2BU3A

Acyl-enzyme intermediate between alr0975 and glutathione at ph 3.4
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
211
structure length
200
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAYRVFTQDNFFSTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALR0975 PROTEIN
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
total genus 64
structure length 200
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2bu3A00
2BTWA 2BU3A 2BTWB
chains in the Genus database with same CATH superfamily
3RVXA 3ZNHA 1AYWA 1DF0A 4YYVA 2YJ9A 2VHSA 1THEA 2R9OA 3KX1A 2G7YA 4FIPA 1Y08A 3IHPA 1ITOA 2B1MA 2JRIA 4PADA 2BDZA 3LFYA 2AVWA 1MHWA 5EZQA 3H6SA 2C0YA 3CH3X 2HXZA 3USVA 1NB5A 4YYUA 1FH0A 1U9XA 3QJ3A 2HD5A 3M99A 2NQAA 1ATKA 4I04A 4DMYA 1CQDA 2WBFX 1PPDA 2DZYA 1QMYA 3N4CA 1CJLA 1X9YA 2FRQA 1ICFA 3KW9A 4Q8GA 3F5VA 3IFUA 2R9FA 3MTNA 2B1NA 2IPPB 2DZZA 3HHIA 4XR7A 4N8WA 3ERVA 1AU4A 1BQIA 1BGOA 3B79A 3MORA 4CDEB 3BY4A 1M6DA 4BS6A 1STFE 4CDCB 3BPMA 6PADA 4BOPA 3PRMA 2DCDA 5CVOB 3E1ZB 3TNXA 3N3KA 2NQGA 3P5WA 4YV8A 1YZBA 3H7DA 4MSXA 5PADA 1PBHA 3KFQA 4BPVA 4XUIA 3K9MA 4P6EA 3IEJA 3WXEA 3NHEA 3MJ5A 1TU6A 4MZOA 2DC9A 4W4UA 2E01A 3AI8A 3V6EA 4QRXA 3QSDA 3OVXA 4RY2A 3O0UA 2R6NA 1U9VA 3MTVA 4QBBA 1JQPA 2CB5A 3K24A 8PCHA 4ZUXU 3HD3A 1DEUA 2G8EA 3RVWA 4BS5A 4N4ZA 1KFUL 5E6JA 2DJGB 5J94A 3W31A 4MI7A 1EWPA 3K8UA 2YJBA 4WURA 1F2CA 1KFXL 3MHHA 3H89A 4M0WA 2F1GA 1GCBA 2DC7A 4K7CA 4QRVA 2ARYA 1F29A 2XU4A 4IUMA 1PPNA 1AU2A 1KHPA 2FO5A 1YK7A 5JZEA 4AXLA 3PW3A 1PPPA 1GMYA 1TL9A 2E00A 4D8BA 1PIPA 2OP3A 1MEMA 4I07A 4MZSA 4OW0A 1KHQA 2DJFB 3BC3A 1PVJA 2YJ8A 3V6CA 4GUAA 3RVVA 2O6XA 5EGWA 3PRPA 4BOQA 1CS8A 4Q8HA 3CH2X 1MDWA 5CHTA 1ME4A 3GCBA 3OISA 3BBAA 4REZA 4ZTBA 1VJVA 4MM3B 2YJCA 4OELA 3TRKA 4D8EA 3PHWA 3HWNA 1U5IA 1SNKA 2AYNA 3BWKA 1NPZA 1PADA 9PAPA 5A24A 1YT7A 4FJCA 3KKUA 3U8EA 1NL6A 3O65A 1CTEA 4RF1A 1SP4B 1AYUA 1NB3A 1Y4HA 2DC6A 2FYEA 3CBJA 3QT4A 1EWLA 1U9QX 2AUXA 2R9NA 1MS6A 4CZWA 3BOWA 5F02A 1QDQA 2JQGR 2GFOA 2JQFR 1EWOA 2YJ2A 3P5XA 2Z84A 1CB5A 2UZJA 4PI3A 1VSNA 4X6HA 2OZ2A 3S3RA 4X6JA 2G6DA 1EF7A 5EF4A 2NQIA 2DCCA 3MP2A 2E03A 4D8IA 1QXPA 2AGAA 4IP3A 3IV2A 1MEGA 1Q6KA 2P0RA 1CSBB 3OVZA 2DC8A 4BOZA 4KLBA 2DCBA 4QRGA 2R9CA 2AIMA 4RKXA 1UKFA 4BOUA 2J7QA 2BU3A 3E9SA 1K3BB 1ZCMA 3W30A 2BTWA 3P5VA 2GHUA 2HWKA 5CVMA 3D6SA 2XU5A 1AYVA 1DKIA 5JH3A 3OF9A 3O1GA 2Y6EA 1BP4A 4YVAA 2ACTA 4YYQA 3PT2A 1YK8A 1GECE 1YALA 1BY8A 5EZSA 3LXSA 2H7JA 4BSQA 3S3QA 4P16A 2DOSA 2PNSA 4W5CA 1U9WA 2F7DA 2OULA 1AIMA 4DMXA 4QH6A 4HXDB 1CPJA 4RF0A 3P5UA 2PBHA 4P6GA 3PBHA 3PHXA 3RNVA 4G54A 4R3DA 1QOLA 1ME3A 4CDDB 4FK5A 3H8CA 3F75A 3IUTA 2FT2A 1CV8A 1AECA 5FPWA 4RNAA 2ATOA 4XZXA 4I05A 1NLJA 3B21A 4YYRA 2P86A 4BOSA 3CBKA 3PHUA 2XU1A 2FUDA 2AU1A 5CHVA 1PXVA 4OVZA 4YYSA 3BB7A 4PP2E 1F2BA 7PCKA 1YVBA 4W5BA 3I3TA 3KWBX 5CVNB 1GLOA 1F2AA 2R9MA 4WA6A 1AU0A 1IWDA 2JTCA 3OF8A 3BCNA 2BTWB 2DCAA 1NQCA 3OQCA 3C9EA 1CVZA 3IOQA 5K16A 5KO3A 2J7QC 2CIOA 2FQ9A 3KWZA 1A6RA 2P7UA 3TMPA 1O0EA 4BQVA 2NQDB 1EWMA 3BPFA 1POPA 3HHAA 3WXGA 1PCIA 1KXRA 4PT5A 1AU3A 4AXMA 2PADA 3PNRA 1HUCB 3ZUAA 4PP1A 3DF0A 5JA7A 2VHFA 2XU3A 4OEMA 2E02A 4YYWA 1XKGA 2BDLA 1ZIVA 2Y5BA 3PSEA 3PDFA 2AS8A 3I06A 1PPOA 3MHSA 3N3GA 3IMAA 3WXFA 4N79A 1S4VA 4X6IA 2HH5A 2IBIA 4A5UA 3H8BA 2FE8A 4OVZB 1PE6A 1MIRA 2G8JA 4HWYA 3C0RA 2FRAA 2HHNA 3KSEA 2FTDA 2AUZA 2PREA 4CDFB 2AYOA 1TLOA
chains in the Genus database with same CATH topology
3B21A 3O65A 4RF1A 3ZNHA 4BOSA 3MTVA 3PHUA 4OVZA 2JRIA 3BB7A 2Z84A 2UZJA 5E6JA 5EZQA 3W31A 4MI7A 4WURA 2JTCA 3MP2A 2BTWB 4D8IA 2AGAA 4IP3A 4M0WA 3OQCA 4BOZA 4RKXA 1UKFA 4BOUA 2J7QA 5KO3A 2BU3A 3E9SA 2J7QC 4IUMA 3W30A 2BTWA 2HWKA 3TMPA 3IFUA 5JZEA 1DKIA 4D8BA 3PT2A 3BY4A 4PT5A 4OW0A 1PVJA 5EZSA 4GUAA 4P16A 4BOPA 2DOSA 3PRMA 3PRPA 4BOQA 3PSEA 4HXDB 4RF0A 1YZBA 3PHXA 3RNVA 3BBAA 4R3DA 4REZA 4ZTBA 4MM3B 3TRKA 4D8EA 3PHWA 4A5UA 2FE8A 4OVZB 3C0RA 3MJ5A 4RNAA 4XZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTW A;  2BU3 A;  2BTW B; 
#chains in the Genus database with same CATH topology
 3RVX A;  3ZNH A;  1AYW A;  1DF0 A;  4YYV A;  2YJ9 A;  2VHS A;  1THE A;  2R9O A;  3KX1 A;  2G7Y A;  4FIP A;  1Y08 A;  3IHP A;  1ITO A;  2B1M A;  2JRI A;  4PAD A;  2BDZ A;  3LFY A;  2AVW A;  1MHW A;  5EZQ A;  3H6S A;  2C0Y A;  3CH3 X;  2HXZ A;  3USV A;  1NB5 A;  4YYU A;  1FH0 A;  1U9X A;  3QJ3 A;  2HD5 A;  3M99 A;  2NQA A;  1ATK A;  4I04 A;  4DMY A;  1CQD A;  2WBF X;  1PPD A;  2DZY A;  1QMY A;  3N4C A;  1CJL A;  1X9Y A;  2FRQ A;  1ICF A;  3KW9 A;  4Q8G A;  3F5V A;  3IFU A;  2R9F A;  3MTN A;  2B1N A;  2IPP B;  2DZZ A;  3HHI A;  4XR7 A;  4N8W A;  3ERV A;  1AU4 A;  1BQI A;  1BGO A;  3B79 A;  3MOR A;  4CDE B;  3BY4 A;  1M6D A;  4BS6 A;  1STF E;  4CDC B;  3BPM A;  6PAD A;  4BOP A;  3PRM A;  2DCD A;  5CVO B;  3E1Z B;  3TNX A;  3N3K A;  2NQG A;  3P5W A;  4YV8 A;  1YZB A;  3H7D A;  4MSX A;  5PAD A;  1PBH A;  3KFQ A;  4BPV A;  4XUI A;  3K9M A;  4P6E A;  3IEJ A;  3WXE A;  3NHE A;  3MJ5 A;  1TU6 A;  4MZO A;  2DC9 A;  4W4U A;  2E01 A;  3AI8 A;  3V6E A;  4QRX A;  3QSD A;  3OVX A;  4RY2 A;  3O0U A;  2R6N A;  1U9V A;  3MTV A;  4QBB A;  1JQP A;  2CB5 A;  3K24 A;  8PCH A;  4ZUX U;  3HD3 A;  1DEU A;  2G8E A;  3RVW A;  4BS5 A;  4N4Z A;  1KFU L;  5E6J A;  2DJG B;  5J94 A;  3W31 A;  4MI7 A;  1EWP A;  3K8U A;  2YJB A;  4WUR A;  1F2C A;  1KFX L;  3MHH A;  3H89 A;  4M0W A;  2F1G A;  1GCB A;  2DC7 A;  4K7C A;  4QRV A;  2ARY A;  1F29 A;  2XU4 A;  4IUM A;  1PPN A;  1AU2 A;  1KHP A;  2FO5 A;  1YK7 A;  5JZE A;  4AXL A;  3PW3 A;  1PPP A;  1GMY A;  1TL9 A;  2E00 A;  4D8B A;  1PIP A;  2OP3 A;  1MEM A;  4I07 A;  4MZS A;  4OW0 A;  1KHQ A;  2DJF B;  3BC3 A;  1PVJ A;  2YJ8 A;  3V6C A;  4GUA A;  3RVV A;  2O6X A;  5EGW A;  3PRP A;  4BOQ A;  1CS8 A;  4Q8H A;  3CH2 X;  1MDW A;  5CHT A;  1ME4 A;  3GCB A;  3OIS A;  3BBA A;  4REZ A;  4ZTB A;  1VJV A;  4MM3 B;  2YJC A;  4OEL A;  3TRK A;  4D8E A;  3PHW A;  3HWN A;  1U5I A;  1SNK A;  2AYN A;  3BWK A;  1NPZ A;  1PAD A;  9PAP A;  5A24 A;  1YT7 A;  4FJC A;  3KKU A;  3U8E A;  1NL6 A;  3O65 A;  1CTE A;  4RF1 A;  1SP4 B;  1AYU A;  1NB3 A;  1Y4H A;  2DC6 A;  2FYE A;  3CBJ A;  3QT4 A;  1EWL A;  1U9Q X;  2AUX A;  2R9N A;  1MS6 A;  4CZW A;  3BOW A;  5F02 A;  1QDQ A;  2JQG R;  2GFO A;  2JQF R;  1EWO A;  2YJ2 A;  3P5X A;  2Z84 A;  1CB5 A;  2UZJ A;  4PI3 A;  1VSN A;  4X6H A;  2OZ2 A;  3S3R A;  4X6J A;  2G6D A;  1EF7 A;  5EF4 A;  2NQI A;  2DCC A;  3MP2 A;  2E03 A;  4D8I A;  1QXP A;  2AGA A;  4IP3 A;  3IV2 A;  1MEG A;  1Q6K A;  2P0R A;  1CSB B;  3OVZ A;  2DC8 A;  4BOZ A;  4KLB A;  2DCB A;  4QRG A;  2R9C A;  2AIM A;  4RKX A;  1UKF A;  4BOU A;  2J7Q A;  2BU3 A;  3E9S A;  1K3B B;  1ZCM A;  3W30 A;  2BTW A;  3P5V A;  2GHU A;  2HWK A;  5CVM A;  3D6S A;  2XU5 A;  1AYV A;  1DKI A;  5JH3 A;  3OF9 A;  3O1G A;  2Y6E A;  1BP4 A;  4YVA A;  2ACT A;  4YYQ A;  3PT2 A;  1YK8 A;  1GEC E;  1YAL A;  1BY8 A;  5EZS A;  3LXS A;  2H7J A;  4BSQ A;  3S3Q A;  4P16 A;  2DOS A;  2PNS A;  4W5C A;  1U9W A;  2F7D A;  2OUL A;  1AIM A;  4DMX A;  4QH6 A;  4HXD B;  1CPJ A;  4RF0 A;  3P5U A;  2PBH A;  4P6G A;  3PBH A;  3PHX A;  3RNV A;  4G54 A;  4R3D A;  1QOL A;  1ME3 A;  4CDD B;  4FK5 A;  3H8C A;  3F75 A;  3IUT A;  2FT2 A;  1CV8 A;  1AEC A;  5FPW A;  4RNA A;  2ATO A;  4XZX A;  4I05 A;  1NLJ A;  3B21 A;  4YYR A;  2P86 A;  4BOS A;  3CBK A;  3PHU A;  2XU1 A;  2FUD A;  2AU1 A;  5CHV A;  1PXV A;  4OVZ A;  4YYS A;  3BB7 A;  4PP2 E;  1F2B A;  7PCK A;  1YVB A;  4W5B A;  3I3T A;  3KWB X;  5CVN B;  1GLO A;  1F2A A;  2R9M A;  4WA6 A;  1AU0 A;  1IWD A;  2JTC A;  3OF8 A;  3BCN A;  2BTW B;  2DCA A;  1NQC A;  3OQC A;  3C9E A;  1CVZ A;  3IOQ A;  5K16 A;  5KO3 A;  2J7Q C;  2CIO A;  2FQ9 A;  3KWZ A;  1A6R A;  2P7U A;  3TMP A;  1O0E A;  4BQV A;  2NQD B;  1EWM A;  3BPF A;  1POP A;  3HHA A;  3WXG A;  1PCI A;  1KXR A;  4PT5 A;  1AU3 A;  4AXM A;  2PAD A;  3PNR A;  1HUC B;  3ZUA A;  4PP1 A;  3DF0 A;  5JA7 A;  2VHF A;  2XU3 A;  4OEM A;  2E02 A;  4YYW A;  1XKG A;  2BDL A;  1ZIV A;  2Y5B A;  3PSE A;  3PDF A;  2AS8 A;  3I06 A;  1PPO A;  3MHS A;  3N3G A;  3IMA A;  3WXF A;  4N79 A;  1S4V A;  4X6I A;  2HH5 A;  2IBI A;  4A5U A;  3H8B A;  2FE8 A;  4OVZ B;  1PE6 A;  1MIR A;  2G8J A;  4HWY A;  3C0R A;  2FRA A;  2HHN A;  3KSE A;  2FTD A;  2AUZ A;  2PRE A;  4CDF B;  2AYO A;  1TLO A; 
#chains in the Genus database with same CATH homology
 3B21 A;  3O65 A;  4RF1 A;  3ZNH A;  4BOS A;  3MTV A;  3PHU A;  4OVZ A;  2JRI A;  3BB7 A;  2Z84 A;  2UZJ A;  5E6J A;  5EZQ A;  3W31 A;  4MI7 A;  4WUR A;  2JTC A;  3MP2 A;  2BTW B;  4D8I A;  2AGA A;  4IP3 A;  4M0W A;  3OQC A;  4BOZ A;  4RKX A;  1UKF A;  4BOU A;  2J7Q A;  5KO3 A;  2BU3 A;  3E9S A;  2J7Q C;  4IUM A;  3W30 A;  2BTW A;  2HWK A;  3TMP A;  3IFU A;  5JZE A;  1DKI A;  4D8B A;  3PT2 A;  3BY4 A;  4PT5 A;  4OW0 A;  1PVJ A;  5EZS A;  4GUA A;  4P16 A;  4BOP A;  2DOS A;  3PRM A;  3PRP A;  4BOQ A;  3PSE A;  4HXD B;  4RF0 A;  1YZB A;  3PHX A;  3RNV A;  3BBA A;  4R3D A;  4REZ A;  4ZTB A;  4MM3 B;  3TRK A;  4D8E A;  3PHW A;  4A5U A;  2FE8 A;  4OVZ B;  3C0R A;  3MJ5 A;  4RNA A;  4XZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...