2FO5A

Crystal structure of recombinant barley cysteine endoprotease b isoform 2 (ep-b2) in complex with leupeptin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
DLPPSVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterologous Expression, Purification, Refolding, and Structural-Functional Characterization of EP-B2, a Self-Activating Barley Cysteine Endoprotease.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cysteine proteinase EP-B 2
total genus 58
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fo5A00
2AUZA 3I06A 4QH6A 3IHPA 2P0RA 2AS8A 2HH5A 2JQFR 3HD3A 3P5XA 2HHNA 3CBJA 4RY2A 1NPZA 1VSNA 2YJBA 2R9NA 2OP3A 2GHUA 2E02A 3KW9A 3BPFA 1PXVA 1F2BA 3H7DA 2DC7A 1BY8A 3O1GA 5K16A 1U9XA 1Q6KA 2AVWA 1JQPA 1GLOA 3MTNA 2P86A 1U9QX 2WBFX 5CVNB 3H8BA 4I05A 3WXEA 1NL6A 2FQ9A 3PDFA 2ACTA 1SP4B 3HHIA 6PADA 1TU6A 2BDLA 4MZSA 2G7YA 1U9WA 1EWOA 4YYSA 3KFQA 3S3RA 4MZOA 2C0YA 2FYEA 3HWNA 4Q8HA 3KX1A 1NQCA 3PBHA 1NB5A 4QRXA 2DZYA 2YJ2A 4CZWA 2FRAA 1MHWA 4XUIA 2R9CA 1CB5A 1NB3A 1PCIA 3H8CA 1STFE 3IOQA 3OVXA 4YYWA 1AYVA 4CDCB 1BQIA 3V6EA 1EWPA 4Q8GA 2G6DA 3P5WA 2H7JA 3OF9A 4QRVA 4ZUXU 2ARYA 1F2CA 4P6GA 1IWDA 2FUDA 1YVBA 3RVXA 2F7DA 2AUXA 1U9VA 2CIOA 3LFYA 2AIMA 3F5VA 1PADA 2YJCA 1GCBA 2FT2A 3MHSA 1YALA 3H89A 1MDWA 1K3BB 1KHPA 1MEMA 2E00A 1QMYA 2GFOA 3IUTA 4BS6A 1DEUA 3B79A 1CVZA 4N79A 1AECA 1BP4A 1ZIVA 1Y08A 4FK5A 3BPMA 2DCDA 4YYUA 3D6SA 2DCCA 2HD5A 1M6DA 2PREA 3QJ3A 3IEJA 1ME4A 4OELA 5CHTA 4X6HA 1EF7A 2DCAA 2NQGA 1CJLA 1U5IA 3N4CA 2R9FA 2Y5BA 5FPWA 2IBIA 4CDEB 2FTDA 1PBHA 1AIMA 2XU4A 3K8UA 3MORA 4XR7A 1S4VA 1QOLA 1X9YA 4MSXA 5F02A 1VJVA 1KFXL 1ITOA 4QRGA 1ME3A 2E03A 2NQIA 1BGOA 3O0UA 5EGWA 4BS5A 4P6EA 1Y4HA 5CHVA 4K7CA 3K24A 3M99A 4I04A 5PADA 2CB5A 2BDZA 2DJFB 3HHAA 1O0EA 5CVMA 2AYOA 3DF0A 1CQDA 3OF8A 3GCBA 1PPNA 3WXFA 3I3TA 4PADA 3CBKA 2IPPB 3LXSA 3S3QA 1MEGA 1CV8A 4CDDB 4X6JA 1THEA 1PPDA 4I07A 4DMYA 3H6SA 7PCKA 3F75A 2DZZA 5CVOB 4G54A 3P5UA 4AXLA 1AU0A 3QT4A 2NQDB 1CTEA 1GMYA 4PI3A 1TL9A 2F1GA 1F2AA 2G8JA 2DJGB 1KFUL 4OEMA 3RVWA 4N4ZA 3C9EA 4YYVA 2AU1A 2O6XA 3P5VA 1MIRA 3NHEA 1PIPA 2OULA 3BWKA 2YJ8A 2FO5A 5JH3A 3OVZA 9PAPA 1KXRA 2E01A 5JA7A 1MS6A 1CS8A 4PP2E 4KLBA 3E1ZB 4W4UA 3PW3A 4QBBA 2R6NA 1FH0A 3USVA 2G8EA 2VHFA 4BQVA 3KSEA 1PPOA 2PBHA 1KHQA 2JQGR 1TLOA 1QXPA 1ATKA 3QSDA 1YK7A 1ZCMA 2B1MA 3KWBX 4N8WA 3KKUA 4W5BA 1YT7A 2P7UA 4WA6A 1HUCB 3BOWA 4FIPA 2OZ2A 3BC3A 3WXGA 4X6IA 3U8EA 3AI8A 5EF4A 3PNRA 4FJCA 4YYRA 3OISA 2DC6A 5A24A 3IV2A 3CH3X 1F29A 1PPPA 2B1NA 4YV8A 1XKGA 3BCNA 1GECE 1EWMA 1AU3A 4AXMA 4YVAA 3V6CA 2AYNA 1POPA 4W5CA 2DC8A 2R9MA 2XU3A 1YK8A 1PE6A 2ATOA 8PCHA 1SNKA 1AU2A 3KWZA 3ZUAA 4CDFB 1DF0A 1AYWA 2XU5A 4YYQA 2PNSA 4PP1A 2XU1A 3N3KA 1AYUA 3RVVA 2VHSA 2FRQA 2YJ9A 1ICFA 3N3GA 2Y6EA 3K9MA 1CSBB 1EWLA 1AU4A 1NLJA 5J94A 2DCBA 4HWYA 4BPVA 3IMAA 4DMXA 2HXZA 1A6RA 3TNXA 2DC9A 2PADA 3MHHA 2NQAA 3ERVA 3CH2X 4BSQA 2R9OA 1CPJA 1QDQA
chains in the Genus database with same CATH superfamily
2AUZA 3I06A 4QH6A 3IHPA 2P0RA 2AS8A 2HH5A 2JQFR 3OQCA 3HD3A 3P5XA 2FE8A 2HHNA 3CBJA 4RY2A 1NPZA 1VSNA 2YJBA 2R9NA 2OP3A 2GHUA 2E02A 3KW9A 3BPFA 1PXVA 1F2BA 3H7DA 2DC7A 5EZQA 1BY8A 3O1GA 5K16A 1U9XA 3PRMA 1Q6KA 2AVWA 1JQPA 1GLOA 3MTNA 2P86A 4P16A 1U9QX 2WBFX 5CVNB 3H8BA 4I05A 3WXEA 2J7QC 1NL6A 2FQ9A 3PDFA 2ACTA 1YZBA 1SP4B 3HHIA 6PADA 1TU6A 2BDLA 4MZSA 2DOSA 2Z84A 2G7YA 3MTVA 1U9WA 1EWOA 4YYSA 3KFQA 3S3RA 4MZOA 2C0YA 2FYEA 3HWNA 4Q8HA 3KX1A 1NQCA 3PBHA 1NB5A 4MM3B 2BTWA 4QRXA 2DZYA 2YJ2A 3PRPA 4IUMA 2JRIA 4CZWA 2FRAA 1MHWA 4XUIA 4OW0A 2R9CA 1CB5A 1NB3A 1PCIA 3H8CA 1STFE 3IOQA 3MJ5A 3PSEA 3OVXA 4YYWA 1AYVA 4CDCB 1BQIA 3V6EA 1EWPA 4Q8GA 4BOPA 2G6DA 3O65A 3P5WA 2H7JA 3OF9A 4QRVA 4ZUXU 5KO3A 2ARYA 5EZSA 1F2CA 4P6GA 1IWDA 2FUDA 3IFUA 1YVBA 3RVXA 2F7DA 3TMPA 2AUXA 1U9VA 2CIOA 3LFYA 2J7QA 2AIMA 3F5VA 1PADA 2YJCA 1GCBA 2FT2A 2AGAA 3MHSA 1YALA 3H89A 1MDWA 1K3BB 1KHPA 1MEMA 2E00A 1QMYA 2GFOA 4BOQA 3IUTA 4BS6A 1DEUA 3B79A 1CVZA 4N79A 1AECA 1BP4A 4R3DA 1ZIVA 1Y08A 4FK5A 3BPMA 2DCDA 4RKXA 4YYUA 3BY4A 3D6SA 2DCCA 2HD5A 4PT5A 1M6DA 2PREA 3QJ3A 3IEJA 4WURA 1ME4A 4OELA 5CHTA 4X6HA 2UZJA 1EF7A 2DCAA 2NQGA 1CJLA 1U5IA 3N4CA 4REZA 2R9FA 2Y5BA 5FPWA 2IBIA 4CDEB 2FTDA 4GUAA 1PBHA 1AIMA 2XU4A 3K8UA 3MORA 4RF1A 4XR7A 3PHUA 1S4VA 1QOLA 1X9YA 4MSXA 5F02A 1VJVA 1KFXL 1ITOA 3TRKA 4QRGA 1ME3A 2E03A 2NQIA 1BGOA 3O0UA 5EGWA 4BS5A 4P6EA 3ZNHA 1Y4HA 5CHVA 4K7CA 3K24A 3M99A 4I04A 5PADA 2CB5A 2BDZA 2DJFB 3HHAA 1O0EA 5CVMA 2AYOA 3DF0A 1CQDA 3OF8A 3GCBA 4D8EA 3PHWA 1PPNA 4MI7A 3WXFA 3I3TA 4PADA 3CBKA 2IPPB 3LXSA 3S3QA 1MEGA 3MP2A 4BOSA 1CV8A 4CDDB 4X6JA 1THEA 1PPDA 4I07A 4DMYA 3H6SA 7PCKA 3F75A 2DZZA 5CVOB 4G54A 3BBAA 3P5UA 4AXLA 1AU0A 3QT4A 2NQDB 1CTEA 1GMYA 4PI3A 5E6JA 3W30A 1TL9A 2F1GA 1F2AA 2G8JA 4RNAA 4IP3A 2DJGB 1KFUL 4OEMA 3RVWA 4N4ZA 3C9EA 4OVZB 1PVJA 4YYVA 2AU1A 2O6XA 3P5VA 1MIRA 4ZTBA 3NHEA 1PIPA 2OULA 3BWKA 2YJ8A 3PT2A 2FO5A 5JH3A 3OVZA 3W31A 9PAPA 1KXRA 3PHXA 2E01A 5JA7A 1MS6A 1CS8A 4PP2E 4KLBA 3E1ZB 4W4UA 3PW3A 4HXDB 4QBBA 2R6NA 1FH0A 3USVA 2G8EA 2VHFA 4BQVA 3KSEA 1PPOA 2PBHA 1KHQA 2JQGR 1TLOA 1QXPA 1ATKA 3QSDA 1DKIA 1YK7A 1ZCMA 2B1MA 3KWBX 4N8WA 3KKUA 4W5BA 1YT7A 2P7UA 4WA6A 1HUCB 3BOWA 4FIPA 2OZ2A 3C0RA 3BC3A 3WXGA 4X6IA 2HWKA 3U8EA 3AI8A 5EF4A 3PNRA 4FJCA 4YYRA 3OISA 2DC6A 5A24A 3IV2A 3CH3X 1F29A 1PPPA 2B1NA 4YV8A 1XKGA 3BCNA 1GECE 1EWMA 1AU3A 5JZEA 4AXMA 4XZXA 4YVAA 3RNVA 3B21A 3V6CA 2AYNA 4D8BA 1POPA 4W5CA 2DC8A 2R9MA 2XU3A 1YK8A 1PE6A 2ATOA 8PCHA 4RF0A 4M0WA 1SNKA 1AU2A 3KWZA 3ZUAA 2BU3A 4CDFB 1DF0A 2JTCA 1AYWA 2XU5A 1UKFA 2PNSA 4YYQA 4BOUA 4PP1A 2XU1A 3N3KA 1AYUA 4BOZA 3RVVA 2VHSA 2FRQA 2YJ9A 1ICFA 3N3GA 2Y6EA 3K9MA 1CSBB 1EWLA 2BTWB 1AU4A 1NLJA 5J94A 2DCBA 3BB7A 4HWYA 4BPVA 3IMAA 4A5UA 4DMXA 2HXZA 1A6RA 3TNXA 2DC9A 2PADA 3MHHA 2NQAA 3ERVA 4D8IA 3CH2X 3E9SA 4BSQA 2R9OA 4OVZA 1CPJA 1QDQA
chains in the Genus database with same CATH topology
2AUZA 3I06A 4QH6A 3IHPA 2P0RA 2AS8A 2HH5A 2JQFR 3HD3A 3P5XA 2HHNA 3CBJA 4RY2A 1NPZA 1VSNA 2YJBA 2R9NA 2BSZA 2OP3A 2GHUA 2E02A 3KW9A 3BPFA 1PXVA 1F2BA 3H7DA 2DC7A 1BY8A 3O1GA 5K16A 1U9XA 1Q6KA 2AVWA 1JQPA 1GLOA 3MTNA 2P86A 1U9QX 2WBFX 5CVNB 3H8BA 4I05A 3WXEA 1NL6A 2FQ9A 3PDFA 2ACTA 1SP4B 3HHIA 6PADA 1TU6A 2BDLA 4MZSA 2G7YA 1U9WA 1EWOA 4YYSA 3KFQA 3S3RA 4MZOA 4BGFA 2C0YA 2FYEA 3HWNA 4Q8HA 3KX1A 1NQCA 3PBHA 1NB5A 4QRXA 2DZYA 2YJ2A 4CZWA 2FRAA 1MHWA 4XUIA 2R9CA 1CB5A 1NB3A 1PCIA 3H8CA 1STFE 3IOQA 3OVXA 4YYWA 1AYVA 4CDCB 1BQIA 3V6EA 1EWPA 4Q8GA 2G6DA 3P5WA 2VFCA 2H7JA 3OF9A 4QRVA 4ZUXU 2ARYA 1F2CA 4P6GA 1IWDA 2FUDA 1YVBA 3RVXA 2F7DA 2AUXA 1U9VA 2CIOA 3LFYA 3D9WA 2AIMA 3F5VA 1PADA 2YJCA 1GCBA 2FT2A 4GUZA 3MHSA 1YALA 3H89A 1MDWA 1K3BB 4B55A 1KHPA 1MEMA 2E00A 1QMYA 2GFOA 3IUTA 4BS6A 1DEUA 3B79A 1CVZA 4N79A 1AECA 1BP4A 1ZIVA 1Y08A 4FK5A 3BPMA 2DCDA 4YYUA 3D6SA 2DCCA 2HD5A 1M6DA 2PREA 3QJ3A 1W6FA 3IEJA 1ME4A 4OELA 5CHTA 4X6HA 2VFBA 1EF7A 2DCAA 2NQGA 1CJLA 1U5IA 3N4CA 2R9FA 2Y5BA 5FPWA 2IBIA 4CDEB 2FTDA 1PBHA 1AIMA 2XU4A 3K8UA 3MORA 4XR7A 1S4VA 1QOLA 1X9YA 4MSXA 5F02A 1VJVA 1KFXL 1ITOA 4QRGA 1ME3A 2E03A 2NQIA 1BGOA 3O0UA 5EGWA 4BS5A 4P6EA 1Y4HA 5CHVA 4K7CA 3K24A 3M99A 4I04A 5PADA 2CB5A 2BDZA 2DJFB 3HHAA 1O0EA 5CVMA 2AYOA 3DF0A 1CQDA 3OF8A 3GCBA 1PPNA 3WXFA 3I3TA 4PADA 3CBKA 2IPPB 3LXSA 3S3QA 1MEGA 1CV8A 4CDDB 4X6JA 1THEA 1PPDA 4I07A 4DMYA 3H6SA 7PCKA 3F75A 2DZZA 5CVOB 4G54A 3P5UA 4AXLA 1AU0A 3QT4A 2NQDB 1CTEA 1GMYA 4PI3A 1TL9A 1GX3A 2F1GA 1F2AA 2G8JA 2DJGB 1KFUL 4OEMA 3RVWA 4N4ZA 3C9EA 4YYVA 2AU1A 2O6XA 3P5VA 1MIRA 3NHEA 1PIPA 2OULA 3BWKA 2YJ8A 2FO5A 5JH3A 3OVZA 9PAPA 1KXRA 2E01A 5JA7A 1MS6A 1CS8A 4PP2E 4KLBA 3E1ZB 4W4UA 3PW3A 4C5PA 4QBBA 2R6NA 1FH0A 3USVA 2G8EA 2VHFA 4BQVA 3KSEA 1PPOA 2PBHA 1KHQA 2JQGR 1TLOA 1QXPA 1ATKA 3QSDA 1YK7A 1ZCMA 2B1MA 3KWBX 4N8WA 3KKUA 4W5BA 1YT7A 2P7UA 4WA6A 1HUCB 3BOWA 4FIPA 2OZ2A 3BC3A 3WXGA 4X6IA 3U8EA 3AI8A 5EF4A 3PNRA 4FJCA 4YYRA 3OISA 2DC6A 5A24A 3IV2A 3CH3X 1F29A 1PPPA 2B1NA 4YV8A 1XKGA 3BCNA 1GECE 1EWMA 1AU3A 4AXMA 4YVAA 3V6CA 2AYNA 1POPA 4W5CA 2DC8A 2R9MA 2XU3A 1YK8A 1PE6A 2ATOA 8PCHA 1SNKA 1AU2A 4NV8A 3KWZA 3ZUAA 4CDFB 1DF0A 1AYWA 2XU5A 4YYQA 2PNSA 4PP1A 2XU1A 3N3KA 1AYUA 1E2TA 3RVVA 2VHSA 1W4TA 2FRQA 2YJ9A 1ICFA 3N3GA 2Y6EA 3K9MA 1CSBB 1EWLA 1AU4A 1NLJA 4NV7A 2DCBA 5J94A 3LTWA 4HWYA 1W5RA 4BPVA 3IMAA 4DMXA 2HXZA 1A6RA 3TNXA 2DC9A 2PADA 3MHHA 2NQAA 3ERVA 3CH2X 4BSQA 2R9OA 1CPJA 1QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUZ A;  3I06 A;  4QH6 A;  3IHP A;  2P0R A;  2AS8 A;  2HH5 A;  2JQF R;  3HD3 A;  3P5X A;  2HHN A;  3CBJ A;  4RY2 A;  1NPZ A;  1VSN A;  2YJB A;  2R9N A;  2OP3 A;  2GHU A;  2E02 A;  3KW9 A;  3BPF A;  1PXV A;  1F2B A;  3H7D A;  2DC7 A;  1BY8 A;  3O1G A;  5K16 A;  1U9X A;  1Q6K A;  2AVW A;  1JQP A;  1GLO A;  3MTN A;  2P86 A;  1U9Q X;  2WBF X;  5CVN B;  3H8B A;  4I05 A;  3WXE A;  1NL6 A;  2FQ9 A;  3PDF A;  2ACT A;  1SP4 B;  3HHI A;  6PAD A;  1TU6 A;  2BDL A;  4MZS A;  2G7Y A;  1U9W A;  1EWO A;  4YYS A;  3KFQ A;  3S3R A;  4MZO A;  2C0Y A;  2FYE A;  3HWN A;  4Q8H A;  3KX1 A;  1NQC A;  3PBH A;  1NB5 A;  4QRX A;  2DZY A;  2YJ2 A;  4CZW A;  2FRA A;  1MHW A;  4XUI A;  2R9C A;  1CB5 A;  1NB3 A;  1PCI A;  3H8C A;  1STF E;  3IOQ A;  3OVX A;  4YYW A;  1AYV A;  4CDC B;  1BQI A;  3V6E A;  1EWP A;  4Q8G A;  2G6D A;  3P5W A;  2H7J A;  3OF9 A;  4QRV A;  4ZUX U;  2ARY A;  1F2C A;  4P6G A;  1IWD A;  2FUD A;  1YVB A;  3RVX A;  2F7D A;  2AUX A;  1U9V A;  2CIO A;  3LFY A;  2AIM A;  3F5V A;  1PAD A;  2YJC A;  1GCB A;  2FT2 A;  3MHS A;  1YAL A;  3H89 A;  1MDW A;  1K3B B;  1KHP A;  1MEM A;  2E00 A;  1QMY A;  2GFO A;  3IUT A;  4BS6 A;  1DEU A;  3B79 A;  1CVZ A;  4N79 A;  1AEC A;  1BP4 A;  1ZIV A;  1Y08 A;  4FK5 A;  3BPM A;  2DCD A;  4YYU A;  3D6S A;  2DCC A;  2HD5 A;  1M6D A;  2PRE A;  3QJ3 A;  3IEJ A;  1ME4 A;  4OEL A;  5CHT A;  4X6H A;  1EF7 A;  2DCA A;  2NQG A;  1CJL A;  1U5I A;  3N4C A;  2R9F A;  2Y5B A;  5FPW A;  2IBI A;  4CDE B;  2FTD A;  1PBH A;  1AIM A;  2XU4 A;  3K8U A;  3MOR A;  4XR7 A;  1S4V A;  1QOL A;  1X9Y A;  4MSX A;  5F02 A;  1VJV A;  1KFX L;  1ITO A;  4QRG A;  1ME3 A;  2E03 A;  2NQI A;  1BGO A;  3O0U A;  5EGW A;  4BS5 A;  4P6E A;  1Y4H A;  5CHV A;  4K7C A;  3K24 A;  3M99 A;  4I04 A;  5PAD A;  2CB5 A;  2BDZ A;  2DJF B;  3HHA A;  1O0E A;  5CVM A;  2AYO A;  3DF0 A;  1CQD A;  3OF8 A;  3GCB A;  1PPN A;  3WXF A;  3I3T A;  4PAD A;  3CBK A;  2IPP B;  3LXS A;  3S3Q A;  1MEG A;  1CV8 A;  4CDD B;  4X6J A;  1THE A;  1PPD A;  4I07 A;  4DMY A;  3H6S A;  7PCK A;  3F75 A;  2DZZ A;  5CVO B;  4G54 A;  3P5U A;  4AXL A;  1AU0 A;  3QT4 A;  2NQD B;  1CTE A;  1GMY A;  4PI3 A;  1TL9 A;  2F1G A;  1F2A A;  2G8J A;  2DJG B;  1KFU L;  4OEM A;  3RVW A;  4N4Z A;  3C9E A;  4YYV A;  2AU1 A;  2O6X A;  3P5V A;  1MIR A;  3NHE A;  1PIP A;  2OUL A;  3BWK A;  2YJ8 A;  2FO5 A;  5JH3 A;  3OVZ A;  9PAP A;  1KXR A;  2E01 A;  5JA7 A;  1MS6 A;  1CS8 A;  4PP2 E;  4KLB A;  3E1Z B;  4W4U A;  3PW3 A;  4QBB A;  2R6N A;  1FH0 A;  3USV A;  2G8E A;  2VHF A;  4BQV A;  3KSE A;  1PPO A;  2PBH A;  1KHQ A;  2JQG R;  1TLO A;  1QXP A;  1ATK A;  3QSD A;  1YK7 A;  1ZCM A;  2B1M A;  3KWB X;  4N8W A;  3KKU A;  4W5B A;  1YT7 A;  2P7U A;  4WA6 A;  1HUC B;  3BOW A;  4FIP A;  2OZ2 A;  3BC3 A;  3WXG A;  4X6I A;  3U8E A;  3AI8 A;  5EF4 A;  3PNR A;  4FJC A;  4YYR A;  3OIS A;  2DC6 A;  5A24 A;  3IV2 A;  3CH3 X;  1F29 A;  1PPP A;  2B1N A;  4YV8 A;  1XKG A;  3BCN A;  1GEC E;  1EWM A;  1AU3 A;  4AXM A;  4YVA A;  3V6C A;  2AYN A;  1POP A;  4W5C A;  2DC8 A;  2R9M A;  2XU3 A;  1YK8 A;  1PE6 A;  2ATO A;  8PCH A;  1SNK A;  1AU2 A;  3KWZ A;  3ZUA A;  4CDF B;  1DF0 A;  1AYW A;  2XU5 A;  4YYQ A;  2PNS A;  4PP1 A;  2XU1 A;  3N3K A;  1AYU A;  3RVV A;  2VHS A;  2FRQ A;  2YJ9 A;  1ICF A;  3N3G A;  2Y6E A;  3K9M A;  1CSB B;  1EWL A;  1AU4 A;  1NLJ A;  5J94 A;  2DCB A;  4HWY A;  4BPV A;  3IMA A;  4DMX A;  2HXZ A;  1A6R A;  3TNX A;  2DC9 A;  2PAD A;  3MHH A;  2NQA A;  3ERV A;  3CH2 X;  4BSQ A;  2R9O A;  1CPJ A;  1QDQ A; 
#chains in the Genus database with same CATH topology
 2AUZ A;  3I06 A;  4QH6 A;  3IHP A;  2P0R A;  2AS8 A;  2HH5 A;  2JQF R;  3OQC A;  3HD3 A;  3P5X A;  2FE8 A;  2HHN A;  3CBJ A;  4RY2 A;  1NPZ A;  1VSN A;  2YJB A;  2R9N A;  2OP3 A;  2GHU A;  2E02 A;  3KW9 A;  3BPF A;  1PXV A;  1F2B A;  3H7D A;  2DC7 A;  5EZQ A;  1BY8 A;  3O1G A;  5K16 A;  1U9X A;  3PRM A;  1Q6K A;  2AVW A;  1JQP A;  1GLO A;  3MTN A;  2P86 A;  4P16 A;  1U9Q X;  2WBF X;  5CVN B;  3H8B A;  4I05 A;  3WXE A;  2J7Q C;  1NL6 A;  2FQ9 A;  3PDF A;  2ACT A;  1YZB A;  1SP4 B;  3HHI A;  6PAD A;  1TU6 A;  2BDL A;  4MZS A;  2DOS A;  2Z84 A;  2G7Y A;  3MTV A;  1U9W A;  1EWO A;  4YYS A;  3KFQ A;  3S3R A;  4MZO A;  2C0Y A;  2FYE A;  3HWN A;  4Q8H A;  3KX1 A;  1NQC A;  3PBH A;  1NB5 A;  4MM3 B;  2BTW A;  4QRX A;  2DZY A;  2YJ2 A;  3PRP A;  4IUM A;  2JRI A;  4CZW A;  2FRA A;  1MHW A;  4XUI A;  4OW0 A;  2R9C A;  1CB5 A;  1NB3 A;  1PCI A;  3H8C A;  1STF E;  3IOQ A;  3MJ5 A;  3PSE A;  3OVX A;  4YYW A;  1AYV A;  4CDC B;  1BQI A;  3V6E A;  1EWP A;  4Q8G A;  4BOP A;  2G6D A;  3O65 A;  3P5W A;  2H7J A;  3OF9 A;  4QRV A;  4ZUX U;  5KO3 A;  2ARY A;  5EZS A;  1F2C A;  4P6G A;  1IWD A;  2FUD A;  3IFU A;  1YVB A;  3RVX A;  2F7D A;  3TMP A;  2AUX A;  1U9V A;  2CIO A;  3LFY A;  2J7Q A;  2AIM A;  3F5V A;  1PAD A;  2YJC A;  1GCB A;  2FT2 A;  2AGA A;  3MHS A;  1YAL A;  3H89 A;  1MDW A;  1K3B B;  1KHP A;  1MEM A;  2E00 A;  1QMY A;  2GFO A;  4BOQ A;  3IUT A;  4BS6 A;  1DEU A;  3B79 A;  1CVZ A;  4N79 A;  1AEC A;  1BP4 A;  4R3D A;  1ZIV A;  1Y08 A;  4FK5 A;  3BPM A;  2DCD A;  4RKX A;  4YYU A;  3BY4 A;  3D6S A;  2DCC A;  2HD5 A;  4PT5 A;  1M6D A;  2PRE A;  3QJ3 A;  3IEJ A;  4WUR A;  1ME4 A;  4OEL A;  5CHT A;  4X6H A;  2UZJ A;  1EF7 A;  2DCA A;  2NQG A;  1CJL A;  1U5I A;  3N4C A;  4REZ A;  2R9F A;  2Y5B A;  5FPW A;  2IBI A;  4CDE B;  2FTD A;  4GUA A;  1PBH A;  1AIM A;  2XU4 A;  3K8U A;  3MOR A;  4RF1 A;  4XR7 A;  3PHU A;  1S4V A;  1QOL A;  1X9Y A;  4MSX A;  5F02 A;  1VJV A;  1KFX L;  1ITO A;  3TRK A;  4QRG A;  1ME3 A;  2E03 A;  2NQI A;  1BGO A;  3O0U A;  5EGW A;  4BS5 A;  4P6E A;  3ZNH A;  1Y4H A;  5CHV A;  4K7C A;  3K24 A;  3M99 A;  4I04 A;  5PAD A;  2CB5 A;  2BDZ A;  2DJF B;  3HHA A;  1O0E A;  5CVM A;  2AYO A;  3DF0 A;  1CQD A;  3OF8 A;  3GCB A;  4D8E A;  3PHW A;  1PPN A;  4MI7 A;  3WXF A;  3I3T A;  4PAD A;  3CBK A;  2IPP B;  3LXS A;  3S3Q A;  1MEG A;  3MP2 A;  4BOS A;  1CV8 A;  4CDD B;  4X6J A;  1THE A;  1PPD A;  4I07 A;  4DMY A;  3H6S A;  7PCK A;  3F75 A;  2DZZ A;  5CVO B;  4G54 A;  3BBA A;  3P5U A;  4AXL A;  1AU0 A;  3QT4 A;  2NQD B;  1CTE A;  1GMY A;  4PI3 A;  5E6J A;  3W30 A;  1TL9 A;  2F1G A;  1F2A A;  2G8J A;  4RNA A;  4IP3 A;  2DJG B;  1KFU L;  4OEM A;  3RVW A;  4N4Z A;  3C9E A;  4OVZ B;  1PVJ A;  4YYV A;  2AU1 A;  2O6X A;  3P5V A;  1MIR A;  4ZTB A;  3NHE A;  1PIP A;  2OUL A;  3BWK A;  2YJ8 A;  3PT2 A;  2FO5 A;  5JH3 A;  3OVZ A;  3W31 A;  9PAP A;  1KXR A;  3PHX A;  2E01 A;  5JA7 A;  1MS6 A;  1CS8 A;  4PP2 E;  4KLB A;  3E1Z B;  4W4U A;  3PW3 A;  4HXD B;  4QBB A;  2R6N A;  1FH0 A;  3USV A;  2G8E A;  2VHF A;  4BQV A;  3KSE A;  1PPO A;  2PBH A;  1KHQ A;  2JQG R;  1TLO A;  1QXP A;  1ATK A;  3QSD A;  1DKI A;  1YK7 A;  1ZCM A;  2B1M A;  3KWB X;  4N8W A;  3KKU A;  4W5B A;  1YT7 A;  2P7U A;  4WA6 A;  1HUC B;  3BOW A;  4FIP A;  2OZ2 A;  3C0R A;  3BC3 A;  3WXG A;  4X6I A;  2HWK A;  3U8E A;  3AI8 A;  5EF4 A;  3PNR A;  4FJC A;  4YYR A;  3OIS A;  2DC6 A;  5A24 A;  3IV2 A;  3CH3 X;  1F29 A;  1PPP A;  2B1N A;  4YV8 A;  1XKG A;  3BCN A;  1GEC E;  1EWM A;  1AU3 A;  5JZE A;  4AXM A;  4XZX A;  4YVA A;  3RNV A;  3B21 A;  3V6C A;  2AYN A;  4D8B A;  1POP A;  4W5C A;  2DC8 A;  2R9M A;  2XU3 A;  1YK8 A;  1PE6 A;  2ATO A;  8PCH A;  4RF0 A;  4M0W A;  1SNK A;  1AU2 A;  3KWZ A;  3ZUA A;  2BU3 A;  4CDF B;  1DF0 A;  2JTC A;  1AYW A;  2XU5 A;  1UKF A;  2PNS A;  4YYQ A;  4BOU A;  4PP1 A;  2XU1 A;  3N3K A;  1AYU A;  4BOZ A;  3RVV A;  2VHS A;  2FRQ A;  2YJ9 A;  1ICF A;  3N3G A;  2Y6E A;  3K9M A;  1CSB B;  1EWL A;  2BTW B;  1AU4 A;  1NLJ A;  5J94 A;  2DCB A;  3BB7 A;  4HWY A;  4BPV A;  3IMA A;  4A5U A;  4DMX A;  2HXZ A;  1A6R A;  3TNX A;  2DC9 A;  2PAD A;  3MHH A;  2NQA A;  3ERV A;  4D8I A;  3CH2 X;  3E9S A;  4BSQ A;  2R9O A;  4OVZ A;  1CPJ A;  1QDQ A; 
#chains in the Genus database with same CATH homology
 2AUZ A;  3I06 A;  4QH6 A;  3IHP A;  2P0R A;  2AS8 A;  2HH5 A;  2JQF R;  3HD3 A;  3P5X A;  2HHN A;  3CBJ A;  4RY2 A;  1NPZ A;  1VSN A;  2YJB A;  2R9N A;  2BSZ A;  2OP3 A;  2GHU A;  2E02 A;  3KW9 A;  3BPF A;  1PXV A;  1F2B A;  3H7D A;  2DC7 A;  1BY8 A;  3O1G A;  5K16 A;  1U9X A;  1Q6K A;  2AVW A;  1JQP A;  1GLO A;  3MTN A;  2P86 A;  1U9Q X;  2WBF X;  5CVN B;  3H8B A;  4I05 A;  3WXE A;  1NL6 A;  2FQ9 A;  3PDF A;  2ACT A;  1SP4 B;  3HHI A;  6PAD A;  1TU6 A;  2BDL A;  4MZS A;  2G7Y A;  1U9W A;  1EWO A;  4YYS A;  3KFQ A;  3S3R A;  4MZO A;  4BGF A;  2C0Y A;  2FYE A;  3HWN A;  4Q8H A;  3KX1 A;  1NQC A;  3PBH A;  1NB5 A;  4QRX A;  2DZY A;  2YJ2 A;  4CZW A;  2FRA A;  1MHW A;  4XUI A;  2R9C A;  1CB5 A;  1NB3 A;  1PCI A;  3H8C A;  1STF E;  3IOQ A;  3OVX A;  4YYW A;  1AYV A;  4CDC B;  1BQI A;  3V6E A;  1EWP A;  4Q8G A;  2G6D A;  3P5W A;  2VFC A;  2H7J A;  3OF9 A;  4QRV A;  4ZUX U;  2ARY A;  1F2C A;  4P6G A;  1IWD A;  2FUD A;  1YVB A;  3RVX A;  2F7D A;  2AUX A;  1U9V A;  2CIO A;  3LFY A;  3D9W A;  2AIM A;  3F5V A;  1PAD A;  2YJC A;  1GCB A;  2FT2 A;  4GUZ A;  3MHS A;  1YAL A;  3H89 A;  1MDW A;  1K3B B;  4B55 A;  1KHP A;  1MEM A;  2E00 A;  1QMY A;  2GFO A;  3IUT A;  4BS6 A;  1DEU A;  3B79 A;  1CVZ A;  4N79 A;  1AEC A;  1BP4 A;  1ZIV A;  1Y08 A;  4FK5 A;  3BPM A;  2DCD A;  4YYU A;  3D6S A;  2DCC A;  2HD5 A;  1M6D A;  2PRE A;  3QJ3 A;  1W6F A;  3IEJ A;  1ME4 A;  4OEL A;  5CHT A;  4X6H A;  2VFB A;  1EF7 A;  2DCA A;  2NQG A;  1CJL A;  1U5I A;  3N4C A;  2R9F A;  2Y5B A;  5FPW A;  2IBI A;  4CDE B;  2FTD A;  1PBH A;  1AIM A;  2XU4 A;  3K8U A;  3MOR A;  4XR7 A;  1S4V A;  1QOL A;  1X9Y A;  4MSX A;  5F02 A;  1VJV A;  1KFX L;  1ITO A;  4QRG A;  1ME3 A;  2E03 A;  2NQI A;  1BGO A;  3O0U A;  5EGW A;  4BS5 A;  4P6E A;  1Y4H A;  5CHV A;  4K7C A;  3K24 A;  3M99 A;  4I04 A;  5PAD A;  2CB5 A;  2BDZ A;  2DJF B;  3HHA A;  1O0E A;  5CVM A;  2AYO A;  3DF0 A;  1CQD A;  3OF8 A;  3GCB A;  1PPN A;  3WXF A;  3I3T A;  4PAD A;  3CBK A;  2IPP B;  3LXS A;  3S3Q A;  1MEG A;  1CV8 A;  4CDD B;  4X6J A;  1THE A;  1PPD A;  4I07 A;  4DMY A;  3H6S A;  7PCK A;  3F75 A;  2DZZ A;  5CVO B;  4G54 A;  3P5U A;  4AXL A;  1AU0 A;  3QT4 A;  2NQD B;  1CTE A;  1GMY A;  4PI3 A;  1TL9 A;  1GX3 A;  2F1G A;  1F2A A;  2G8J A;  2DJG B;  1KFU L;  4OEM A;  3RVW A;  4N4Z A;  3C9E A;  4YYV A;  2AU1 A;  2O6X A;  3P5V A;  1MIR A;  3NHE A;  1PIP A;  2OUL A;  3BWK A;  2YJ8 A;  2FO5 A;  5JH3 A;  3OVZ A;  9PAP A;  1KXR A;  2E01 A;  5JA7 A;  1MS6 A;  1CS8 A;  4PP2 E;  4KLB A;  3E1Z B;  4W4U A;  3PW3 A;  4C5P A;  4QBB A;  2R6N A;  1FH0 A;  3USV A;  2G8E A;  2VHF A;  4BQV A;  3KSE A;  1PPO A;  2PBH A;  1KHQ A;  2JQG R;  1TLO A;  1QXP A;  1ATK A;  3QSD A;  1YK7 A;  1ZCM A;  2B1M A;  3KWB X;  4N8W A;  3KKU A;  4W5B A;  1YT7 A;  2P7U A;  4WA6 A;  1HUC B;  3BOW A;  4FIP A;  2OZ2 A;  3BC3 A;  3WXG A;  4X6I A;  3U8E A;  3AI8 A;  5EF4 A;  3PNR A;  4FJC A;  4YYR A;  3OIS A;  2DC6 A;  5A24 A;  3IV2 A;  3CH3 X;  1F29 A;  1PPP A;  2B1N A;  4YV8 A;  1XKG A;  3BCN A;  1GEC E;  1EWM A;  1AU3 A;  4AXM A;  4YVA A;  3V6C A;  2AYN A;  1POP A;  4W5C A;  2DC8 A;  2R9M A;  2XU3 A;  1YK8 A;  1PE6 A;  2ATO A;  8PCH A;  1SNK A;  1AU2 A;  4NV8 A;  3KWZ A;  3ZUA A;  4CDF B;  1DF0 A;  1AYW A;  2XU5 A;  4YYQ A;  2PNS A;  4PP1 A;  2XU1 A;  3N3K A;  1AYU A;  1E2T A;  3RVV A;  2VHS A;  1W4T A;  2FRQ A;  2YJ9 A;  1ICF A;  3N3G A;  2Y6E A;  3K9M A;  1CSB B;  1EWL A;  1AU4 A;  1NLJ A;  4NV7 A;  2DCB A;  5J94 A;  3LTW A;  4HWY A;  1W5R A;  4BPV A;  3IMA A;  4DMX A;  2HXZ A;  1A6R A;  3TNX A;  2DC9 A;  2PAD A;  3MHH A;  2NQA A;  3ERV A;  3CH2 X;  4BSQ A;  2R9O A;  1CPJ A;  1QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...