2BU3A

Acyl-enzyme intermediate between alr0975 and glutathione at ph 3.4
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
211
structure length
200
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAYRVFTQDNFFSTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
molecule keywords ALR0975 PROTEIN
total genus 64
structure length 200
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2bu3A00
2BTWA 2BTWB 2BU3A
chains in the Genus database with same CATH superfamily
3PRMA 1S4VA 3IEJA 3P5VA 4X6IA 2BU3A 3OQCA 2DC7A 2XU5A 2AS8A 3I06A 4AXLA 4D8BA 1STFE 3HHIA 3QT4A 1PXVA 3WXGA 3IMAA 1JQPA 1GLOA 3H8BA 2FUDA 1PPNA 4BS6A 3BOWA 3MHSA 1KXRA 3RVWA 4BS5A 4FJCA 1DKIA 1YZBA 1EWMA 3IHPA 3ZNHA 2YJ9A 4IP3A 2C0YA 1MS6A 1PIPA 3IUTA 3RVVA 4OVZA 2BTWA 3PSEA 4N8WA 1ICFA 2CIOA 5CVNB 3S3RA 4M0WA 1AECA 3BPMA 4PI3A 4BOSA 4QBBA 1NQCA 5KO3A 1AYUA 2XU1A 1FH0A 3K9MA 2NQIA 4PADA 1Y4HA 1PADA 4RF1A 1ITOA 3KX1A 1BGOA 2NQGA 4BOPA 2DCBA 4REZA 4CDCB 1CQDA 2DCCA 1EF7A 3O65A 1PPOA 4YYWA 3KWBX 3P5UA 4Q8HA 1GECE 1PBHA 2HHNA 1YK8A 2AYOA 2F1GA 2WBFX 3PHXA 3ERVA 3OISA 3WXFA 3BY4A 4W5CA 6PADA 2YJ8A 3W31A 1SNKA 2FTDA 4W5BA 1K3BB 3O0UA 4BOZA 2R9OA 4I05A 2J7QC 3BWKA 1AU3A 1AYWA 3M99A 3QSDA 4WA6A 1ATKA 4PT5A 1X9YA 3F75A 4XZXA 2DCAA 5K16A 1CJLA 2PADA 3NHEA 2JQGR 1CTEA 2DCDA 2OULA 5CVMA 1HUCB 2DC9A 2Z84A 3MTNA 4MZSA 1CV8A 1QXPA 4MM3B 4CDEB 3BB7A 1YVBA 4QRXA 2P0RA 2J7QA 3RVXA 3O1GA 4OVZB 3F5VA 1CB5A 2ATOA 3LXSA 3LFYA 1THEA 2R9FA 3CBKA 4G54A 2BDZA 2E03A 1KFXL 5PADA 5JH3A 2GFOA 4ZTBA 2VHSA 4YYSA 3KWZA 2IPPB 3OF8A 1DEUA 1F2BA 3H89A 1AU4A 1U9VA 2AUXA 3MJ5A 3KFQA 3U8EA 4YYVA 2NQDB 4PP1A 4CDFB 2OZ2A 2IBIA 1QDQA 2P7UA 3RNVA 1ME4A 1Y08A 5CHVA 2BTWB 1VJVA 4OELA 1EWPA 1MEMA 3TMPA 3IV2A 1PPPA 2Y6EA 2HD5A 3P5WA 1NL6A 1F29A 2E01A 3OF9A 3CH2X 4HXDB 7PCKA 1TL9A 1KHPA 3E1ZB 3QJ3A 4PP2E 4XR7A 2AU1A 4KLBA 2Y5BA 3ZUAA 4K7CA 2O6XA 1BP4A 3PT2A 2JQFR 4OEMA 2VHFA 3MP2A 2ACTA 1Q6KA 3KW9A 2YJCA 1PE6A 1EWLA 1CVZA 4N4ZA 1EWOA 4YVAA 2FT2A 4RY2A 1QMYA 3H7DA 3C9EA 3PHWA 4DMYA 3PHUA 4P6GA 3BPFA 4CDDB 2DZYA 2PNSA 1POPA 3N3KA 3IFUA 2R9CA 4BOUA 3S3QA 3P5XA 2B1MA 1AIMA 3MHHA 5E6JA 3W30A 1TLOA 5FPWA 3BC3A 2FO5A 2AGAA 3I3TA 3GCBA 1TU6A 5EZQA 4BQVA 3DF0A 1PCIA 2F7DA 1U5IA 4D8EA 4P16A 4ZUXU 1U9WA 1YALA 5JZEA 2DJFB 1AU0A 2UZJA 3OVXA 5EF4A 5A24A 4R3DA 1CS8A 4D8IA 3PRPA 5CHTA 4BSQA 4A5UA 2DZZA 2DC8A 3USVA 2P86A 2AVWA 4FK5A 1MDWA 2E02A 3N3GA 3N4CA 2AUZA 3BCNA 3PDFA 5F02A 4QRVA 2FRAA 1U9QX 2AYNA 2G7YA 1MIRA 4AXMA 4QRGA 4WURA 1U9XA 2DJGB 3C0RA 1ME3A 4YYRA 9PAPA 3H6SA 2H7JA 2XU4A 2CB5A 3H8CA 2ARYA 3PBHA 2G8JA 5EZSA 4X6JA 4X6HA 1UKFA 2E00A 3D6SA 3KKUA 3KSEA 1VSNA 1A6RA 2B1NA 2JTCA 3V6EA 1QOLA 2BDLA 2XU3A 1GMYA 4XUIA 3CH3X 3K8UA 3V6CA 2FRQA 4MI7A 4HWYA 4IUMA 1NPZA 4GUAA 1BY8A 3IOQA 1M6DA 2PREA 3MTVA 4QH6A 3PW3A 3HWNA 3PNRA 1NB3A 1AYVA 4I07A 2DOSA 1NLJA 4MZOA 2G8EA 5EGWA 1YT7A 3HHAA 4MSXA 1F2AA 1SP4B 2JRIA 1AU2A 1MHWA 2YJ2A 3OVZA 2R9MA 4BPVA 4DMXA 1ZCMA 4BOQA 4FIPA 1KHQA 3WXEA 2HWKA 2G6DA 1PPDA 1F2CA 3AI8A 2OP3A 2PBHA 3CBJA 5JA7A 1YK7A 1KFUL 2AIMA 4CZWA 2R6NA 4W4UA 4N79A 8PCHA 3K24A 2NQAA 4Q8GA 1BQIA 3TRKA 2GHUA 2HH5A 3HD3A 2HXZA 4RKXA 4RNAA 2R9NA 3BBAA 1GCBA 2DC6A 3MORA 2FE8A 4RF0A 4OW0A 4P6EA 1O0EA 1CSBB 2FQ9A 4I04A 4YYQA 5J94A 1MEGA 3B21A 1CPJA 3TNXA 1XKGA 1PVJA 4YYUA 1ZIVA 1IWDA 1NB5A 2FYEA 1DF0A 5CVOB 2YJBA 3B79A 4YV8A 3E9SA
chains in the Genus database with same CATH topology
4RNAA 2HWKA 3PRMA 4XZXA 5E6JA 3BBAA 3BY4A 1UKFA 4IP3A 3W30A 3MTVA 2FE8A 4RF0A 4ZTBA 3RNVA 4OW0A 2UZJA 4BOPA 2AGAA 2BTWA 3PSEA 2BTWB 2BU3A 3OQCA 4OVZA 3W31A 3PT2A 4REZA 4WURA 4BOZA 3B21A 3PHWA 2DOSA 3C0RA 2JTCA 2Z84A 3PHUA 4R3DA 4RKXA 3TMPA 4D8BA 5EZQA 4D8IA 3PRPA 4M0WA 1PVJA 3O65A 2J7QC 4MM3B 4A5UA 4BOSA 3BB7A 3ZNHA 3MP2A 4D8EA 4P16A 2J7QA 5KO3A 3IFUA 3TRKA 4BOUA 3MJ5A 4MI7A 4HXDB 4OVZB 2JRIA 4IUMA 5JZEA 3PHXA 5EZSA 4RF1A 4BOQA 3E9SA 4GUAA 1DKIA 1YZBA 4PT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTW A;  2BTW B;  2BU3 A; 
#chains in the Genus database with same CATH topology
 3PRM A;  1S4V A;  3IEJ A;  3P5V A;  4X6I A;  2BU3 A;  3OQC A;  2DC7 A;  2XU5 A;  2AS8 A;  3I06 A;  4AXL A;  4D8B A;  1STF E;  3HHI A;  3QT4 A;  1PXV A;  3WXG A;  3IMA A;  1JQP A;  1GLO A;  3H8B A;  2FUD A;  1PPN A;  4BS6 A;  3BOW A;  3MHS A;  1KXR A;  3RVW A;  4BS5 A;  4FJC A;  1DKI A;  1YZB A;  1EWM A;  3IHP A;  3ZNH A;  2YJ9 A;  4IP3 A;  2C0Y A;  1MS6 A;  1PIP A;  3IUT A;  3RVV A;  4OVZ A;  2BTW A;  3PSE A;  4N8W A;  1ICF A;  2CIO A;  5CVN B;  3S3R A;  4M0W A;  1AEC A;  3BPM A;  4PI3 A;  4BOS A;  4QBB A;  1NQC A;  5KO3 A;  1AYU A;  2XU1 A;  1FH0 A;  3K9M A;  2NQI A;  4PAD A;  1Y4H A;  1PAD A;  4RF1 A;  1ITO A;  3KX1 A;  1BGO A;  2NQG A;  4BOP A;  2DCB A;  4REZ A;  4CDC B;  1CQD A;  2DCC A;  1EF7 A;  3O65 A;  1PPO A;  4YYW A;  3KWB X;  3P5U A;  4Q8H A;  1GEC E;  1PBH A;  2HHN A;  1YK8 A;  2AYO A;  2F1G A;  2WBF X;  3PHX A;  3ERV A;  3OIS A;  3WXF A;  3BY4 A;  4W5C A;  6PAD A;  2YJ8 A;  3W31 A;  1SNK A;  2FTD A;  4W5B A;  1K3B B;  3O0U A;  4BOZ A;  2R9O A;  4I05 A;  2J7Q C;  3BWK A;  1AU3 A;  1AYW A;  3M99 A;  3QSD A;  4WA6 A;  1ATK A;  4PT5 A;  1X9Y A;  3F75 A;  4XZX A;  2DCA A;  5K16 A;  1CJL A;  2PAD A;  3NHE A;  2JQG R;  1CTE A;  2DCD A;  2OUL A;  5CVM A;  1HUC B;  2DC9 A;  2Z84 A;  3MTN A;  4MZS A;  1CV8 A;  1QXP A;  4MM3 B;  4CDE B;  3BB7 A;  1YVB A;  4QRX A;  2P0R A;  2J7Q A;  3RVX A;  3O1G A;  4OVZ B;  3F5V A;  1CB5 A;  2ATO A;  3LXS A;  3LFY A;  1THE A;  2R9F A;  3CBK A;  4G54 A;  2BDZ A;  2E03 A;  1KFX L;  5PAD A;  5JH3 A;  2GFO A;  4ZTB A;  2VHS A;  4YYS A;  3KWZ A;  2IPP B;  3OF8 A;  1DEU A;  1F2B A;  3H89 A;  1AU4 A;  1U9V A;  2AUX A;  3MJ5 A;  3KFQ A;  3U8E A;  4YYV A;  2NQD B;  4PP1 A;  4CDF B;  2OZ2 A;  2IBI A;  1QDQ A;  2P7U A;  3RNV A;  1ME4 A;  1Y08 A;  5CHV A;  2BTW B;  1VJV A;  4OEL A;  1EWP A;  1MEM A;  3TMP A;  3IV2 A;  1PPP A;  2Y6E A;  2HD5 A;  3P5W A;  1NL6 A;  1F29 A;  2E01 A;  3OF9 A;  3CH2 X;  4HXD B;  7PCK A;  1TL9 A;  1KHP A;  3E1Z B;  3QJ3 A;  4PP2 E;  4XR7 A;  2AU1 A;  4KLB A;  2Y5B A;  3ZUA A;  4K7C A;  2O6X A;  1BP4 A;  3PT2 A;  2JQF R;  4OEM A;  2VHF A;  3MP2 A;  2ACT A;  1Q6K A;  3KW9 A;  2YJC A;  1PE6 A;  1EWL A;  1CVZ A;  4N4Z A;  1EWO A;  4YVA A;  2FT2 A;  4RY2 A;  1QMY A;  3H7D A;  3C9E A;  3PHW A;  4DMY A;  3PHU A;  4P6G A;  3BPF A;  4CDD B;  2DZY A;  2PNS A;  1POP A;  3N3K A;  3IFU A;  2R9C A;  4BOU A;  3S3Q A;  3P5X A;  2B1M A;  1AIM A;  3MHH A;  5E6J A;  3W30 A;  1TLO A;  5FPW A;  3BC3 A;  2FO5 A;  2AGA A;  3I3T A;  3GCB A;  1TU6 A;  5EZQ A;  4BQV A;  3DF0 A;  1PCI A;  2F7D A;  1U5I A;  4D8E A;  4P16 A;  4ZUX U;  1U9W A;  1YAL A;  5JZE A;  2DJF B;  1AU0 A;  2UZJ A;  3OVX A;  5EF4 A;  5A24 A;  4R3D A;  1CS8 A;  4D8I A;  3PRP A;  5CHT A;  4BSQ A;  4A5U A;  2DZZ A;  2DC8 A;  3USV A;  2P86 A;  2AVW A;  4FK5 A;  1MDW A;  2E02 A;  3N3G A;  3N4C A;  2AUZ A;  3BCN A;  3PDF A;  5F02 A;  4QRV A;  2FRA A;  1U9Q X;  2AYN A;  2G7Y A;  1MIR A;  4AXM A;  4QRG A;  4WUR A;  1U9X A;  2DJG B;  3C0R A;  1ME3 A;  4YYR A;  9PAP A;  3H6S A;  2H7J A;  2XU4 A;  2CB5 A;  3H8C A;  2ARY A;  3PBH A;  2G8J A;  5EZS A;  4X6J A;  4X6H A;  1UKF A;  2E00 A;  3D6S A;  3KKU A;  3KSE A;  1VSN A;  1A6R A;  2B1N A;  2JTC A;  3V6E A;  1QOL A;  2BDL A;  2XU3 A;  1GMY A;  4XUI A;  3CH3 X;  3K8U A;  3V6C A;  2FRQ A;  4MI7 A;  4HWY A;  4IUM A;  1NPZ A;  4GUA A;  1BY8 A;  3IOQ A;  1M6D A;  2PRE A;  3MTV A;  4QH6 A;  3PW3 A;  3HWN A;  3PNR A;  1NB3 A;  1AYV A;  4I07 A;  2DOS A;  1NLJ A;  4MZO A;  2G8E A;  5EGW A;  1YT7 A;  3HHA A;  4MSX A;  1F2A A;  1SP4 B;  2JRI A;  1AU2 A;  1MHW A;  2YJ2 A;  3OVZ A;  2R9M A;  4BPV A;  4DMX A;  1ZCM A;  4BOQ A;  4FIP A;  1KHQ A;  3WXE A;  2HWK A;  2G6D A;  1PPD A;  1F2C A;  3AI8 A;  2OP3 A;  2PBH A;  3CBJ A;  5JA7 A;  1YK7 A;  1KFU L;  2AIM A;  4CZW A;  2R6N A;  4W4U A;  4N79 A;  8PCH A;  3K24 A;  2NQA A;  4Q8G A;  1BQI A;  3TRK A;  2GHU A;  2HH5 A;  3HD3 A;  2HXZ A;  4RKX A;  4RNA A;  2R9N A;  3BBA A;  1GCB A;  2DC6 A;  3MOR A;  2FE8 A;  4RF0 A;  4OW0 A;  4P6E A;  1O0E A;  1CSB B;  2FQ9 A;  4I04 A;  4YYQ A;  5J94 A;  1MEG A;  3B21 A;  1CPJ A;  3TNX A;  1XKG A;  1PVJ A;  4YYU A;  1ZIV A;  1IWD A;  1NB5 A;  2FYE A;  1DF0 A;  5CVO B;  2YJB A;  3B79 A;  4YV8 A;  3E9S A; 
#chains in the Genus database with same CATH homology
 4RNA A;  2HWK A;  3PRM A;  4XZX A;  5E6J A;  3BBA A;  3BY4 A;  1UKF A;  4IP3 A;  3W30 A;  3MTV A;  2FE8 A;  4RF0 A;  4ZTB A;  3RNV A;  4OW0 A;  2UZJ A;  4BOP A;  2AGA A;  2BTW A;  3PSE A;  2BTW B;  2BU3 A;  3OQC A;  4OVZ A;  3W31 A;  3PT2 A;  4REZ A;  4WUR A;  4BOZ A;  3B21 A;  3PHW A;  2DOS A;  3C0R A;  2JTC A;  2Z84 A;  3PHU A;  4R3D A;  4RKX A;  3TMP A;  4D8B A;  5EZQ A;  4D8I A;  3PRP A;  4M0W A;  1PVJ A;  3O65 A;  2J7Q C;  4MM3 B;  4A5U A;  4BOS A;  3BB7 A;  3ZNH A;  3MP2 A;  4D8E A;  4P16 A;  2J7Q A;  5KO3 A;  3IFU A;  3TRK A;  4BOU A;  3MJ5 A;  4MI7 A;  4HXD B;  4OVZ B;  2JRI A;  4IUM A;  5JZE A;  3PHX A;  5EZS A;  4RF1 A;  4BOQ A;  3E9S A;  4GUA A;  1DKI A;  1YZB A;  4PT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...