2BU3A

Acyl-enzyme intermediate between alr0975 and glutathione at ph 3.4
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
211
structure length
200
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAYRVFTQDNFFSTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
molecule keywords ALR0975 PROTEIN
total genus 64
structure length 200
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2bu3A00
2BU3A 2BTWB 2BTWA
chains in the Genus database with same CATH superfamily
4Q8HA 2HHNA 4OVZB 4P6GA 3RVWA 3BY4A 1THEA 5CVNB 3KX1A 1YT7A 1DKIA 2HH5A 2P7UA 4MI7A 4QBBA 4G54A 4QRVA 2AYOA 2J7QC 1QXPA 2DCBA 2DC7A 3PBHA 1Q6KA 3KKUA 1KFXL 4OELA 3CH3X 2DC9A 1GCBA 1Y4HA 2ACTA 4FIPA 4N4ZA 2OZ2A 3IFUA 7PCKA 3QT4A 5CHTA 1ZCMA 1ICFA 3O65A 4Q8GA 4YYQA 1S4VA 2Y5BA 4D8BA 3M99A 2NQIA 1X9YA 4R3DA 2YJ2A 1AECA 3WXEA 1CS8A 1DEUA 1M6DA 2BTWA 3D6SA 2XU3A 4XZXA 1BGOA 1U9WA 3H8CA 2FTDA 2IPPB 3NHEA 3BBAA 4I04A 2PNSA 5JA7A 4BQVA 1BQIA 4CDEB 2HXZA 4OEMA 5CHVA 1NLJA 5K16A 5F02A 2GHUA 8PCHA 3KFQA 2IBIA 4W5BA 4MZSA 5CVOB 3MHHA 3V6CA 4YVAA 3OISA 1QOLA 2R9NA 2YJ8A 4X6HA 1NB3A 1BY8A 3P5VA 2YJ9A 3MHSA 1AYVA 1JQPA 2FO5A 2DOSA 2PREA 3KWZA 4QRXA 4BPVA 5EF4A 5J94A 2FUDA 4WURA 1VJVA 1U5IA 1BP4A 2FE8A 4WA6A 1AU0A 2UZJA 3S3RA 3ZUAA 3OQCA 1PPOA 2DJFB 1CV8A 4X6JA 3CBKA 4MZOA 1F29A 4A5UA 1F2CA 2Z84A 4W5CA 3OVXA 1FH0A 1YZBA 3MTVA 3W31A 2DC6A 3CH2X 1MEMA 3W30A 1PADA 1QDQA 2AVWA 3PNRA 4GUAA 4RF1A 1YK8A 1GECE 2NQDB 3QSDA 1NL6A 4BOPA 4BOUA 5PADA 3RVVA 1STFE 3MJ5A 2CIOA 1HUCB 3RVXA 3P5WA 3I06A 4YYVA 3KSEA 3PDFA 2CB5A 1MDWA 2AYNA 2NQGA 2DZYA 4DMXA 3C0RA 1K3BB 1ATKA 1QMYA 2C0YA 1MIRA 2R9OA 9PAPA 3WXGA 4YYUA 1PPDA 2P0RA 1XKGA 3TRKA 3GCBA 4P6EA 2B1MA 4OW0A 1YVBA 2J7QA 4HXDB 3H6SA 2DCAA 5JZEA 1ME4A 1CVZA 4PP2E 1ITOA 4PADA 2XU4A 1CTEA 4BOQA 4MM3B 3OF8A 5JH3A 3IV2A 3HD3A 1F2AA 3MP2A 2VHSA 1YALA 1SP4B 1CSBB 2HWKA 2JTCA 2NQAA 3MORA 1MEGA 3PHWA 1CB5A 4RKXA 2PBHA 3HWNA 1UKFA 4DMYA 3C9EA 2AIMA 4REZA 5EZSA 2XU5A 5EGWA 3LFYA 1VSNA 3DF0A 2G8JA 2Y6EA 1EF7A 3IEJA 1PVJA 2HD5A 3AI8A 4YYSA 1PE6A 4ZTBA 3USVA 1MS6A 3H8BA 2FQ9A 3BOWA 3PRPA 1YK7A 4QH6A 1CJLA 4RNAA 2R9CA 3IMAA 3QJ3A 1KHQA 2P86A 2E00A 4PT5A 1AYUA 2BU3A 3N4CA 2AUXA 1AIMA 4D8IA 4IUMA 1NQCA 1MHWA 2BDZA 4CZWA 4KLBA 3S3QA 1PPNA 2JQFR 3H89A 4AXLA 2H7JA 2FRAA 4D8EA 3OF9A 4I05A 1EWPA 3BCNA 3PT2A 3P5UA 3PHUA 3BPMA 3F5VA 3TMPA 3H7DA 4HWYA 1ME3A 1Y08A 2YJBA 1CPJA 2FYEA 4MSXA 1GLOA 4BSQA 1PBHA 3BC3A 2DCDA 1AYWA 2AUZA 4N8WA 1EWLA 1GMYA 2OP3A 4ZUXU 3K9MA 4BOZA 3BPFA 1EWMA 1U9QX 2AU1A 2VHFA 4M0WA 4BS5A 2R9MA 2BDLA 2E03A 3OVZA 1ZIVA 1TLOA 1F2BA 2E02A 2DJGB 4BOSA 5EZQA 3TNXA 2XU1A 1AU3A 2PADA 2G8EA 3B21A 4XUIA 4W4UA 4YV8A 1AU2A 5A24A 2AGAA 5KO3A 3CBJA 3LXSA 2AS8A 3N3GA 4CDFB 5FPWA 1NB5A 1PIPA 2FRQA 2R9FA 1TU6A 2E01A 1IWDA 4QRGA 2GFOA 3F75A 4PP1A 1U9VA 3HHAA 2B1NA 3K8UA 4BS6A 1DF0A 5CVMA 4N79A 4IP3A 3IHPA 3PHXA 3P5XA 2G7YA 2YJCA 4YYRA 1POPA 3RNVA 3PRMA 4XR7A 2DC8A 3I3TA 4FJCA 3O0UA 3KW9A 2WBFX 4AXMA 3V6EA 1PPPA 4P16A 4PI3A 2F7DA 1TL9A 2JQGR 3E9SA 3IOQA 1A6RA 4K7CA 3BWKA 1KXRA 2ATOA 4X6IA 3WXFA 1NPZA 3U8EA 4RF0A 3PW3A 2JRIA 3N3KA 1CQDA 3ZNHA 3BB7A 3ERVA 3KWBX 3PSEA 1EWOA 5E6JA 3E1ZB 3IUTA 4FK5A 4I07A 4OVZA 2ARYA 3MTNA 3K24A 2BTWB 3B79A 2OULA 1SNKA 1PXVA 2O6XA 2R6NA 1PCIA 2F1GA 4RY2A 4YYWA 4CDDB 1U9XA 1O0EA 1AU4A 2G6DA 1KHPA 3O1GA 3HHIA 2DCCA 4CDCB 1KFUL 2FT2A 2DZZA 6PADA
chains in the Genus database with same CATH topology
3MJ5A 4A5UA 4IP3A 2Z84A 3B21A 4OW0A 4P16A 3PHWA 3PHXA 4OVZA 1YZBA 3MTVA 3TRKA 4WURA 3W31A 2J7QA 4RKXA 2BTWA 3PRPA 3W30A 2AGAA 4OVZB 5KO3A 1UKFA 4D8EA 2FE8A 4XZXA 2BTWB 4HXDB 3E9SA 4RNAA 3BY4A 4GUAA 2UZJA 4RF1A 4BOZA 3IFUA 5JZEA 3C0RA 3BBAA 4REZA 3OQCA 4M0WA 3PT2A 5EZSA 4PT5A 3RNVA 4BOQA 1DKIA 3PHUA 3O65A 4RF0A 3PRMA 2JRIA 4MM3B 2BU3A 4MI7A 4BOPA 3MP2A 3ZNHA 3BB7A 2J7QC 1PVJA 4BOSA 4D8IA 4IUMA 3TMPA 4BOUA 3PSEA 5E6JA 5EZQA 4D8BA 4R3DA 2HWKA 2DOSA 4ZTBA 2JTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU3 A;  2BTW B;  2BTW A; 
#chains in the Genus database with same CATH topology
 4Q8H A;  2HHN A;  4OVZ B;  4P6G A;  3RVW A;  3BY4 A;  1THE A;  5CVN B;  3KX1 A;  1YT7 A;  1DKI A;  2HH5 A;  2P7U A;  4MI7 A;  4QBB A;  4G54 A;  4QRV A;  2AYO A;  2J7Q C;  1QXP A;  2DCB A;  2DC7 A;  3PBH A;  1Q6K A;  3KKU A;  1KFX L;  4OEL A;  3CH3 X;  2DC9 A;  1GCB A;  1Y4H A;  2ACT A;  4FIP A;  4N4Z A;  2OZ2 A;  3IFU A;  7PCK A;  3QT4 A;  5CHT A;  1ZCM A;  1ICF A;  3O65 A;  4Q8G A;  4YYQ A;  1S4V A;  2Y5B A;  4D8B A;  3M99 A;  2NQI A;  1X9Y A;  4R3D A;  2YJ2 A;  1AEC A;  3WXE A;  1CS8 A;  1DEU A;  1M6D A;  2BTW A;  3D6S A;  2XU3 A;  4XZX A;  1BGO A;  1U9W A;  3H8C A;  2FTD A;  2IPP B;  3NHE A;  3BBA A;  4I04 A;  2PNS A;  5JA7 A;  4BQV A;  1BQI A;  4CDE B;  2HXZ A;  4OEM A;  5CHV A;  1NLJ A;  5K16 A;  5F02 A;  2GHU A;  8PCH A;  3KFQ A;  2IBI A;  4W5B A;  4MZS A;  5CVO B;  3MHH A;  3V6C A;  4YVA A;  3OIS A;  1QOL A;  2R9N A;  2YJ8 A;  4X6H A;  1NB3 A;  1BY8 A;  3P5V A;  2YJ9 A;  3MHS A;  1AYV A;  1JQP A;  2FO5 A;  2DOS A;  2PRE A;  3KWZ A;  4QRX A;  4BPV A;  5EF4 A;  5J94 A;  2FUD A;  4WUR A;  1VJV A;  1U5I A;  1BP4 A;  2FE8 A;  4WA6 A;  1AU0 A;  2UZJ A;  3S3R A;  3ZUA A;  3OQC A;  1PPO A;  2DJF B;  1CV8 A;  4X6J A;  3CBK A;  4MZO A;  1F29 A;  4A5U A;  1F2C A;  2Z84 A;  4W5C A;  3OVX A;  1FH0 A;  1YZB A;  3MTV A;  3W31 A;  2DC6 A;  3CH2 X;  1MEM A;  3W30 A;  1PAD A;  1QDQ A;  2AVW A;  3PNR A;  4GUA A;  4RF1 A;  1YK8 A;  1GEC E;  2NQD B;  3QSD A;  1NL6 A;  4BOP A;  4BOU A;  5PAD A;  3RVV A;  1STF E;  3MJ5 A;  2CIO A;  1HUC B;  3RVX A;  3P5W A;  3I06 A;  4YYV A;  3KSE A;  3PDF A;  2CB5 A;  1MDW A;  2AYN A;  2NQG A;  2DZY A;  4DMX A;  3C0R A;  1K3B B;  1ATK A;  1QMY A;  2C0Y A;  1MIR A;  2R9O A;  9PAP A;  3WXG A;  4YYU A;  1PPD A;  2P0R A;  1XKG A;  3TRK A;  3GCB A;  4P6E A;  2B1M A;  4OW0 A;  1YVB A;  2J7Q A;  4HXD B;  3H6S A;  2DCA A;  5JZE A;  1ME4 A;  1CVZ A;  4PP2 E;  1ITO A;  4PAD A;  2XU4 A;  1CTE A;  4BOQ A;  4MM3 B;  3OF8 A;  5JH3 A;  3IV2 A;  3HD3 A;  1F2A A;  3MP2 A;  2VHS A;  1YAL A;  1SP4 B;  1CSB B;  2HWK A;  2JTC A;  2NQA A;  3MOR A;  1MEG A;  3PHW A;  1CB5 A;  4RKX A;  2PBH A;  3HWN A;  1UKF A;  4DMY A;  3C9E A;  2AIM A;  4REZ A;  5EZS A;  2XU5 A;  5EGW A;  3LFY A;  1VSN A;  3DF0 A;  2G8J A;  2Y6E A;  1EF7 A;  3IEJ A;  1PVJ A;  2HD5 A;  3AI8 A;  4YYS A;  1PE6 A;  4ZTB A;  3USV A;  1MS6 A;  3H8B A;  2FQ9 A;  3BOW A;  3PRP A;  1YK7 A;  4QH6 A;  1CJL A;  4RNA A;  2R9C A;  3IMA A;  3QJ3 A;  1KHQ A;  2P86 A;  2E00 A;  4PT5 A;  1AYU A;  2BU3 A;  3N4C A;  2AUX A;  1AIM A;  4D8I A;  4IUM A;  1NQC A;  1MHW A;  2BDZ A;  4CZW A;  4KLB A;  3S3Q A;  1PPN A;  2JQF R;  3H89 A;  4AXL A;  2H7J A;  2FRA A;  4D8E A;  3OF9 A;  4I05 A;  1EWP A;  3BCN A;  3PT2 A;  3P5U A;  3PHU A;  3BPM A;  3F5V A;  3TMP A;  3H7D A;  4HWY A;  1ME3 A;  1Y08 A;  2YJB A;  1CPJ A;  2FYE A;  4MSX A;  1GLO A;  4BSQ A;  1PBH A;  3BC3 A;  2DCD A;  1AYW A;  2AUZ A;  4N8W A;  1EWL A;  1GMY A;  2OP3 A;  4ZUX U;  3K9M A;  4BOZ A;  3BPF A;  1EWM A;  1U9Q X;  2AU1 A;  2VHF A;  4M0W A;  4BS5 A;  2R9M A;  2BDL A;  2E03 A;  3OVZ A;  1ZIV A;  1TLO A;  1F2B A;  2E02 A;  2DJG B;  4BOS A;  5EZQ A;  3TNX A;  2XU1 A;  1AU3 A;  2PAD A;  2G8E A;  3B21 A;  4XUI A;  4W4U A;  4YV8 A;  1AU2 A;  5A24 A;  2AGA A;  5KO3 A;  3CBJ A;  3LXS A;  2AS8 A;  3N3G A;  4CDF B;  5FPW A;  1NB5 A;  1PIP A;  2FRQ A;  2R9F A;  1TU6 A;  2E01 A;  1IWD A;  4QRG A;  2GFO A;  3F75 A;  4PP1 A;  1U9V A;  3HHA A;  2B1N A;  3K8U A;  4BS6 A;  1DF0 A;  5CVM A;  4N79 A;  4IP3 A;  3IHP A;  3PHX A;  3P5X A;  2G7Y A;  2YJC A;  4YYR A;  1POP A;  3RNV A;  3PRM A;  4XR7 A;  2DC8 A;  3I3T A;  4FJC A;  3O0U A;  3KW9 A;  2WBF X;  4AXM A;  3V6E A;  1PPP A;  4P16 A;  4PI3 A;  2F7D A;  1TL9 A;  2JQG R;  3E9S A;  3IOQ A;  1A6R A;  4K7C A;  3BWK A;  1KXR A;  2ATO A;  4X6I A;  3WXF A;  1NPZ A;  3U8E A;  4RF0 A;  3PW3 A;  2JRI A;  3N3K A;  1CQD A;  3ZNH A;  3BB7 A;  3ERV A;  3KWB X;  3PSE A;  1EWO A;  5E6J A;  3E1Z B;  3IUT A;  4FK5 A;  4I07 A;  4OVZ A;  2ARY A;  3MTN A;  3K24 A;  2BTW B;  3B79 A;  2OUL A;  1SNK A;  1PXV A;  2O6X A;  2R6N A;  1PCI A;  2F1G A;  4RY2 A;  4YYW A;  4CDD B;  1U9X A;  1O0E A;  1AU4 A;  2G6D A;  1KHP A;  3O1G A;  3HHI A;  2DCC A;  4CDC B;  1KFU L;  2FT2 A;  2DZZ A;  6PAD A; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  4A5U A;  4IP3 A;  2Z84 A;  3B21 A;  4OW0 A;  4P16 A;  3PHW A;  3PHX A;  4OVZ A;  1YZB A;  3MTV A;  3TRK A;  4WUR A;  3W31 A;  2J7Q A;  4RKX A;  2BTW A;  3PRP A;  3W30 A;  2AGA A;  4OVZ B;  5KO3 A;  1UKF A;  4D8E A;  2FE8 A;  4XZX A;  2BTW B;  4HXD B;  3E9S A;  4RNA A;  3BY4 A;  4GUA A;  2UZJ A;  4RF1 A;  4BOZ A;  3IFU A;  5JZE A;  3C0R A;  3BBA A;  4REZ A;  3OQC A;  4M0W A;  3PT2 A;  5EZS A;  4PT5 A;  3RNV A;  4BOQ A;  1DKI A;  3PHU A;  3O65 A;  4RF0 A;  3PRM A;  2JRI A;  4MM3 B;  2BU3 A;  4MI7 A;  4BOP A;  3MP2 A;  3ZNH A;  3BB7 A;  2J7Q C;  1PVJ A;  4BOS A;  4D8I A;  4IUM A;  3TMP A;  4BOU A;  3PSE A;  5E6J A;  5EZQ A;  4D8B A;  4R3D A;  2HWK A;  2DOS A;  4ZTB A;  2JTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...