2B1MA

Crystal structure of a papain-fold protein without the catalytic cysteine from seeds of pachyrhizus erosus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
225
structure length
225
Chain Sequence
b'APESWDWSKKGVITKVKFQGQCGSGWAFSATGAIEAAHAIATGNLVSLSEQELIDCVDESEGCYNGWHYQSFEWVVKHGGIASEADYPYKARDGKCKANEIQDKVTIDNYGVQILSNESTESEAESSLQSFVLEQPISVSIDAKDFHFYSGGIYDGGNCSSPYGINHFVLIVGYGSEDGVDYWIAKNSWGEDWGIDGYIRIQRNTGNLLGVCGMNYFASYPIIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPE31
publication title Crystal structure of a papain-fold protein without the catalytic residue: a novel member in the cysteine proteinase family
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 64
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2b1mA00
4AXMA 2NQAA 4BPVA 3WXFA 3C9EA 3OF9A 2FYEA 3F75A 1MS6A 3H8CA 4PP2E 1YVBA 2CIOA 4YVAA 1PPOA 3ERVA 1NPZA 1JQPA 3H8BA 4YV8A 2XU3A 4W5BA 1AIMA 1F29A 4I05A 2G8EA 3MORA 2P86A 5CHVA 3O0UA 2HXZA 1AU2A 3F5VA 1CTEA 1ATKA 2YJ8A 5FPWA 3KWZA 1F2AA 1HUCB 1U9QX 1CVZA 4BS6A 2G8JA 1KXRA 2R9FA 3KW9A 5CVOB 3B79A 1PCIA 4N8WA 3OISA 1TLOA 3IMAA 2ACTA 1PE6A 4QH6A 2E03A 4MSXA 1U9VA 1MEMA 1YT7A 1PXVA 4P6EA 1AU3A 3PW3A 4HWYA 3CH3X 1DF0A 3RVWA 1AYVA 4I07A 1KHPA 3N4CA 1CSBB 3HHAA 2F7DA 2DC7A 2DJGB 4BSQA 2DC9A 1O0EA 2E00A 3CBJA 1S4VA 2YJCA 3QT4A 1AYWA 4FK5A 5PADA 3AI8A 4YYSA 3IEJA 4CDCB 3P5UA 4G54A 1KFUL 1CPJA 1THEA 1NQCA 1K3BB 8PCHA 2DC6A 2DCBA 2OZ2A 3PBHA 3HD3A 1U5IA 2O6XA 1FH0A 3N3GA 4MZSA 2FQ9A 4XR7A 1QMYA 1ITOA 2OP3A 4FIPA 4Q8HA 2H7JA 3IOQA 2E01A 1U9WA 5CHTA 4WA6A 3CH2X 3QSDA 2Y5BA 1NB5A 4X6IA 1PADA 3H89A 2HHNA 4YYVA 4CDEB 5JH3A 1MDWA 3H7DA 3I3TA 1EF7A 1PPPA 2WBFX 1AYUA 1NL6A 1CS8A 1GECE 3ZUAA 1CB5A 1AECA 3TNXA 4W5CA 5F02A 3I06A 2P0RA 3DF0A 1AU4A 3K8UA 1VJVA 2BDLA 2AUZA 3LXSA 3BC3A 3K24A 2PREA 1SNKA 2DC8A 1QXPA 3BCNA 4ZUXU 2NQDB 2YJ2A 2DZYA 2P7UA 2ARYA 1YK8A 2R9MA 7PCKA 2HD5A 1Y4HA 1VSNA 2YJBA 2BDZA 3RVXA 2XU5A 2NQIA 1PBHA 4QRGA 1STFE 2FO5A 4CDFB 2G6DA 1KFXL 3PDFA 1BGOA 2AIMA 1ME4A 3CBKA 1M6DA 2JQFR 3U8EA 1IWDA 3KWBX 4X6JA 1GCBA 5K16A 2E02A 4YYQA 3BPMA 1U9XA 4CZWA 1MIRA 3IUTA 1A6RA 2AU1A 1MEGA 2VHFA 5EGWA 1ZIVA 2DCAA 1PPNA 1F2CA 4QRVA 4Q8GA 2XU1A 3BOWA 2AYNA 2ATOA 2XU4A 1CV8A 3H6SA 3D6SA 2GFOA 4DMXA 4YYUA 4N79A 3KX1A 2DCCA 1DEUA 4QBBA 1ME3A 3P5WA 2C0YA 2R6NA 3GCBA 1NB3A 2DZZA 2G7YA 2HH5A 4KLBA 1YK7A 3P5VA 2PADA 1F2BA 1TL9A 3KSEA 3K9MA 2FTDA 3IV2A 3LFYA 4PADA 4OELA 4X6HA 1TU6A 3OVZA 1BY8A 1ICFA 4YYWA 2DJFB 4I04A 2FRQA 4QRXA 3RVVA 3PNRA 3V6CA 3MHSA 4W4UA 2FRAA 1EWOA 1KHQA 2GHUA 1MHWA 4MZOA 5CVMA 3WXGA 2B1MA 3MHHA 1BQIA 4CDDB 3O1GA 2F1GA 3KFQA 6PADA 2AYOA 2B1NA 3OVXA 2VHSA 2YJ9A 4K7CA 1EWLA 3WXEA 2AVWA 2FT2A 2FUDA 1CQDA 3BPFA 4N4ZA 3HHIA 3S3RA 2JQGR 3KKUA 1SP4B 3S3QA 1XKGA 5A24A 3NHEA 1GMYA 1EWPA 1PIPA 1YALA 4AXLA 1X9YA 1QOLA 9PAPA 2CB5A 1PPDA 2IPPB 1GLOA 2NQGA 4BQVA 2Y6EA 3N3KA 4XUIA 5EF4A 1ZCMA 1POPA 1AU0A 5CVNB 4PP1A 3IHPA 2R9CA 4PI3A 3HWNA 1BP4A 3MTNA 4BS5A 2OULA 4RY2A 4OEMA 4P6GA 2DCDA 2IBIA 2AUXA 1Q6KA 1CJLA 4FJCA 3OF8A 3BWKA 5JA7A 2PBHA 2AS8A 2PNSA 1EWMA 1QDQA 5J94A 4YYRA 3E1ZB 3USVA 2R9OA 3QJ3A 1Y08A 4DMYA 3P5XA 3M99A 1NLJA 3V6EA 2R9NA
chains in the Genus database with same CATH superfamily
3PHWA 4AXMA 2NQAA 4BPVA 3WXFA 3C9EA 3OF9A 2FYEA 3F75A 1MS6A 3H8CA 4IUMA 4PP2E 1YVBA 2CIOA 4YVAA 4RF0A 1PPOA 3ERVA 1NPZA 4RNAA 1JQPA 3W31A 3PHXA 3H8BA 4YV8A 2XU3A 4W5BA 1AIMA 1F29A 4I05A 2G8EA 4GUAA 3MORA 2P86A 5CHVA 3O0UA 2HXZA 1AU2A 3F5VA 1CTEA 1ATKA 2YJ8A 5FPWA 4D8EA 3KWZA 1F2AA 1HUCB 1U9QX 1CVZA 4BS6A 2G8JA 1KXRA 2R9FA 4RF1A 3KW9A 5CVOB 3B79A 1PCIA 4N8WA 3OISA 1TLOA 3IMAA 2ACTA 1PE6A 4BOQA 4HXDB 4QH6A 2Z84A 1PVJA 2E03A 1U9VA 4MSXA 1MEMA 1YT7A 1PXVA 4P6EA 1AU3A 4P16A 3PW3A 4HWYA 2DOSA 2J7QC 3CH3X 1DF0A 3BB7A 3RVWA 3IFUA 3O65A 1AYVA 4I07A 1KHPA 3N4CA 1CSBB 3HHAA 2F7DA 2DC7A 2DJGB 4BSQA 2DC9A 1O0EA 2E00A 3CBJA 1S4VA 4PT5A 2YJCA 3QT4A 1AYWA 4FK5A 5PADA 3AI8A 4YYSA 3IEJA 4CDCB 3P5UA 4G54A 4IP3A 1KFUL 1CPJA 3C0RA 4D8BA 1THEA 1NQCA 1K3BB 8PCHA 2DC6A 2DCBA 2OZ2A 3PBHA 3HD3A 1U5IA 2O6XA 1FH0A 3N3GA 4MZSA 5EZSA 2FQ9A 4XR7A 4BOUA 1QMYA 1ITOA 2OP3A 4FIPA 4Q8HA 4R3DA 2H7JA 3IOQA 2E01A 1U9WA 5CHTA 4WA6A 4RKXA 3CH2X 3QSDA 2Y5BA 1NB5A 4X6IA 1PADA 3H89A 2HHNA 4YYVA 4CDEB 5JH3A 1MDWA 3H7DA 3I3TA 1EF7A 1PPPA 2WBFX 1AYUA 1NL6A 1CS8A 1GECE 3ZUAA 1CB5A 1AECA 3TNXA 4W5CA 5F02A 4MM3B 3I06A 2P0RA 3DF0A 1AU4A 2BTWB 3K8UA 1VJVA 4M0WA 2BDLA 2AUZA 3LXSA 3BC3A 3K24A 2PREA 1SNKA 2DC8A 1QXPA 3BCNA 4ZUXU 2NQDB 4MI7A 2YJ2A 1YZBA 4OVZB 2DZYA 2P7UA 2ARYA 1YK8A 3MJ5A 2R9MA 7PCKA 2HD5A 1Y4HA 1VSNA 2YJBA 3BBAA 2BDZA 3RVXA 2XU5A 2NQIA 1PBHA 4QRGA 1STFE 2FO5A 4CDFB 2G6DA 1KFXL 3PDFA 1BGOA 2AIMA 1ME4A 3CBKA 1M6DA 2JQFR 3U8EA 1IWDA 3KWBX 4X6JA 1GCBA 5K16A 3PSEA 2E02A 4YYQA 3BPMA 1U9XA 4CZWA 1MIRA 3IUTA 1A6RA 2AU1A 3PT2A 1MEGA 2VHFA 5EGWA 1ZIVA 2DCAA 1PPNA 1F2CA 2UZJA 4QRVA 4Q8GA 1DKIA 2XU1A 3BOWA 2AYNA 2ATOA 2XU4A 1CV8A 3H6SA 3D6SA 2GFOA 4DMXA 4YYUA 4N79A 4BOSA 3KX1A 2DCCA 1DEUA 4QBBA 3RNVA 1ME3A 3P5WA 2C0YA 2R6NA 3GCBA 1NB3A 2DZZA 3BY4A 2G7YA 2HH5A 2BU3A 4KLBA 1YK7A 3OQCA 3TMPA 3P5VA 2PADA 1F2BA 1TL9A 3KSEA 3E9SA 3K9MA 3MP2A 2FTDA 3IV2A 3LFYA 5KO3A 4PADA 4OELA 4X6HA 1TU6A 3TRKA 3OVZA 1BY8A 1ICFA 4YYWA 2DJFB 4I04A 2FRQA 4QRXA 4WURA 3RVVA 3PNRA 5E6JA 4D8IA 3V6CA 3MHSA 4W4UA 2FRAA 1EWOA 1KHQA 2GHUA 1MHWA 4MZOA 5CVMA 3W30A 3WXGA 2B1MA 3MHHA 1BQIA 4REZA 4CDDB 3O1GA 2F1GA 3KFQA 4BOZA 6PADA 3PRMA 2AYOA 2B1NA 3B21A 3OVXA 2VHSA 2YJ9A 4K7CA 1EWLA 3WXEA 4BOPA 2AVWA 2FT2A 3ZNHA 2FUDA 2JTCA 1CQDA 3MTVA 3BPFA 4N4ZA 3HHIA 3S3RA 2JQGR 3KKUA 2BTWA 1SP4B 3S3QA 1XKGA 2FE8A 5A24A 3NHEA 1GMYA 1EWPA 5JZEA 1PIPA 1YALA 4OVZA 4AXLA 1X9YA 1QOLA 9PAPA 2CB5A 1UKFA 1PPDA 2IPPB 1GLOA 2NQGA 4BQVA 2Y6EA 3N3KA 4XUIA 5EF4A 4ZTBA 1ZCMA 1POPA 1AU0A 2J7QA 5CVNB 2JRIA 4PP1A 3IHPA 2R9CA 2AGAA 4PI3A 3HWNA 1BP4A 3MTNA 4BS5A 2OULA 4RY2A 4OEMA 4P6GA 2DCDA 2IBIA 2AUXA 1Q6KA 1CJLA 4FJCA 3OF8A 3BWKA 5JA7A 2PBHA 2AS8A 2PNSA 1EWMA 1QDQA 5J94A 4YYRA 3E1ZB 3USVA 2HWKA 2R9OA 4XZXA 3QJ3A 3PRPA 1Y08A 5EZQA 4DMYA 3P5XA 3M99A 4A5UA 1NLJA 3V6EA 2R9NA 4OW0A 3PHUA
chains in the Genus database with same CATH topology
4AXMA 2NQAA 4BPVA 3WXFA 3C9EA 3OF9A 2FYEA 3F75A 1MS6A 3H8CA 4PP2E 1YVBA 2CIOA 4YVAA 1PPOA 3ERVA 1NPZA 1JQPA 3H8BA 4YV8A 2XU3A 4W5BA 1AIMA 1F29A 4I05A 4BGFA 2G8EA 3MORA 2P86A 5CHVA 3O0UA 2HXZA 1AU2A 3F5VA 1CTEA 4B55A 1ATKA 2YJ8A 5FPWA 3KWZA 4GUZA 1F2AA 1HUCB 1U9QX 1CVZA 4BS6A 2G8JA 1KXRA 2R9FA 3KW9A 5CVOB 3B79A 1PCIA 4N8WA 3OISA 1TLOA 3IMAA 2ACTA 1PE6A 4QH6A 2E03A 4MSXA 1U9VA 1MEMA 1YT7A 1PXVA 4P6EA 1AU3A 3PW3A 4HWYA 3CH3X 1DF0A 3RVWA 1AYVA 4I07A 1KHPA 3N4CA 1CSBB 3HHAA 2F7DA 2DC7A 2DJGB 4BSQA 2DC9A 1O0EA 2E00A 3CBJA 1S4VA 2YJCA 3QT4A 1AYWA 4FK5A 5PADA 3AI8A 4YYSA 3IEJA 2VFBA 4CDCB 3P5UA 4G54A 1KFUL 1CPJA 1THEA 1NQCA 1K3BB 8PCHA 4C5PA 2DC6A 2DCBA 2OZ2A 3PBHA 3HD3A 1U5IA 2O6XA 1FH0A 3N3GA 4MZSA 2FQ9A 4XR7A 3LTWA 1QMYA 1ITOA 2OP3A 4FIPA 4Q8HA 2H7JA 3IOQA 2E01A 1U9WA 5CHTA 4WA6A 2BSZA 3CH2X 3QSDA 2Y5BA 1NB5A 4X6IA 1PADA 3H89A 2HHNA 4YYVA 4CDEB 5JH3A 1MDWA 3H7DA 3I3TA 1EF7A 1PPPA 2WBFX 1AYUA 1NL6A 1CS8A 1GECE 3ZUAA 1CB5A 1AECA 3TNXA 4W5CA 5F02A 3I06A 2P0RA 3DF0A 1AU4A 3K8UA 1VJVA 2BDLA 2AUZA 3LXSA 3BC3A 3K24A 2PREA 1SNKA 2DC8A 1QXPA 3BCNA 4ZUXU 2NQDB 2YJ2A 2DZYA 2P7UA 1W5RA 2ARYA 1YK8A 2R9MA 7PCKA 2HD5A 1Y4HA 1VSNA 2YJBA 2BDZA 3RVXA 2XU5A 2NQIA 1PBHA 4QRGA 1STFE 2FO5A 4CDFB 2G6DA 1KFXL 3PDFA 1W4TA 1BGOA 2AIMA 1ME4A 3CBKA 1M6DA 2JQFR 3U8EA 1IWDA 3KWBX 4X6JA 1GCBA 3D9WA 5K16A 1W6FA 2E02A 1GX3A 4YYQA 3BPMA 1U9XA 4CZWA 1MIRA 3IUTA 1A6RA 2AU1A 1MEGA 2VHFA 5EGWA 1ZIVA 2DCAA 1E2TA 1PPNA 1F2CA 4QRVA 4Q8GA 4NV8A 2XU1A 3BOWA 2AYNA 2ATOA 2XU4A 1CV8A 3H6SA 3D6SA 2GFOA 4DMXA 4YYUA 4N79A 3KX1A 2DCCA 1DEUA 4QBBA 1ME3A 3P5WA 2C0YA 2R6NA 3GCBA 2VFCA 1NB3A 2DZZA 2G7YA 2HH5A 4KLBA 1YK7A 3P5VA 2PADA 1F2BA 1TL9A 3KSEA 3K9MA 2FTDA 3IV2A 3LFYA 4PADA 4OELA 4X6HA 1TU6A 3OVZA 1BY8A 1ICFA 4YYWA 2DJFB 4I04A 2FRQA 4QRXA 3RVVA 3PNRA 3V6CA 3MHSA 4W4UA 2FRAA 1EWOA 1KHQA 2GHUA 1MHWA 4MZOA 5CVMA 3WXGA 2B1MA 3MHHA 4NV7A 1BQIA 4CDDB 3O1GA 2F1GA 3KFQA 6PADA 2AYOA 2B1NA 3OVXA 2VHSA 2YJ9A 4K7CA 1EWLA 3WXEA 2AVWA 2FT2A 2FUDA 1CQDA 3BPFA 4N4ZA 3HHIA 3S3RA 2JQGR 3KKUA 1SP4B 3S3QA 1XKGA 5A24A 3NHEA 1GMYA 1EWPA 1PIPA 1YALA 4AXLA 1X9YA 1QOLA 9PAPA 2CB5A 1PPDA 2IPPB 1GLOA 2NQGA 4BQVA 2Y6EA 3N3KA 4XUIA 5EF4A 1ZCMA 1POPA 1AU0A 5CVNB 4PP1A 3IHPA 2R9CA 4PI3A 3HWNA 1BP4A 3MTNA 4BS5A 2OULA 4RY2A 4OEMA 4P6GA 2DCDA 2IBIA 2AUXA 1Q6KA 1CJLA 4FJCA 3OF8A 3BWKA 5JA7A 2PBHA 2AS8A 2PNSA 1EWMA 1QDQA 5J94A 4YYRA 3E1ZB 3USVA 2R9OA 3QJ3A 1Y08A 4DMYA 3P5XA 3M99A 1NLJA 3V6EA 2R9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXM A;  2NQA A;  4BPV A;  3WXF A;  3C9E A;  3OF9 A;  2FYE A;  3F75 A;  1MS6 A;  3H8C A;  4PP2 E;  1YVB A;  2CIO A;  4YVA A;  1PPO A;  3ERV A;  1NPZ A;  1JQP A;  3H8B A;  4YV8 A;  2XU3 A;  4W5B A;  1AIM A;  1F29 A;  4I05 A;  2G8E A;  3MOR A;  2P86 A;  5CHV A;  3O0U A;  2HXZ A;  1AU2 A;  3F5V A;  1CTE A;  1ATK A;  2YJ8 A;  5FPW A;  3KWZ A;  1F2A A;  1HUC B;  1U9Q X;  1CVZ A;  4BS6 A;  2G8J A;  1KXR A;  2R9F A;  3KW9 A;  5CVO B;  3B79 A;  1PCI A;  4N8W A;  3OIS A;  1TLO A;  3IMA A;  2ACT A;  1PE6 A;  4QH6 A;  2E03 A;  4MSX A;  1U9V A;  1MEM A;  1YT7 A;  1PXV A;  4P6E A;  1AU3 A;  3PW3 A;  4HWY A;  3CH3 X;  1DF0 A;  3RVW A;  1AYV A;  4I07 A;  1KHP A;  3N4C A;  1CSB B;  3HHA A;  2F7D A;  2DC7 A;  2DJG B;  4BSQ A;  2DC9 A;  1O0E A;  2E00 A;  3CBJ A;  1S4V A;  2YJC A;  3QT4 A;  1AYW A;  4FK5 A;  5PAD A;  3AI8 A;  4YYS A;  3IEJ A;  4CDC B;  3P5U A;  4G54 A;  1KFU L;  1CPJ A;  1THE A;  1NQC A;  1K3B B;  8PCH A;  2DC6 A;  2DCB A;  2OZ2 A;  3PBH A;  3HD3 A;  1U5I A;  2O6X A;  1FH0 A;  3N3G A;  4MZS A;  2FQ9 A;  4XR7 A;  1QMY A;  1ITO A;  2OP3 A;  4FIP A;  4Q8H A;  2H7J A;  3IOQ A;  2E01 A;  1U9W A;  5CHT A;  4WA6 A;  3CH2 X;  3QSD A;  2Y5B A;  1NB5 A;  4X6I A;  1PAD A;  3H89 A;  2HHN A;  4YYV A;  4CDE B;  5JH3 A;  1MDW A;  3H7D A;  3I3T A;  1EF7 A;  1PPP A;  2WBF X;  1AYU A;  1NL6 A;  1CS8 A;  1GEC E;  3ZUA A;  1CB5 A;  1AEC A;  3TNX A;  4W5C A;  5F02 A;  3I06 A;  2P0R A;  3DF0 A;  1AU4 A;  3K8U A;  1VJV A;  2BDL A;  2AUZ A;  3LXS A;  3BC3 A;  3K24 A;  2PRE A;  1SNK A;  2DC8 A;  1QXP A;  3BCN A;  4ZUX U;  2NQD B;  2YJ2 A;  2DZY A;  2P7U A;  2ARY A;  1YK8 A;  2R9M A;  7PCK A;  2HD5 A;  1Y4H A;  1VSN A;  2YJB A;  2BDZ A;  3RVX A;  2XU5 A;  2NQI A;  1PBH A;  4QRG A;  1STF E;  2FO5 A;  4CDF B;  2G6D A;  1KFX L;  3PDF A;  1BGO A;  2AIM A;  1ME4 A;  3CBK A;  1M6D A;  2JQF R;  3U8E A;  1IWD A;  3KWB X;  4X6J A;  1GCB A;  5K16 A;  2E02 A;  4YYQ A;  3BPM A;  1U9X A;  4CZW A;  1MIR A;  3IUT A;  1A6R A;  2AU1 A;  1MEG A;  2VHF A;  5EGW A;  1ZIV A;  2DCA A;  1PPN A;  1F2C A;  4QRV A;  4Q8G A;  2XU1 A;  3BOW A;  2AYN A;  2ATO A;  2XU4 A;  1CV8 A;  3H6S A;  3D6S A;  2GFO A;  4DMX A;  4YYU A;  4N79 A;  3KX1 A;  2DCC A;  1DEU A;  4QBB A;  1ME3 A;  3P5W A;  2C0Y A;  2R6N A;  3GCB A;  1NB3 A;  2DZZ A;  2G7Y A;  2HH5 A;  4KLB A;  1YK7 A;  3P5V A;  2PAD A;  1F2B A;  1TL9 A;  3KSE A;  3K9M A;  2FTD A;  3IV2 A;  3LFY A;  4PAD A;  4OEL A;  4X6H A;  1TU6 A;  3OVZ A;  1BY8 A;  1ICF A;  4YYW A;  2DJF B;  4I04 A;  2FRQ A;  4QRX A;  3RVV A;  3PNR A;  3V6C A;  3MHS A;  4W4U A;  2FRA A;  1EWO A;  1KHQ A;  2GHU A;  1MHW A;  4MZO A;  5CVM A;  3WXG A;  2B1M A;  3MHH A;  1BQI A;  4CDD B;  3O1G A;  2F1G A;  3KFQ A;  6PAD A;  2AYO A;  2B1N A;  3OVX A;  2VHS A;  2YJ9 A;  4K7C A;  1EWL A;  3WXE A;  2AVW A;  2FT2 A;  2FUD A;  1CQD A;  3BPF A;  4N4Z A;  3HHI A;  3S3R A;  2JQG R;  3KKU A;  1SP4 B;  3S3Q A;  1XKG A;  5A24 A;  3NHE A;  1GMY A;  1EWP A;  1PIP A;  1YAL A;  4AXL A;  1X9Y A;  1QOL A;  9PAP A;  2CB5 A;  1PPD A;  2IPP B;  1GLO A;  2NQG A;  4BQV A;  2Y6E A;  3N3K A;  4XUI A;  5EF4 A;  1ZCM A;  1POP A;  1AU0 A;  5CVN B;  4PP1 A;  3IHP A;  2R9C A;  4PI3 A;  3HWN A;  1BP4 A;  3MTN A;  4BS5 A;  2OUL A;  4RY2 A;  4OEM A;  4P6G A;  2DCD A;  2IBI A;  2AUX A;  1Q6K A;  1CJL A;  4FJC A;  3OF8 A;  3BWK A;  5JA7 A;  2PBH A;  2AS8 A;  2PNS A;  1EWM A;  1QDQ A;  5J94 A;  4YYR A;  3E1Z B;  3USV A;  2R9O A;  3QJ3 A;  1Y08 A;  4DMY A;  3P5X A;  3M99 A;  1NLJ A;  3V6E A;  2R9N A; 
#chains in the Genus database with same CATH topology
 3PHW A;  4AXM A;  2NQA A;  4BPV A;  3WXF A;  3C9E A;  3OF9 A;  2FYE A;  3F75 A;  1MS6 A;  3H8C A;  4IUM A;  4PP2 E;  1YVB A;  2CIO A;  4YVA A;  4RF0 A;  1PPO A;  3ERV A;  1NPZ A;  4RNA A;  1JQP A;  3W31 A;  3PHX A;  3H8B A;  4YV8 A;  2XU3 A;  4W5B A;  1AIM A;  1F29 A;  4I05 A;  2G8E A;  4GUA A;  3MOR A;  2P86 A;  5CHV A;  3O0U A;  2HXZ A;  1AU2 A;  3F5V A;  1CTE A;  1ATK A;  2YJ8 A;  5FPW A;  4D8E A;  3KWZ A;  1F2A A;  1HUC B;  1U9Q X;  1CVZ A;  4BS6 A;  2G8J A;  1KXR A;  2R9F A;  4RF1 A;  3KW9 A;  5CVO B;  3B79 A;  1PCI A;  4N8W A;  3OIS A;  1TLO A;  3IMA A;  2ACT A;  1PE6 A;  4BOQ A;  4HXD B;  4QH6 A;  2Z84 A;  1PVJ A;  2E03 A;  1U9V A;  4MSX A;  1MEM A;  1YT7 A;  1PXV A;  4P6E A;  1AU3 A;  4P16 A;  3PW3 A;  4HWY A;  2DOS A;  2J7Q C;  3CH3 X;  1DF0 A;  3BB7 A;  3RVW A;  3IFU A;  3O65 A;  1AYV A;  4I07 A;  1KHP A;  3N4C A;  1CSB B;  3HHA A;  2F7D A;  2DC7 A;  2DJG B;  4BSQ A;  2DC9 A;  1O0E A;  2E00 A;  3CBJ A;  1S4V A;  4PT5 A;  2YJC A;  3QT4 A;  1AYW A;  4FK5 A;  5PAD A;  3AI8 A;  4YYS A;  3IEJ A;  4CDC B;  3P5U A;  4G54 A;  4IP3 A;  1KFU L;  1CPJ A;  3C0R A;  4D8B A;  1THE A;  1NQC A;  1K3B B;  8PCH A;  2DC6 A;  2DCB A;  2OZ2 A;  3PBH A;  3HD3 A;  1U5I A;  2O6X A;  1FH0 A;  3N3G A;  4MZS A;  5EZS A;  2FQ9 A;  4XR7 A;  4BOU A;  1QMY A;  1ITO A;  2OP3 A;  4FIP A;  4Q8H A;  4R3D A;  2H7J A;  3IOQ A;  2E01 A;  1U9W A;  5CHT A;  4WA6 A;  4RKX A;  3CH2 X;  3QSD A;  2Y5B A;  1NB5 A;  4X6I A;  1PAD A;  3H89 A;  2HHN A;  4YYV A;  4CDE B;  5JH3 A;  1MDW A;  3H7D A;  3I3T A;  1EF7 A;  1PPP A;  2WBF X;  1AYU A;  1NL6 A;  1CS8 A;  1GEC E;  3ZUA A;  1CB5 A;  1AEC A;  3TNX A;  4W5C A;  5F02 A;  4MM3 B;  3I06 A;  2P0R A;  3DF0 A;  1AU4 A;  2BTW B;  3K8U A;  1VJV A;  4M0W A;  2BDL A;  2AUZ A;  3LXS A;  3BC3 A;  3K24 A;  2PRE A;  1SNK A;  2DC8 A;  1QXP A;  3BCN A;  4ZUX U;  2NQD B;  4MI7 A;  2YJ2 A;  1YZB A;  4OVZ B;  2DZY A;  2P7U A;  2ARY A;  1YK8 A;  3MJ5 A;  2R9M A;  7PCK A;  2HD5 A;  1Y4H A;  1VSN A;  2YJB A;  3BBA A;  2BDZ A;  3RVX A;  2XU5 A;  2NQI A;  1PBH A;  4QRG A;  1STF E;  2FO5 A;  4CDF B;  2G6D A;  1KFX L;  3PDF A;  1BGO A;  2AIM A;  1ME4 A;  3CBK A;  1M6D A;  2JQF R;  3U8E A;  1IWD A;  3KWB X;  4X6J A;  1GCB A;  5K16 A;  3PSE A;  2E02 A;  4YYQ A;  3BPM A;  1U9X A;  4CZW A;  1MIR A;  3IUT A;  1A6R A;  2AU1 A;  3PT2 A;  1MEG A;  2VHF A;  5EGW A;  1ZIV A;  2DCA A;  1PPN A;  1F2C A;  2UZJ A;  4QRV A;  4Q8G A;  1DKI A;  2XU1 A;  3BOW A;  2AYN A;  2ATO A;  2XU4 A;  1CV8 A;  3H6S A;  3D6S A;  2GFO A;  4DMX A;  4YYU A;  4N79 A;  4BOS A;  3KX1 A;  2DCC A;  1DEU A;  4QBB A;  3RNV A;  1ME3 A;  3P5W A;  2C0Y A;  2R6N A;  3GCB A;  1NB3 A;  2DZZ A;  3BY4 A;  2G7Y A;  2HH5 A;  2BU3 A;  4KLB A;  1YK7 A;  3OQC A;  3TMP A;  3P5V A;  2PAD A;  1F2B A;  1TL9 A;  3KSE A;  3E9S A;  3K9M A;  3MP2 A;  2FTD A;  3IV2 A;  3LFY A;  5KO3 A;  4PAD A;  4OEL A;  4X6H A;  1TU6 A;  3TRK A;  3OVZ A;  1BY8 A;  1ICF A;  4YYW A;  2DJF B;  4I04 A;  2FRQ A;  4QRX A;  4WUR A;  3RVV A;  3PNR A;  5E6J A;  4D8I A;  3V6C A;  3MHS A;  4W4U A;  2FRA A;  1EWO A;  1KHQ A;  2GHU A;  1MHW A;  4MZO A;  5CVM A;  3W30 A;  3WXG A;  2B1M A;  3MHH A;  1BQI A;  4REZ A;  4CDD B;  3O1G A;  2F1G A;  3KFQ A;  4BOZ A;  6PAD A;  3PRM A;  2AYO A;  2B1N A;  3B21 A;  3OVX A;  2VHS A;  2YJ9 A;  4K7C A;  1EWL A;  3WXE A;  4BOP A;  2AVW A;  2FT2 A;  3ZNH A;  2FUD A;  2JTC A;  1CQD A;  3MTV A;  3BPF A;  4N4Z A;  3HHI A;  3S3R A;  2JQG R;  3KKU A;  2BTW A;  1SP4 B;  3S3Q A;  1XKG A;  2FE8 A;  5A24 A;  3NHE A;  1GMY A;  1EWP A;  5JZE A;  1PIP A;  1YAL A;  4OVZ A;  4AXL A;  1X9Y A;  1QOL A;  9PAP A;  2CB5 A;  1UKF A;  1PPD A;  2IPP B;  1GLO A;  2NQG A;  4BQV A;  2Y6E A;  3N3K A;  4XUI A;  5EF4 A;  4ZTB A;  1ZCM A;  1POP A;  1AU0 A;  2J7Q A;  5CVN B;  2JRI A;  4PP1 A;  3IHP A;  2R9C A;  2AGA A;  4PI3 A;  3HWN A;  1BP4 A;  3MTN A;  4BS5 A;  2OUL A;  4RY2 A;  4OEM A;  4P6G A;  2DCD A;  2IBI A;  2AUX A;  1Q6K A;  1CJL A;  4FJC A;  3OF8 A;  3BWK A;  5JA7 A;  2PBH A;  2AS8 A;  2PNS A;  1EWM A;  1QDQ A;  5J94 A;  4YYR A;  3E1Z B;  3USV A;  2HWK A;  2R9O A;  4XZX A;  3QJ3 A;  3PRP A;  1Y08 A;  5EZQ A;  4DMY A;  3P5X A;  3M99 A;  4A5U A;  1NLJ A;  3V6E A;  2R9N A;  4OW0 A;  3PHU A; 
#chains in the Genus database with same CATH homology
 4AXM A;  2NQA A;  4BPV A;  3WXF A;  3C9E A;  3OF9 A;  2FYE A;  3F75 A;  1MS6 A;  3H8C A;  4PP2 E;  1YVB A;  2CIO A;  4YVA A;  1PPO A;  3ERV A;  1NPZ A;  1JQP A;  3H8B A;  4YV8 A;  2XU3 A;  4W5B A;  1AIM A;  1F29 A;  4I05 A;  4BGF A;  2G8E A;  3MOR A;  2P86 A;  5CHV A;  3O0U A;  2HXZ A;  1AU2 A;  3F5V A;  1CTE A;  4B55 A;  1ATK A;  2YJ8 A;  5FPW A;  3KWZ A;  4GUZ A;  1F2A A;  1HUC B;  1U9Q X;  1CVZ A;  4BS6 A;  2G8J A;  1KXR A;  2R9F A;  3KW9 A;  5CVO B;  3B79 A;  1PCI A;  4N8W A;  3OIS A;  1TLO A;  3IMA A;  2ACT A;  1PE6 A;  4QH6 A;  2E03 A;  4MSX A;  1U9V A;  1MEM A;  1YT7 A;  1PXV A;  4P6E A;  1AU3 A;  3PW3 A;  4HWY A;  3CH3 X;  1DF0 A;  3RVW A;  1AYV A;  4I07 A;  1KHP A;  3N4C A;  1CSB B;  3HHA A;  2F7D A;  2DC7 A;  2DJG B;  4BSQ A;  2DC9 A;  1O0E A;  2E00 A;  3CBJ A;  1S4V A;  2YJC A;  3QT4 A;  1AYW A;  4FK5 A;  5PAD A;  3AI8 A;  4YYS A;  3IEJ A;  2VFB A;  4CDC B;  3P5U A;  4G54 A;  1KFU L;  1CPJ A;  1THE A;  1NQC A;  1K3B B;  8PCH A;  4C5P A;  2DC6 A;  2DCB A;  2OZ2 A;  3PBH A;  3HD3 A;  1U5I A;  2O6X A;  1FH0 A;  3N3G A;  4MZS A;  2FQ9 A;  4XR7 A;  3LTW A;  1QMY A;  1ITO A;  2OP3 A;  4FIP A;  4Q8H A;  2H7J A;  3IOQ A;  2E01 A;  1U9W A;  5CHT A;  4WA6 A;  2BSZ A;  3CH2 X;  3QSD A;  2Y5B A;  1NB5 A;  4X6I A;  1PAD A;  3H89 A;  2HHN A;  4YYV A;  4CDE B;  5JH3 A;  1MDW A;  3H7D A;  3I3T A;  1EF7 A;  1PPP A;  2WBF X;  1AYU A;  1NL6 A;  1CS8 A;  1GEC E;  3ZUA A;  1CB5 A;  1AEC A;  3TNX A;  4W5C A;  5F02 A;  3I06 A;  2P0R A;  3DF0 A;  1AU4 A;  3K8U A;  1VJV A;  2BDL A;  2AUZ A;  3LXS A;  3BC3 A;  3K24 A;  2PRE A;  1SNK A;  2DC8 A;  1QXP A;  3BCN A;  4ZUX U;  2NQD B;  2YJ2 A;  2DZY A;  2P7U A;  1W5R A;  2ARY A;  1YK8 A;  2R9M A;  7PCK A;  2HD5 A;  1Y4H A;  1VSN A;  2YJB A;  2BDZ A;  3RVX A;  2XU5 A;  2NQI A;  1PBH A;  4QRG A;  1STF E;  2FO5 A;  4CDF B;  2G6D A;  1KFX L;  3PDF A;  1W4T A;  1BGO A;  2AIM A;  1ME4 A;  3CBK A;  1M6D A;  2JQF R;  3U8E A;  1IWD A;  3KWB X;  4X6J A;  1GCB A;  3D9W A;  5K16 A;  1W6F A;  2E02 A;  1GX3 A;  4YYQ A;  3BPM A;  1U9X A;  4CZW A;  1MIR A;  3IUT A;  1A6R A;  2AU1 A;  1MEG A;  2VHF A;  5EGW A;  1ZIV A;  2DCA A;  1E2T A;  1PPN A;  1F2C A;  4QRV A;  4Q8G A;  4NV8 A;  2XU1 A;  3BOW A;  2AYN A;  2ATO A;  2XU4 A;  1CV8 A;  3H6S A;  3D6S A;  2GFO A;  4DMX A;  4YYU A;  4N79 A;  3KX1 A;  2DCC A;  1DEU A;  4QBB A;  1ME3 A;  3P5W A;  2C0Y A;  2R6N A;  3GCB A;  2VFC A;  1NB3 A;  2DZZ A;  2G7Y A;  2HH5 A;  4KLB A;  1YK7 A;  3P5V A;  2PAD A;  1F2B A;  1TL9 A;  3KSE A;  3K9M A;  2FTD A;  3IV2 A;  3LFY A;  4PAD A;  4OEL A;  4X6H A;  1TU6 A;  3OVZ A;  1BY8 A;  1ICF A;  4YYW A;  2DJF B;  4I04 A;  2FRQ A;  4QRX A;  3RVV A;  3PNR A;  3V6C A;  3MHS A;  4W4U A;  2FRA A;  1EWO A;  1KHQ A;  2GHU A;  1MHW A;  4MZO A;  5CVM A;  3WXG A;  2B1M A;  3MHH A;  4NV7 A;  1BQI A;  4CDD B;  3O1G A;  2F1G A;  3KFQ A;  6PAD A;  2AYO A;  2B1N A;  3OVX A;  2VHS A;  2YJ9 A;  4K7C A;  1EWL A;  3WXE A;  2AVW A;  2FT2 A;  2FUD A;  1CQD A;  3BPF A;  4N4Z A;  3HHI A;  3S3R A;  2JQG R;  3KKU A;  1SP4 B;  3S3Q A;  1XKG A;  5A24 A;  3NHE A;  1GMY A;  1EWP A;  1PIP A;  1YAL A;  4AXL A;  1X9Y A;  1QOL A;  9PAP A;  2CB5 A;  1PPD A;  2IPP B;  1GLO A;  2NQG A;  4BQV A;  2Y6E A;  3N3K A;  4XUI A;  5EF4 A;  1ZCM A;  1POP A;  1AU0 A;  5CVN B;  4PP1 A;  3IHP A;  2R9C A;  4PI3 A;  3HWN A;  1BP4 A;  3MTN A;  4BS5 A;  2OUL A;  4RY2 A;  4OEM A;  4P6G A;  2DCD A;  2IBI A;  2AUX A;  1Q6K A;  1CJL A;  4FJC A;  3OF8 A;  3BWK A;  5JA7 A;  2PBH A;  2AS8 A;  2PNS A;  1EWM A;  1QDQ A;  5J94 A;  4YYR A;  3E1Z B;  3USV A;  2R9O A;  3QJ3 A;  1Y08 A;  4DMY A;  3P5X A;  3M99 A;  1NLJ A;  3V6E A;  2R9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...