR A;  2H7J A;  5B77 A;  3ZTG A;  1EWP A;  4X3G A;  4A4C A;  1FH0 A;  3KNV A;  6PAD A;  3T7L A;  3LXS A;  3CBJ A;  5TDR A;  4B7Y C;  1F2C A;  1QOL A;  3N3K A;  1U6G B;  2FYE A;  2YU4 A;  2DX8 A;  2AYN A;  2DC8 A;  2DJG B;  4YBT A;  2XU1 A;  2Y6E A;  4BS5 A;  1DF0 A;  3K24 A;  3U5N A;  3OF8 A;  3O33 A;  1ZCM A;  1N87 A;  2M6M A;  1ITO A;  2ECW A;  3QJ3 A;  3I06 A;  2AS8 A;  3O34 A;  1WEO A;  3O0U A;  1YAL A;  2RSD A;  4MVT A;  3CH2 X;  3IOQ A;  1BOR A;  5AIU A;  2NQI A;  2FQ9 A;  4CDE B;  4CA1 A;  3ZYQ A;  2VNF A;  1AYW A;  2JMI A;  2L43 A;  2QIZ A;  5JA7 A;  2R9F A;  1GMY A;  5EYA F;  1YVB A;  1PPO A;  3OVX A;  2HHN A;  2YSM A;  2G8J A;  4FK5 A;  2LGK A;  2MA6 A;  4NN2 A;  3N9O A;  1EF7 A;  1T1H A;  4PPE A;  2VHS A;  3ZPV E;  3HTK C;  3BOW A;  4LLB A;  1DEU A;  8PCH A;  2F7D A;  2YJB A;  2YHO A;  4XI1 A;  1CS8 A;  3I2D A;  1AU4 A;  3GCB A;  3M99 A;  1CB5 A;  4UP5 A;  4CDD B;  2HDP A;  3CH3 X;  3USV A;  4BQV A;  3N9N A;  3SOW A;  3O7A A;  3AI8 A;  5J94 A;  4PI3 A;  2E00 A;  4QRV A;  2MNZ A;  3KKU A;  2NQG A;  2M3H A;  4X6J A;  2VJF A;  4FJC A;  3H8B A;  4YYQ A;  1AIM A;  3O70 A;  1A6R A;  4UI9 B;  1U9W A;  2FTD A;  2PBH A;  2XU3 A;  3KWB X;  2R9M A;  2K4D A;  3L11 A;  2DZY A;  3RVV A;  2ECI A;  2G45 A;  3O1G A;  3ZNI A;  3PBH A;  5JH3 A;  2R6N A;  5KH7 A;  3N4C A;  1M6D A;  5TAB A;  3N9P A;  2JMD A;  1CV8 A;  3KX1 A;  2AN6 A;  1KHQ A;  1PXV A;  1MEG A;  1THE A;  4S3O B;  2XEU A;  1QMY A;  3U5P A;  5FB1 A;  2VPD A;  2XU5 A;  2P0R A;  3KWZ A;  5H1T A;  4AUQ B;  2JQG R;  5EGW A;  3HHA A;  1MS6 A;  2NQA A;  2PUY A;  5AIT A;  2PNX A;  2LRI C;  2QJ0 A;  4QF2 A;  3MTN A;  3U8E A;  3P5U A;  1JOC A;  3LQJ A;  2IBI A;  2KYU A;  4QF3 A;  1IWD A;  3RPG C;  3V43 A;  3HHI A;  1F2A A;  1KHP A;  2YW8 A;  4YBM A;  4I7D A;  5LKT A;  4L7X A;  1E4U A;  4N79 A;  2CSZ A;  1WEQ A;  2F1G A;  4AXL A;  5JG6 A;  4QRG A;  1PPN A;  2UZG A;  2MA5 A;  3BC3 A;  5B79 A;  2KWK A;  1GCB A;  5K16 A;  3OF9 A;  3ZUA A;  1X4J A;  1YT7 A;  2H0D A;  1HYI A;  1CVZ A;  3PNR A;  4Q8G A;  1NLJ A;  1X4I A;  1QDQ A;  3EB5 A;  2OP3 A;  4N4F A;  1STF E;  2Y43 A;  3O35 A;  1TL9 A;  1AEC A;  2ECT A;  3N9L A;  4S3O C;  2LGL A;  2DC7 A;  4AYC B;  2Y5B A;  3GL6 A;  4F52 B;  1VSN A;  1MEM A;  2CSY A;  2FUD A;  1MHW A;  2DC9 A;  5FB0 A;  3F5V A;  2KIZ A;  3V6C A;  2PNS A;  2YQL A;  4I04 A;  3VK6 A;  3WXG A;  2ATO A;  2KWN A;  4MZO A;  3C5K A;  4I7C A;  5LKX A;  3PHD A;  1Y4H A;  3N9M A;  1U9Q X;  3WXE A;  1YK8 A;  4YAD A;  2D8S A;  1TLO A;  2FUU A;  2LDR A;  2FRQ A;  4AP4 A;  2Y1M A;  1WEP A;  1RMD A;  3N3G A;  2LN0 A;  4AYC A;  2KR4 A;  3KV5 A;  3IHP A;  1ZIV A;  3DF0 A;  2AUZ A;  4A4B A;  4YC9 A;  2FRA A;  5TBN A;  4QRX A;  2F6J A;  5D1M B;  2YYR A;  1WEV A;  4MSX A;  2AVW A;  1WE9 A;  4PTB A;  4XR7 A;  3FL2 A;  2VPE A;  5A24 A;  5PAD A;  5KH9 A;  2FUI A;  1LDK C;  1PAD A;  2MD8 C;  5LKZ A;  1EWM A;  3LFY A;  2GHU A;  1F2B A;  2P86 A;  2R9C A;  3RTR B;  1MIR A;  2L75 A;  3SHB A;  2VJF B;  4YAT A;  3U5O A;  2ECN A;  2FO5 A;  4YYV A;  1YK7 A;  2LGG A;  3MHH A;  3OIS A;  1IYM A;  2LQ6 A;  2LGV A;  3RVW A;  3ERV A;  7PCK A;  3ZVY A;  1GLO A;  4P6E A;  1VFY A;  2HH5 A;  4RY2 A;  1F29 A;  3L1X A;  2LXH C;  2BDZ A;  4GNE A;  1ATK A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 2K16 A;  4V3L C;  1K3B B;  2J7Q A;  2R9N A;  3MTV A;  9PAP A;  1AYU A;  2CKL A;  3NHE A;  2G6Q A;  4YBS A;  3O37 A;  2YJC A;  5G05 B;  5FER A;  3FAO A;  5B76 A;  1U9V A;  2M85 A;  2E6R A;  2KGG A;  2VPG A;  3DQV R;  4REZ A;  2ECG A;  3T6R A;  1CHC A;  2HXZ A;  3OVZ A;  2DJF B;  3PHX A;  1NL6 A;  3H7D A;  2VP7 A;  3P5X A;  4FIP A;  4BSQ A;  2M13 A;  4OVZ A;  2C2V S;  2VHF A;  4WZ3 B;  3HD3 A;  2DCD A;  2HD5 A;  2JRJ A;  2FFW A;  4GND A;  5G0F A;  2KRE A;  4PAD A;  4YYW A;  1PPP A;  4BOZ A;  1NQC A;  4IC2 A;  3BBA A;  2YT5 A;  3P5W A;  4YYU A;  3M7K A;  3FM8 C;  4AXM A;  2M1R A;  4K7C A;  1POP A;  2P7U A;  2P57 A;  5I3L A;  1CJL A;  5CVO B;  2KKX A;  4WA6 A;  1Z6U A;  2MT5 A;  3H6S A;  4W4U A;  4OEM A;  4P6G A;  4DMX A;  3QT4 A;  2AUX A;  2BTW B;  2YVR A;  3I3T A;  2L0B A;  3F75 A;  3IEJ A;  2VJE A;  2FT2 A;  3LRQ A;  2JMJ A;  2GFO A;  5KH3 A;  2CKL B;  2OUL A;  3B79 A;  1LDJ B;  1PCI A;  1X9Y A;  2YJ8 A;  3BB7 A;  2EGP A;  2UZJ A;  2RR4 A;  2G8E A;  3WXF A;  2LV9 A;  4DMY A;  3H8C A;  2Y1N A;  4WZ0 A;  3C0R A;  3K9M A;  4IC3 A;  4N3W A;  2IDA A;  1WEU A;  3MHS A;  4OGE A;  4AVX A;  3W31 A;  3RPG B;  3D6S A;  2EXU A;  1WEE A;  2FSA A;  4P16 A;  1CQD A;  1Z60 A;  3PDF A;  1ME3 A;  4D8I A;  1WEN A;  3PUR A;  5TDW A;  3SOX A;  1BY8 A;  2B1M A;  2MNY A;  3IUT A;  2CRR A;  4A0C D;  2RI7 A;  1EWO A;  3PUQ A;  4UP0 A;  4ZQL A;  2CB5 A;  4YV8 A;  2YHN A;  2ZET C;  4HWY A;  2IQJ A;  1ICF A;  4A49 A;  4BS6 A;  4BOP A;  5B8D A;  1CSB B;  3PHW A;  4GNF A;  3HCU A;  1DVP A;  2CRW A;  2YJ9 A;  3BPF A;  1VD4 A;  2QIC A;  4L58 A;  4ZUX U;  2BDL A;  2IPP B;  4IP3 A;  3KQI A;  2BTW A;  2JQF R;  4GNG A;  2JM3 A;  1K2F A;  4Q8H A;  5EF4 A;  1U5I A;  1PBH A;  2LXP C;  3IV2 A;  5CVM A;  2AU1 A;  4YAX A;  2I50 A;  3S3Q A;  2ECV A;  2KWJ A;  1PPD A;  1WEW A;  2LAU A;  3BY4 A;  2DCA A;  3PT2 A;  5CHT A;  4G54 A;  5D1L B;  5EZQ A;  3HWN A;  2D8U A;  4IUM A;  1GEC E;  1AU3 A;  3U5M A;  1ME4 A;  4Z0R A;  3ZPV 1;  2DC6 A;  2KU3 A;  2VPB A;  4N4Z A;  2VJE B;  2AYO A;  2NAA A;  2L80 A;  3SOU A;  5LCW B;  4W5B A;  3TNX A;  5FEY A;  5CHV A;  4W5C A;  3HCT A;  1JM7 B;  4LJN A;  1BP4 A;  3H89 A;  4PT5 A;  4BBQ A;  2MIQ A;  2YUC A;  1XKG A;  4CCG X;  4Q6F A;  2ARY A;  2R9O A;  3MDB C;  3LQH A;  5LKU A;  2E01 A;  5C11 A;  4KLB A;  3V6E A;  2KFT A;  2ECJ A;  1MDW A;  5F02 A;  2PAD A;  3H7H A;  3M62 A;  3PW3 A;  4PP1 A;  3KV6 A;  3SUB A;  3KW9 A;  3RVX A;  4WZ2 A;  2G43 A;  4ZDT A;  3GV4 A;  5B75 A;  1VJV A;  4MM3 B;  4YYR A;  5CVN B;  1CPJ A;  1KFX L;  3LQI A;  2EA6 A;  3ASL A;  4I7B A;  1Y08 A;  2K17 A;  3C9E A;  2O6X A;  3EB6 A;  2MUM A;  2KWO A;  2B1N A;  1NB5 A;  2EOD A;  2HYE D;  1KXR A;  1WEM A;  2C2L A;  2XB1 A;  1HYJ A;  2OWA A;  1MBM A;  4PP2 E;  4QH6 A;  4RKX A;  1NPZ A;  1DKI A;  2J7Q C;  2DZZ A;  3M63 A;  4R8P K;  3E1Z B;  4X6H A;  3P5V A;  5G04 B;  3QZV A;  5J3X A;  4C9Z A;  5SVY A;  2NQD B;  4R7E A;  4CZW A;  2KE1 A;  4OEL A;  2E02 A;  2G7Y A;  1Z2Q A;  4P5O B;  5B78 A;  3OQC A;  1FP0 A;  5DKA A;  4CDF B;  2F6N A;  1BGO A;  2E6S A;  2YSJ A;  2K1J A;  3NG2 A;  2CT2 A;  5FPW A;  1NB3 A;  4V3K C;  3BPM A;  4LK9 A;  3QSD A;  3PRP A;  1ZBD B;  1SP4 B;  1EWL A;  2JRI A;  3FJU B;  4BPV A;  2ACT A;  1MM2 A;  1VYX A;  2HWK A;  1Q6K A;  4N8W A;  3DPL R;  3BCN A;  4B86 C;  3O47 A;  2G6D A;  2YJ2 A;  1SNK A;  1AYV A;  4QBB A;  4X6I A;  2BAY A;  3C6W A;  1WES A;  3E9S A;  3KSE A;  1QXP A;  3IMA A;  3BWK A;  4FO9 A;  3KFQ A;  5TRB A;  4I05 A;  2L5U A;  5D1K B;  1XWH A;  1MM3 A;  1PIP A;  1V87 A;  3JUE A;  3K8U A;  1WFK A;  4TKP B;  4MZS A;  4RNA A;  2AIM A;  4D8E A;  1G25 A;  5EZS A;  3CBK A;  4YYS A;  4OGC A;  1KFU L;  1FBV A;  1X4U A;  5DIN A;  1WIM A;  2PRE A;  2DCC A;  2EGM A;  2DOS A;  2B0O E;  4YAB A;  1F62 A;  4BHW A;  1UKF A;  2E03 A;  3HCS A;  1U9X A;  2DCB A;  3MOR A;  4GB0 A;  1JM7 A;  3MJ5 A;  4CDC B;  1WGM A;  3N9Q A;  1PVJ A;  5H1U A;  1AU2 A;  1S4V A;  2F42 A;  2L7P A;  1WIL A;  1O0E A;  4XUI A;  2XU4 A;  2WBF X;  4I07 A;  2YRE A;  3LDY A;  4LKA A;  3S3R A;  1CTE A;  1HUC B;  1TU6 A;  2MD7 B;  4R2Y A;  4O64 A;  5JZE A;  5SVI B;  3KDE C;  2C0Y A;  2H0D B;  5C13 A;  3O36 A;  4YVA A;  4LAD B;  5H9M A;  5H1V A;  1PE6 A;  2FE8 A;  2YQM A;  3ZVZ B;  2OXQ C;  2CIO A;  2KGI A;  1AU0 A;  1JQP A;  2OZ2 A;  1BQI A;  2YUR A;  2H7J A;  2BU3 A;  5B77 A;  4HXD B;  3ZTG A;  1EWP A;  4BOS A;  4X3G A;  4A4C A;  1FH0 A;  3KNV A;  3DDT A;  6PAD A;  3T7L A;  3LXS A;  3CBJ A;  4ZTB A;  5TDR A;  4B7Y C;  1F2C A;  1QOL A;  3N3K A;  1U6G B;  2DJA A;  2YU4 A;  2DX8 A;  2AYN A;  2DC8 A;  2JUN A;  4YBT A;  2DJG B;  2FYE A;  2XU1 A;  2Y6E A;  4BS5 A;  3FEH A;  1DF0 A;  3TMP A;  3K24 A;  3U5N A;  3OF8 A;  3O33 A;  1ZCM A;  1N87 A;  2M6M A;  1ITO A;  2ECW A;  3QJ3 A;  3I06 A;  2AS8 A;  3O34 A;  1WEO A;  3O0U A;  1YAL A;  2RSD A;  4MVT A;  3CH2 X;  3IOQ A;  3LVR E;  1BOR A;  5AIU A;  2NQI A;  2FQ9 A;  4CDE B;  4CA1 A;  3ZYQ A;  2VNF A;  1AYW A;  2JMI A;  2L43 A;  2QIZ A;  5JA7 A;  2R9F A;  2XOY A;  3O65 A;  5K3Q A;  1GMY A;  3MP2 A;  5EYA F;  4D8B A;  1YVB A;  1PPO A;  3OVX A;  2HHN A;  2YSM A;  2G8J A;  4FK5 A;  4BOQ A;  3LJU X;  2LGK A;  2MA6 A;  4NN2 A;  3N9O A;  1EF7 A;  1T1H A;  3PLW A;  4PPE A;  2VHS A;  3ZPV E;  1DCQ A;  3HTK C;  3B21 A;  3BOW A;  4LLB A;  1DEU A;  8PCH A;  2F7D A;  2YJB A;  2YHO A;  4XI1 A;  1CS8 A;  3I2D A;  1AU4 A;  3GCB A;  3M99 A;  1CB5 A;  4UP5 A;  4CDD B;  2HDP A;  3CH3 X;  3USV A;  4BQV A;  3N9N A;  3SOW A;  3O7A A;  3AI8 A;  5J94 A;  4PI3 A;  2E00 A;  3PHU A;  4QRV A;  2MNZ A;  3KKU A;  2NQG A;  2M3H A;  4X6J A;  2VJF A;  4FJC A;  3H8B A;  4YYQ A;  1AIM A;  3ZNH A;  3O70 A;  1A6R A;  4QQ4 A;  4Z0O A;  4UI9 B;  1U9W A;  2FTD A;  2PBH A;  2XU3 A;  3KWB X;  2R9M A;  2K4D A;  3L11 A;  2DZY A;  4M0W A;  4OVZ B;  2ECI A;  3RVV A;  2G45 A;  4R3D A;  3O1G A;  3ZNI A;  3PBH A;  5JH3 A;  2R6N A;  5KH7 A;  3N4C A;  1M6D A;  5TAB A;  4XZX A;  3N9P A;  2JMD A;  1CV8 A;  3KX1 A;  3E2D A;  2AN6 A;  1KHQ A;  1PXV A;  1MEG A;  1THE A;  4S3O B;  2XEU A;  1QMY A;  3U5P A;  4H9D A;  5FB1 A;  2VPD A;  2XU5 A;  3PSE A;  2P0R A;  3KWZ A;  5H1T A;  4MI7 A;  4AUQ B;  2JQG R;  5EGW A;  3HHA A;  1MS6 A;  2AGA A;  2NQA A;  3W30 A;  2PUY A;  4BOU A;  5AIT A;  2PNX A;  2LRI C;  2QJ0 A;  4QF2 A;  2Z84 A;  3MTN A;  3U8E A;  4F1P A;  3P5U A;  1JOC A;  3LQJ A;  2IBI A;  2KYU A;  4QF3 A;  1IWD A;  3RNV A;  3RPG C;  3V43 A;  5E6J A;  3HHI A;  1F2A A;  1KHP A;  2YW8 A;  3Q1D A;  4YBM A;  4I7D A;  5LKT A;  4L7X A;  1E4U A;  4N79 A;  2CSZ A;  1WEQ A;  4RF1 A;  2F1G A;  4AXL A;  5JG6 A;  4QRG A;  1PPN A;  2UZG A;  2MA5 A;  3BC3 A;  5B79 A;  4OW0 A;  2KWK A;  1GCB A;  5K16 A;  5SVI A;  3OF9 A;  3ZUA A;  1X4J A;  2MKE A;  1YT7 A;  4O62 A;  2H0D A;  1HYI A;  1CVZ A;  3PNR A;  4Q8G A;  1NLJ A;  1X4I A;  1QDQ A;  3LVQ E;  3EB5 A;  2OP3 A;  4N4F A;  1STF E;  2Y43 A;  3O35 A;  1TL9 A;  1AEC A;  2ECT A;  3T9K A;  3N9L A;  4S3O C;  2CON A;  2LGL A;  2DC7 A;  4AYC B;  2Y5B A;  3GL6 A;  4F52 B;  1VSN A;  3DWD A;  3FAN A;  1MEM A;  2CSY A;  3IFU A;  2FUD A;  1MHW A;  2DC9 A;  5FB0 A;  2FD4 A;  3F5V A;  2KIZ A;  2XOZ A;  3V6C A;  2PNS A;  2YQL A;  4I04 A;  3VK6 A;  3WXG A;  4RF0 A;  2ATO A;  2KWN A;  1YZB A;  3C5K A;  4I7C A;  5LKX A;  4MZO A;  2DSM A;  3PHD A;  1Y4H A;  3N9M A;  1U9Q X;  3WXE A;  1YK8 A;  4YAD A;  2D8S A;  1TLO A;  2FUU A;  2LDR A;  2FRQ A;  4AP4 A;  2Y1M A;  1WEP A;  1RMD A;  3N3G A;  2LN0 A;  4AYC A;  4A5U A;  2KR4 A;  3KV5 A;  3IHP A;  3PRM A;  1ZIV A;  3DF0 A;  2AUZ A;  4A4B A;  4YC9 A;  2FRA A;  5TBN A;  4QRX A;  2F6J A;  5D1M B;  2YYR A;  1WEV A;  4MSX A;  2AVW A;  1WE9 A;  4PTB A;  4XR7 A;  3FL2 A;  2VPE A;  5A24 A;  5PAD A;  5KH9 A;  2FUI A;  1LDK C;  1PAD A;  2E61 A;  2MD8 C;  5LKZ A;  1EWM A;  3LFY A;  2GHU A;  1F2B A;  2P86 A;  2R9C A;  4WUR A;  3RTR B;  1MIR A;  3TRK A;  2L75 A;  3SHB A;  2VJF B;  4YAT A;  3U5O A;  2KKY A;  2XP0 A;  2ECN A;  2FO5 A;  4YYV A;  1YK7 A;  2LGG A;  2XOC A;  3MHH A;  2JTC A;  3OIS A;  1IYM A;  2LQ6 A;  5KO3 A;  2CSV A;  2LGV A;  3RVW A;  3ERV A;  7PCK A;  3ZVY A;  1GLO A;  4P6E A;  4GUA A;  1VFY A;  2HH5 A;  4RY2 A;  1F29 A;  3L1X A;  2LXH C;  2BDZ A;  5SVX A;  4GNE A;  1ATK A;  3L1Z B; 
#chains in the Genus database with same CATH homology
 2K16 A;  4V3L C;  1K3B B;  2R9N A;  9PAP A;  1AYU A;  2CKL A;  3NHE A;  2G6Q A;  4YBS A;  3O37 A;  2YJC A;  5G05 B;  5FER A;  5B76 A;  1U9V A;  2M85 A;  2E6R A;  2KGG A;  2VPG A;  3DQV R;  2ECG A;  3T6R A;  1CHC A;  2HXZ A;  3OVZ A;  2DJF B;  1NL6 A;  3H7D A;  2VP7 A;  3P5X A;  4FIP A;  4BSQ A;  2C2V S;  2VHF A;  4WZ3 B;  3HD3 A;  2DCD A;  2HD5 A;  2JRJ A;  4GND A;  5G0F A;  2VFC A;  2KRE A;  4PAD A;  4YYW A;  1PPP A;  1NQC A;  4IC2 A;  3P5W A;  2YT5 A;  4YYU A;  4AXM A;  2M1R A;  4K7C A;  1POP A;  2P7U A;  4B55 A;  5I3L A;  1CJL A;  5CVO B;  4WA6 A;  1Z6U A;  2MT5 A;  3H6S A;  4W4U A;  4OEM A;  4P6G A;  4DMX A;  3QT4 A;  2AUX A;  3I3T A;  2L0B A;  3F75 A;  3IEJ A;  2VJE A;  2FT2 A;  3LRQ A;  2JMJ A;  2GFO A;  5KH3 A;  2CKL B;  2OUL A;  3B79 A;  1LDJ B;  1PCI A;  1X9Y A;  2YJ8 A;  2EGP A;  2G8E A;  3WXF A;  2LV9 A;  4DMY A;  3H8C A;  2Y1N A;  4WZ0 A;  3K9M A;  4IC3 A;  4N3W A;  2IDA A;  1WEU A;  3MHS A;  4AVX A;  4NV7 A;  3RPG B;  3D6S A;  1WEE A;  2FSA A;  1CQD A;  1Z60 A;  3PDF A;  1ME3 A;  1WEN A;  3PUR A;  5TDW A;  3SOX A;  1BY8 A;  2B1M A;  2MNY A;  3IUT A;  4A0C D;  2RI7 A;  1EWO A;  3PUQ A;  4UP0 A;  4ZQL A;  2CB5 A;  4YV8 A;  2VFB A;  2YHN A;  2ZET C;  4HWY A;  1ICF A;  4A49 A;  4BS6 A;  5B8D A;  1CSB B;  4GNF A;  3HCU A;  1DVP A;  2YJ9 A;  3BPF A;  1VD4 A;  2QIC A;  4L58 A;  4ZUX U;  2BDL A;  2IPP B;  3KQI A;  2JQF R;  4GNG A;  1K2F A;  4Q8H A;  5EF4 A;  1U5I A;  1PBH A;  2LXP C;  3IV2 A;  5CVM A;  2AU1 A;  4YAX A;  2I50 A;  3S3Q A;  2ECV A;  2KWJ A;  1PPD A;  1WEW A;  2DCA A;  5CHT A;  4G54 A;  5D1L B;  3HWN A;  1GEC E;  1AU3 A;  3U5M A;  1ME4 A;  3ZPV 1;  2DC6 A;  2KU3 A;  2VPB A;  4N4Z A;  2VJE B;  2AYO A;  2NAA A;  2L80 A;  3SOU A;  5LCW B;  4W5B A;  3TNX A;  5FEY A;  5CHV A;  3LTW A;  4W5C A;  3HCT A;  1JM7 B;  4LJN A;  1BP4 A;  3H89 A;  4BBQ A;  2MIQ A;  2YUC A;  1XKG A;  4CCG X;  4Q6F A;  2ARY A;  2R9O A;  5LKU A;  3LQH A;  2E01 A;  4KLB A;  5C11 A;  3V6E A;  2KFT A;  2ECJ A;  1MDW A;  5F02 A;  2PAD A;  3M62 A;  3PW3 A;  4PP1 A;  3KV6 A;  3KW9 A;  3RVX A;  4WZ2 A;  2G43 A;  4ZDT A;  3GV4 A;  5B75 A;  1VJV A;  4YYR A;  5CVN B;  1CPJ A;  1KFX L;  3LQI A;  2EA6 A;  3ASL A;  4I7B A;  1Y08 A;  2K17 A;  3C9E A;  2O6X A;  3EB6 A;  2MUM A;  2KWO A;  2B1N A;  1NB5 A;  2EOD A;  2HYE D;  1KXR A;  1WEM A;  2C2L A;  2XB1 A;  1HYJ A;  4PP2 E;  4QH6 A;  1NPZ A;  4C5P A;  2DZZ A;  3M63 A;  4R8P K;  3E1Z B;  4X6H A;  3P5V A;  5G04 B;  3QZV A;  5J3X A;  4C9Z A;  4BGF A;  2NQD B;  4R7E A;  4CZW A;  2KE1 A;  4OEL A;  2E02 A;  2G7Y A;  1Z2Q A;  4P5O B;  5B78 A;  1FP0 A;  5DKA A;  4CDF B;  2F6N A;  1BGO A;  2E6S A;  2YSJ A;  2K1J A;  3NG2 A;  2CT2 A;  5FPW A;  1NB3 A;  4V3K C;  3BPM A;  4LK9 A;  3QSD A;  1ZBD B;  1SP4 B;  1EWL A;  4BPV A;  2ACT A;  1MM2 A;  1VYX A;  1Q6K A;  4N8W A;  3DPL R;  1W6F A;  3BCN A;  4B86 C;  2G6D A;  2YJ2 A;  1SNK A;  1AYV A;  4QBB A;  4X6I A;  2BAY A;  3C6W A;  1WES A;  3KSE A;  1QXP A;  3IMA A;  3BWK A;  4FO9 A;  3KFQ A;  5TRB A;  4I05 A;  2L5U A;  1XWH A;  5D1K B;  1MM3 A;  1PIP A;  1V87 A;  3K8U A;  4MZS A;  1WFK A;  4TKP B;  2AIM A;  1G25 A;  3CBK A;  4YYS A;  1KFU L;  1FBV A;  1X4U A;  5DIN A;  1WIM A;  2PRE A;  2DCC A;  4YAB A;  1F62 A;  4BHW A;  1GX3 A;  2E03 A;  3HCS A;  1U9X A;  2DCB A;  3MOR A;  4GB0 A;  1JM7 A;  4CDC B;  1WGM A;  3N9Q A;  5H1U A;  1AU2 A;  1S4V A;  2F42 A;  1WIL A;  1O0E A;  4XUI A;  2XU4 A;  2WBF X;  4I07 A;  2YRE A;  4LKA A;  3S3R A;  1CTE A;  1HUC B;  1TU6 A;  2MD7 B;  4R2Y A;  4O64 A;  2C0Y A;  2H0D B;  5C13 A;  3O36 A;  4YVA A;  4LAD B;  5H9M A;  5H1V A;  1PE6 A;  2YQM A;  3ZVZ B;  2OXQ C;  2CIO A;  2KGI A;  1AU0 A;  1JQP A;  2OZ2 A;  1BQI A;  2YUR A;  2H7J A;  5B77 A;  3ZTG A;  1EWP A;  4X3G A;  4A4C A;  1FH0 A;  3KNV A;  6PAD A;  3T7L A;  3LXS A;  3CBJ A;  5TDR A;  4B7Y C;  1F2C A;  1QOL A;  3N3K A;  1U6G B;  2FYE A;  2YU4 A;  2DX8 A;  2AYN A;  2DC8 A;  2DJG B;  4YBT A;  2XU1 A;  2Y6E A;  4BS5 A;  1DF0 A;  3K24 A;  3U5N A;  3OF8 A;  3O33 A;  1ZCM A;  1N87 A;  2M6M A;  1W4T A;  1ITO A;  2ECW A;  3QJ3 A;  3I06 A;  2AS8 A;  3O34 A;  1WEO A;  3O0U A;  1YAL A;  2RSD A;  4MVT A;  3CH2 X;  3IOQ A;  1BOR A;  5AIU A;  2NQI A;  2FQ9 A;  4CDE B;  4CA1 A;  3ZYQ A;  2VNF A;  1AYW A;  2JMI A;  2L43 A;  2QIZ A;  5JA7 A;  2R9F A;  1GMY A;  5EYA F;  1YVB A;  1PPO A;  4NV8 A;  3OVX A;  2HHN A;  2YSM A;  2G8J A;  4GUZ A;  4FK5 A;  2LGK A;  2MA6 A;  4NN2 A;  3N9O A;  2BSZ A;  1EF7 A;  1T1H A;  4PPE A;  2VHS A;  3ZPV E;  3HTK C;  3BOW A;  4LLB A;  1DEU A;  8PCH A;  2F7D A;  2YJB A;  2YHO A;  4XI1 A;  1CS8 A;  3I2D A;  1AU4 A;  3GCB A;  3M99 A;  1CB5 A;  4UP5 A;  4CDD B;  2HDP A;  3CH3 X;  3USV A;  4BQV A;  3N9N A;  3SOW A;  3O7A A;  3AI8 A;  5J94 A;  4PI3 A;  2E00 A;  4QRV A;  2MNZ A;  3KKU A;  2NQG A;  2M3H A;  4X6J A;  2VJF A;  4FJC A;  3H8B A;  4YYQ A;  1AIM A;  3O70 A;  1A6R A;  4UI9 B;  1U9W A;  2FTD A;  2PBH A;  2XU3 A;  3KWB X;  2R9M A;  2K4D A;  3L11 A;  2DZY A;  3RVV A;  2ECI A;  2G45 A;  3O1G A;  3ZNI A;  3PBH A;  5JH3 A;  2R6N A;  5KH7 A;  3N4C A;  1M6D A;  5TAB A;  3N9P A;  2JMD A;  1CV8 A;  3KX1 A;  2AN6 A;  1KHQ A;  1PXV A;  1MEG A;  1THE A;  4S3O B;  2XEU A;  1QMY A;  3U5P A;  5FB1 A;  2VPD A;  2XU5 A;  2P0R A;  3KWZ A;  5H1T A;  4AUQ B;  2JQG R;  5EGW A;  3HHA A;  1MS6 A;  2NQA A;  2PUY A;  5AIT A;  2PNX A;  2LRI C;  2QJ0 A;  4QF2 A;  3MTN A;  3U8E A;  3P5U A;  1JOC A;  3LQJ A;  2IBI A;  2KYU A;  4QF3 A;  1IWD A;  3RPG C;  3V43 A;  3HHI A;  1F2A A;  1KHP A;  2YW8 A;  4YBM A;  4I7D A;  5LKT A;  4L7X A;  1E4U A;  4N79 A;  2CSZ A;  1WEQ A;  2F1G A;  4AXL A;  5JG6 A;  4QRG A;  1PPN A;  2UZG A;  2MA5 A;  3BC3 A;  5B79 A;  2KWK A;  1GCB A;  5K16 A;  3OF9 A;  3ZUA A;  1X4J A;  1YT7 A;  2H0D A;  1HYI A;  1CVZ A;  3PNR A;  4Q8G A;  1NLJ A;  1X4I A;  1QDQ A;  3EB5 A;  2OP3 A;  4N4F A;  1STF E;  2Y43 A;  3O35 A;  1TL9 A;  1AEC A;  2ECT A;  3N9L A;  4S3O C;  2LGL A;  2DC7 A;  4AYC B;  2Y5B A;  3GL6 A;  4F52 B;  1VSN A;  1MEM A;  2CSY A;  2FUD A;  1MHW A;  2DC9 A;  5FB0 A;  3F5V A;  2KIZ A;  3V6C A;  2PNS A;  2YQL A;  4I04 A;  3VK6 A;  3WXG A;  2ATO A;  2KWN A;  4MZO A;  3C5K A;  4I7C A;  5LKX A;  3PHD A;  1Y4H A;  3N9M A;  1U9Q X;  3WXE A;  1YK8 A;  4YAD A;  2D8S A;  1TLO A;  2FUU A;  2LDR A;  2FRQ A;  4AP4 A;  2Y1M A;  1WEP A;  1RMD A;  3N3G A;  2LN0 A;  4AYC A;  2KR4 A;  3KV5 A;  3IHP A;  1ZIV A;  3DF0 A;  2AUZ A;  4A4B A;  4YC9 A;  2FRA A;  5TBN A;  4QRX A;  3D9W A;  2F6J A;  5D1M B;  1W5R A;  2YYR A;  1WEV A;  4MSX A;  2AVW A;  1WE9 A;  4PTB A;  4XR7 A;  3FL2 A;  2VPE A;  5A24 A;  5PAD A;  5KH9 A;  2FUI A;  1LDK C;  1PAD A;  1E2T A;  2MD8 C;  5LKZ A;  1EWM A;  3LFY A;  2GHU A;  1F2B A;  2P86 A;  2R9C A;  3RTR B;  1MIR A;  2L75 A;  3SHB A;  2VJF B;  4YAT A;  3U5O A;  2ECN A;  2FO5 A;  4YYV A;  1YK7 A;  2LGG A;  3MHH A;  3OIS A;  1IYM A;  2LQ6 A;  2LGV A;  3RVW A;  3ERV A;  7PCK A;  3ZVY A;  1GLO A;  4P6E A;  1VFY A;  2HH5 A;  4RY2 A;  1F29 A;  3L1X A;  2LXH C;  2BDZ A;  4GNE A;  1ATK A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...