2B1MA

Crystal structure of a papain-fold protein without the catalytic cysteine from seeds of pachyrhizus erosus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
225
structure length
225
Chain Sequence
APESWDWSKKGVITKVKFQGQCGSGWAFSATGAIEAAHAIATGNLVSLSEQELIDCVDESEGCYNGWHYQSFEWVVKHGGIASEADYPYKARDGKCKANEIQDKVTIDNYGVQILSNESTESEAESSLQSFVLEQPISVSIDAKDFHFYSGGIYDGGNCSSPYGINHFVLIVGYGSEDGVDYWIAKNSWGEDWGIDGYIRIQRNTGNLLGVCGMNYFASYPIIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a papain-fold protein without the catalytic residue: a novel member in the cysteine proteinase family
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords SPE31
total genus 64
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2b1mA00
4FIPA 3IMAA 1BP4A 2IBIA 3OVXA 3P5VA 1U9WA 4CDEB 1U9XA 1VJVA 2NQDB 1PE6A 4X6HA 3H89A 3CBJA 3WXFA 3MTNA 3F5VA 1EWPA 3MHSA 4YYRA 1MS6A 2XU4A 3PW3A 4PI3A 2NQIA 3H6SA 1SNKA 1O0EA 1A6RA 2DC8A 2ARYA 4BQVA 1AYVA 2C0YA 3IV2A 1EF7A 2XU3A 4OELA 3N3GA 4QRGA 3GCBA 4ZUXU 3KFQA 1CB5A 3BC3A 2DCBA 2R9MA 2PBHA 2AUZA 2GFOA 4MZSA 4YV8A 5J94A 2FYEA 3USVA 2PNSA 3IOQA 4Q8GA 1U9VA 4I07A 1MDWA 1IWDA 1CQDA 2BDLA 1ZCMA 1NLJA 1ATKA 1PXVA 4QRXA 1QDQA 3D6SA 3QT4A 1STFE 1CV8A 1KXRA 4DMXA 2G6DA 1AU0A 3LXSA 2AUXA 2Y6EA 2ACTA 2YJ2A 4W5CA 1MEMA 2R9OA 1BQIA 3O1GA 3N3KA 2FRQA 2DCCA 2R9NA 2DZYA 3V6EA 3K8UA 1AYWA 3H8CA 1Y08A 1PPDA 3QSDA 1KFXL 1F2CA 4N79A 2G8JA 1YVBA 2HD5A 3I06A 4P6GA 1TLOA 2WBFX 4W5BA 2CIOA 2AS8A 3NHEA 3S3RA 2B1MA 4X6JA 1GLOA 2FT2A 4FJCA 9PAPA 1Y4HA 2HXZA 3TNXA 2B1NA 3K9MA 4AXLA 2YJCA 1CS8A 2AU1A 4QRVA 1VSNA 1PADA 3RVXA 2NQAA 4KLBA 4CDCB 2PREA 3BPMA 5EF4A 2FQ9A 2P7UA 3KWBX 2F7DA 3N4CA 1NQCA 3S3QA 1KHPA 3HHIA 1KFUL 1XKGA 3B79A 3MHHA 1AU2A 1YT7A 2FUDA 3CH3X 3OISA 2E02A 1TL9A 2E01A 1ITOA 4MZOA 4YYQA 2YJBA 3LFYA 1DEUA 2R9FA 6PADA 5CVMA 2OULA 5CVNB 3BWKA 2ATOA 2HH5A 3F75A 1ME3A 4W4UA 1U5IA 2AIMA 1CTEA 1AU3A 1HUCB 1YK7A 5K16A 4CZWA 2OP3A 3HWNA 1X9YA 2E03A 1JQPA 2VHFA 2VHSA 5EGWA 4PADA 4BS6A 2FRAA 4N8WA 5A24A 4P6EA 1PIPA 1PCIA 3WXEA 1MEGA 2DJFB 3IUTA 1EWMA 2NQGA 3PNRA 3KKUA 2GHUA 2G7YA 3OF8A 2DC7A 4PP1A 3PBHA 2R6NA 2F1GA 1AYUA 2YJ8A 2R9CA 4QH6A 3KSEA 1NB5A 1MIRA 4XUIA 4YYUA 2G8EA 4I05A 1QMYA 4I04A 1GECE 1S4VA 4K7CA 5JH3A 5JA7A 1CVZA 2DC9A 3ERVA 3E1ZB 2DZZA 3OVZA 3H8BA 3MORA 2XU1A 1GMYA 5CHVA 4FK5A 3H7DA 1GCBA 1BGOA 1PPPA 4YYWA 1CJLA 1ICFA 1SP4B 4YVAA 4G54A 3KWZA 4QBBA 2PADA 2P86A 5CVOB 3RVVA 1CPJA 3ZUAA 1THEA 2P0RA 2DJGB 1K3BB 2XU5A 3BOWA 2H7JA 4OEMA 2Y5BA 2IPPB 1MHWA 4BS5A 1POPA 7PCKA 4CDFB 1U9QX 4WA6A 3V6CA 3HD3A 3KX1A 3P5WA 4X6IA 2OZ2A 2FTDA 3IHPA 1QXPA 2AYOA 3IEJA 2DCAA 2YJ9A 1ZIVA 5CHTA 1NB3A 1AU4A 3PDFA 3O0UA 5FPWA 2DCDA 4PP2E 4BSQA 1EWOA 1CSBB 1QOLA 2O6XA 1PPNA 3BCNA 3BPFA 1KHQA 2E00A 1F2AA 4N4ZA 1M6DA 1ME4A 3P5UA 1YALA 4RY2A 4XR7A 1BY8A 1F29A 3WXGA 5PADA 4YYSA 1Q6KA 1PPOA 2BDZA 5F02A 3HHAA 1DF0A 3DF0A 2CB5A 1AIMA 2HHNA 2AYNA 2DC6A 3AI8A 4YYVA 3P5XA 2JQGR 3U8EA 4HWYA 8PCHA 1FH0A 4AXMA 4MSXA 1F2BA 3QJ3A 1NL6A 3KW9A 2JQFR 1NPZA 1AECA 1TU6A 3C9EA 3RVWA 3OF9A 1YK8A 3I3TA 2AVWA 3K24A 3M99A 1EWLA 4Q8HA 4DMYA 4CDDB 3CBKA 1PBHA 4BPVA 3CH2X 2FO5A
chains in the Genus database with same CATH superfamily
4FIPA 4BOUA 4REZA 3IMAA 1BP4A 2IBIA 3OVXA 4A5UA 3P5VA 1U9WA 4CDEB 1U9XA 1VJVA 2NQDB 1PE6A 4X6HA 3H89A 3CBJA 3WXFA 3MTNA 3F5VA 1EWPA 3MHSA 5JZEA 4BOQA 4YYRA 3C0RA 1MS6A 2XU4A 3PW3A 2DOSA 4PI3A 2NQIA 3W31A 3H6SA 1SNKA 1O0EA 1A6RA 4OW0A 2DC8A 2ARYA 4BQVA 1AYVA 2C0YA 2JTCA 2JRIA 3IV2A 1EF7A 2XU3A 5EZQA 4OELA 3N3GA 4QRGA 2Z84A 3GCBA 3RNVA 4ZUXU 3KFQA 4IUMA 1CB5A 3W30A 3BC3A 2DCBA 2R9MA 2PBHA 2AUZA 2GFOA 4MZSA 4YV8A 5J94A 2FYEA 4M0WA 3USVA 2PNSA 3IOQA 4Q8GA 1U9VA 4D8BA 4I07A 2UZJA 1MDWA 1IWDA 1CQDA 2BDLA 1ZCMA 1NLJA 1ATKA 1PXVA 3O65A 4QRXA 1QDQA 3D6SA 3QT4A 1STFE 1CV8A 1KXRA 4DMXA 2G6DA 1AU0A 3LXSA 4MM3B 2AUXA 3PRMA 2Y6EA 2ACTA 2YJ2A 4W5CA 1MEMA 2R9OA 1BQIA 3B21A 3O1GA 5KO3A 3N3KA 2FRQA 2DCCA 2R9NA 2DZYA 3V6EA 3K8UA 1AYWA 3H8CA 1Y08A 1PPDA 3QSDA 1KFXL 1F2CA 4N79A 2G8JA 1YVBA 2HD5A 3I06A 4P6GA 1TLOA 2WBFX 4W5BA 2HWKA 2CIOA 2AS8A 3NHEA 3S3RA 2B1MA 2FE8A 4X6JA 2BTWB 1GLOA 2FT2A 3PSEA 4FJCA 9PAPA 1Y4HA 2HXZA 3TNXA 4D8EA 2B1NA 3K9MA 4AXLA 2YJCA 1CS8A 2AU1A 4ZTBA 4QRVA 1VSNA 4P16A 1PADA 3RVXA 2NQAA 4KLBA 4CDCB 2PREA 3BPMA 5EF4A 2FQ9A 2P7UA 3PHUA 3KWBX 2F7DA 3BBAA 3BY4A 3PHWA 3TRKA 3N4CA 1NQCA 3S3QA 2BTWA 1KHPA 3OQCA 3HHIA 1KFUL 1XKGA 3B79A 3MHHA 1AU2A 1YT7A 4WURA 5EZSA 2FUDA 3CH3X 3OISA 2E02A 1TL9A 2E01A 1ITOA 4MZOA 4YYQA 2YJBA 1YZBA 2J7QA 3E9SA 3LFYA 1DEUA 2R9FA 6PADA 5CVMA 2OULA 5CVNB 3BWKA 2ATOA 2HH5A 3F75A 1ME3A 4W4UA 1U5IA 2AIMA 3MTVA 1CTEA 1AU3A 1HUCB 1YK7A 5K16A 4CZWA 5E6JA 2OP3A 3HWNA 1X9YA 3IFUA 2E03A 1JQPA 2VHFA 2VHSA 5EGWA 4PADA 4BS6A 2FRAA 4N8WA 5A24A 4P6EA 1PIPA 1PCIA 3WXEA 1MEGA 2DJFB 3IUTA 4BOPA 1EWMA 2NQGA 3PNRA 3KKUA 2GHUA 2G7YA 3MJ5A 3OF8A 1UKFA 2DC7A 4PP1A 3PBHA 2R6NA 2F1GA 1AYUA 2YJ8A 2R9CA 4QH6A 3KSEA 1NB5A 1MIRA 4XUIA 4YYUA 4D8IA 2G8EA 4I05A 2J7QC 1QMYA 3BB7A 4I04A 4BOSA 1GECE 1S4VA 4K7CA 5JH3A 5JA7A 1CVZA 2DC9A 3ERVA 4XZXA 3E1ZB 2DZZA 3OVZA 3H8BA 3MORA 4HXDB 2XU1A 1GMYA 5CHVA 4FK5A 3H7DA 1GCBA 1BGOA 1PPPA 4YYWA 1CJLA 1ICFA 1SP4B 4YVAA 4G54A 3KWZA 4QBBA 2PADA 2P86A 3ZNHA 5CVOB 3RVVA 4R3DA 2AGAA 1CPJA 3ZUAA 1THEA 2P0RA 2DJGB 1K3BB 2XU5A 3BOWA 2H7JA 4RF1A 4OEMA 2Y5BA 2IPPB 1MHWA 4BS5A 1POPA 7PCKA 4CDFB 1U9QX 4WA6A 3V6CA 3HD3A 3KX1A 3P5WA 4RKXA 4MI7A 4X6IA 2OZ2A 3PRPA 3TMPA 2FTDA 3IHPA 4OVZA 1QXPA 2AYOA 3IEJA 2DCAA 2YJ9A 1ZIVA 5CHTA 1NB3A 1AU4A 3PDFA 3O0UA 5FPWA 2DCDA 4PP2E 4BSQA 1EWOA 1CSBB 1QOLA 2O6XA 1PPNA 3BCNA 1DKIA 3BPFA 1KHQA 2E00A 1F2AA 4N4ZA 1M6DA 1ME4A 3P5UA 1YALA 4RY2A 4XR7A 1BY8A 4OVZB 1F29A 3WXGA 5PADA 4YYSA 1Q6KA 1PPOA 2BDZA 5F02A 3HHAA 4BOZA 2BU3A 3PHXA 1DF0A 3DF0A 2CB5A 1AIMA 2HHNA 2AYNA 2DC6A 4GUAA 4PT5A 3AI8A 4YYVA 3P5XA 2JQGR 3U8EA 4HWYA 8PCHA 1FH0A 4AXMA 4MSXA 1F2BA 3QJ3A 1NL6A 3KW9A 4RF0A 3MP2A 3PT2A 4RNAA 2JQFR 1NPZA 1AECA 1TU6A 3C9EA 3RVWA 4IP3A 3OF9A 1YK8A 3I3TA 1PVJA 2AVWA 3K24A 3M99A 1EWLA 4Q8HA 4DMYA 4CDDB 3CBKA 1PBHA 4BPVA 3CH2X 2FO5A
chains in the Genus database with same CATH topology
4FIPA 3IMAA 1BP4A 2IBIA 3OVXA 3P5VA 1U9WA 4CDEB 1U9XA 1VJVA 2NQDB 1PE6A 4X6HA 3H89A 3CBJA 3WXFA 3MTNA 3F5VA 1EWPA 3MHSA 4YYRA 1MS6A 2XU4A 3PW3A 4PI3A 2NQIA 3H6SA 1SNKA 1O0EA 1A6RA 2DC8A 2ARYA 4BQVA 1AYVA 2C0YA 3IV2A 1EF7A 2XU3A 4OELA 3N3GA 4QRGA 3GCBA 4ZUXU 3KFQA 1CB5A 3BC3A 2DCBA 1W5RA 2R9MA 2PBHA 2AUZA 2GFOA 4MZSA 3D9WA 4YV8A 5J94A 2FYEA 3USVA 2PNSA 3IOQA 4Q8GA 1U9VA 4I07A 1MDWA 1IWDA 1CQDA 2BDLA 4BGFA 1ZCMA 1NLJA 1ATKA 1PXVA 4QRXA 1QDQA 3D6SA 3QT4A 1STFE 1CV8A 1KXRA 4DMXA 2G6DA 1AU0A 3LXSA 2AUXA 2Y6EA 2ACTA 2YJ2A 4W5CA 1MEMA 2R9OA 1BQIA 3O1GA 3N3KA 2FRQA 2DCCA 2R9NA 2DZYA 3V6EA 3K8UA 1AYWA 3H8CA 1Y08A 1PPDA 3QSDA 1KFXL 1F2CA 4N79A 2G8JA 1YVBA 2HD5A 3I06A 4P6GA 1TLOA 1GX3A 2WBFX 4W5BA 2CIOA 2AS8A 3NHEA 3S3RA 2B1MA 4X6JA 3LTWA 1GLOA 2FT2A 4FJCA 9PAPA 1Y4HA 2HXZA 3TNXA 2B1NA 3K9MA 4AXLA 2YJCA 1CS8A 2AU1A 4QRVA 1VSNA 1PADA 3RVXA 2NQAA 4KLBA 4CDCB 2PREA 3BPMA 5EF4A 2FQ9A 2P7UA 3KWBX 2F7DA 3N4CA 1NQCA 3S3QA 1KHPA 3HHIA 1KFUL 1XKGA 3B79A 3MHHA 1AU2A 1YT7A 2FUDA 3CH3X 3OISA 2E02A 1TL9A 2BSZA 2E01A 1ITOA 4MZOA 4YYQA 2YJBA 3LFYA 1DEUA 2R9FA 6PADA 5CVMA 2OULA 5CVNB 3BWKA 2ATOA 2HH5A 3F75A 1ME3A 4W4UA 1U5IA 2AIMA 1CTEA 1AU3A 1HUCB 1YK7A 2VFCA 5K16A 4CZWA 2OP3A 3HWNA 1X9YA 2E03A 1JQPA 2VHFA 2VHSA 5EGWA 4PADA 4BS6A 2FRAA 4N8WA 5A24A 4P6EA 1PIPA 1PCIA 3WXEA 1MEGA 2DJFB 3IUTA 1EWMA 2NQGA 3PNRA 3KKUA 2GHUA 2G7YA 3OF8A 2DC7A 4PP1A 3PBHA 2R6NA 4C5PA 2F1GA 1AYUA 2YJ8A 2R9CA 4QH6A 3KSEA 1NB5A 1MIRA 4XUIA 4YYUA 2G8EA 4I05A 1QMYA 4I04A 4NV7A 2VFBA 1GECE 1S4VA 4K7CA 5JH3A 5JA7A 1CVZA 2DC9A 3ERVA 3E1ZB 2DZZA 3OVZA 3H8BA 3MORA 2XU1A 1GMYA 5CHVA 4FK5A 3H7DA 1GCBA 1BGOA 1PPPA 4YYWA 1CJLA 1ICFA 1SP4B 4YVAA 4G54A 3KWZA 4QBBA 2PADA 2P86A 5CVOB 3RVVA 1CPJA 3ZUAA 1THEA 2P0RA 2DJGB 1K3BB 2XU5A 3BOWA 2H7JA 1W6FA 4OEMA 2Y5BA 2IPPB 1MHWA 4BS5A 1POPA 7PCKA 4CDFB 1U9QX 4WA6A 3V6CA 3HD3A 3KX1A 3P5WA 4X6IA 2OZ2A 2FTDA 3IHPA 1QXPA 2AYOA 3IEJA 2DCAA 2YJ9A 1ZIVA 5CHTA 4GUZA 1NB3A 1AU4A 3PDFA 3O0UA 5FPWA 2DCDA 4PP2E 4B55A 4BSQA 1EWOA 1CSBB 1QOLA 2O6XA 1PPNA 3BCNA 1W4TA 3BPFA 1KHQA 2E00A 1F2AA 4N4ZA 1M6DA 1ME4A 3P5UA 1YALA 4RY2A 4XR7A 1BY8A 1F29A 3WXGA 5PADA 4YYSA 1Q6KA 1PPOA 2BDZA 5F02A 3HHAA 1DF0A 3DF0A 2CB5A 1AIMA 2HHNA 2AYNA 2DC6A 3AI8A 4YYVA 3P5XA 2JQGR 3U8EA 4HWYA 8PCHA 1FH0A 4AXMA 4MSXA 1F2BA 3QJ3A 1NL6A 3KW9A 1E2TA 2JQFR 1NPZA 1AECA 1TU6A 3C9EA 3RVWA 3OF9A 1YK8A 3I3TA 2AVWA 4NV8A 3K24A 3M99A 1EWLA 4Q8HA 4DMYA 4CDDB 3CBKA 1PBHA 4BPVA 3CH2X 2FO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIP A;  3IMA A;  1BP4 A;  2IBI A;  3OVX A;  3P5V A;  1U9W A;  4CDE B;  1U9X A;  1VJV A;  2NQD B;  1PE6 A;  4X6H A;  3H89 A;  3CBJ A;  3WXF A;  3MTN A;  3F5V A;  1EWP A;  3MHS A;  4YYR A;  1MS6 A;  2XU4 A;  3PW3 A;  4PI3 A;  2NQI A;  3H6S A;  1SNK A;  1O0E A;  1A6R A;  2DC8 A;  2ARY A;  4BQV A;  1AYV A;  2C0Y A;  3IV2 A;  1EF7 A;  2XU3 A;  4OEL A;  3N3G A;  4QRG A;  3GCB A;  4ZUX U;  3KFQ A;  1CB5 A;  3BC3 A;  2DCB A;  2R9M A;  2PBH A;  2AUZ A;  2GFO A;  4MZS A;  4YV8 A;  5J94 A;  2FYE A;  3USV A;  2PNS A;  3IOQ A;  4Q8G A;  1U9V A;  4I07 A;  1MDW A;  1IWD A;  1CQD A;  2BDL A;  1ZCM A;  1NLJ A;  1ATK A;  1PXV A;  4QRX A;  1QDQ A;  3D6S A;  3QT4 A;  1STF E;  1CV8 A;  1KXR A;  4DMX A;  2G6D A;  1AU0 A;  3LXS A;  2AUX A;  2Y6E A;  2ACT A;  2YJ2 A;  4W5C A;  1MEM A;  2R9O A;  1BQI A;  3O1G A;  3N3K A;  2FRQ A;  2DCC A;  2R9N A;  2DZY A;  3V6E A;  3K8U A;  1AYW A;  3H8C A;  1Y08 A;  1PPD A;  3QSD A;  1KFX L;  1F2C A;  4N79 A;  2G8J A;  1YVB A;  2HD5 A;  3I06 A;  4P6G A;  1TLO A;  2WBF X;  4W5B A;  2CIO A;  2AS8 A;  3NHE A;  3S3R A;  2B1M A;  4X6J A;  1GLO A;  2FT2 A;  4FJC A;  9PAP A;  1Y4H A;  2HXZ A;  3TNX A;  2B1N A;  3K9M A;  4AXL A;  2YJC A;  1CS8 A;  2AU1 A;  4QRV A;  1VSN A;  1PAD A;  3RVX A;  2NQA A;  4KLB A;  4CDC B;  2PRE A;  3BPM A;  5EF4 A;  2FQ9 A;  2P7U A;  3KWB X;  2F7D A;  3N4C A;  1NQC A;  3S3Q A;  1KHP A;  3HHI A;  1KFU L;  1XKG A;  3B79 A;  3MHH A;  1AU2 A;  1YT7 A;  2FUD A;  3CH3 X;  3OIS A;  2E02 A;  1TL9 A;  2E01 A;  1ITO A;  4MZO A;  4YYQ A;  2YJB A;  3LFY A;  1DEU A;  2R9F A;  6PAD A;  5CVM A;  2OUL A;  5CVN B;  3BWK A;  2ATO A;  2HH5 A;  3F75 A;  1ME3 A;  4W4U A;  1U5I A;  2AIM A;  1CTE A;  1AU3 A;  1HUC B;  1YK7 A;  5K16 A;  4CZW A;  2OP3 A;  3HWN A;  1X9Y A;  2E03 A;  1JQP A;  2VHF A;  2VHS A;  5EGW A;  4PAD A;  4BS6 A;  2FRA A;  4N8W A;  5A24 A;  4P6E A;  1PIP A;  1PCI A;  3WXE A;  1MEG A;  2DJF B;  3IUT A;  1EWM A;  2NQG A;  3PNR A;  3KKU A;  2GHU A;  2G7Y A;  3OF8 A;  2DC7 A;  4PP1 A;  3PBH A;  2R6N A;  2F1G A;  1AYU A;  2YJ8 A;  2R9C A;  4QH6 A;  3KSE A;  1NB5 A;  1MIR A;  4XUI A;  4YYU A;  2G8E A;  4I05 A;  1QMY A;  4I04 A;  1GEC E;  1S4V A;  4K7C A;  5JH3 A;  5JA7 A;  1CVZ A;  2DC9 A;  3ERV A;  3E1Z B;  2DZZ A;  3OVZ A;  3H8B A;  3MOR A;  2XU1 A;  1GMY A;  5CHV A;  4FK5 A;  3H7D A;  1GCB A;  1BGO A;  1PPP A;  4YYW A;  1CJL A;  1ICF A;  1SP4 B;  4YVA A;  4G54 A;  3KWZ A;  4QBB A;  2PAD A;  2P86 A;  5CVO B;  3RVV A;  1CPJ A;  3ZUA A;  1THE A;  2P0R A;  2DJG B;  1K3B B;  2XU5 A;  3BOW A;  2H7J A;  4OEM A;  2Y5B A;  2IPP B;  1MHW A;  4BS5 A;  1POP A;  7PCK A;  4CDF B;  1U9Q X;  4WA6 A;  3V6C A;  3HD3 A;  3KX1 A;  3P5W A;  4X6I A;  2OZ2 A;  2FTD A;  3IHP A;  1QXP A;  2AYO A;  3IEJ A;  2DCA A;  2YJ9 A;  1ZIV A;  5CHT A;  1NB3 A;  1AU4 A;  3PDF A;  3O0U A;  5FPW A;  2DCD A;  4PP2 E;  4BSQ A;  1EWO A;  1CSB B;  1QOL A;  2O6X A;  1PPN A;  3BCN A;  3BPF A;  1KHQ A;  2E00 A;  1F2A A;  4N4Z A;  1M6D A;  1ME4 A;  3P5U A;  1YAL A;  4RY2 A;  4XR7 A;  1BY8 A;  1F29 A;  3WXG A;  5PAD A;  4YYS A;  1Q6K A;  1PPO A;  2BDZ A;  5F02 A;  3HHA A;  1DF0 A;  3DF0 A;  2CB5 A;  1AIM A;  2HHN A;  2AYN A;  2DC6 A;  3AI8 A;  4YYV A;  3P5X A;  2JQG R;  3U8E A;  4HWY A;  8PCH A;  1FH0 A;  4AXM A;  4MSX A;  1F2B A;  3QJ3 A;  1NL6 A;  3KW9 A;  2JQF R;  1NPZ A;  1AEC A;  1TU6 A;  3C9E A;  3RVW A;  3OF9 A;  1YK8 A;  3I3T A;  2AVW A;  3K24 A;  3M99 A;  1EWL A;  4Q8H A;  4DMY A;  4CDD B;  3CBK A;  1PBH A;  4BPV A;  3CH2 X;  2FO5 A; 
#chains in the Genus database with same CATH topology
 4FIP A;  4BOU A;  4REZ A;  3IMA A;  1BP4 A;  2IBI A;  3OVX A;  4A5U A;  3P5V A;  1U9W A;  4CDE B;  1U9X A;  1VJV A;  2NQD B;  1PE6 A;  4X6H A;  3H89 A;  3CBJ A;  3WXF A;  3MTN A;  3F5V A;  1EWP A;  3MHS A;  5JZE A;  4BOQ A;  4YYR A;  3C0R A;  1MS6 A;  2XU4 A;  3PW3 A;  2DOS A;  4PI3 A;  2NQI A;  3W31 A;  3H6S A;  1SNK A;  1O0E A;  1A6R A;  4OW0 A;  2DC8 A;  2ARY A;  4BQV A;  1AYV A;  2C0Y A;  2JTC A;  2JRI A;  3IV2 A;  1EF7 A;  2XU3 A;  5EZQ A;  4OEL A;  3N3G A;  4QRG A;  2Z84 A;  3GCB A;  3RNV A;  4ZUX U;  3KFQ A;  4IUM A;  1CB5 A;  3W30 A;  3BC3 A;  2DCB A;  2R9M A;  2PBH A;  2AUZ A;  2GFO A;  4MZS A;  4YV8 A;  5J94 A;  2FYE A;  4M0W A;  3USV A;  2PNS A;  3IOQ A;  4Q8G A;  1U9V A;  4D8B A;  4I07 A;  2UZJ A;  1MDW A;  1IWD A;  1CQD A;  2BDL A;  1ZCM A;  1NLJ A;  1ATK A;  1PXV A;  3O65 A;  4QRX A;  1QDQ A;  3D6S A;  3QT4 A;  1STF E;  1CV8 A;  1KXR A;  4DMX A;  2G6D A;  1AU0 A;  3LXS A;  4MM3 B;  2AUX A;  3PRM A;  2Y6E A;  2ACT A;  2YJ2 A;  4W5C A;  1MEM A;  2R9O A;  1BQI A;  3B21 A;  3O1G A;  5KO3 A;  3N3K A;  2FRQ A;  2DCC A;  2R9N A;  2DZY A;  3V6E A;  3K8U A;  1AYW A;  3H8C A;  1Y08 A;  1PPD A;  3QSD A;  1KFX L;  1F2C A;  4N79 A;  2G8J A;  1YVB A;  2HD5 A;  3I06 A;  4P6G A;  1TLO A;  2WBF X;  4W5B A;  2HWK A;  2CIO A;  2AS8 A;  3NHE A;  3S3R A;  2B1M A;  2FE8 A;  4X6J A;  2BTW B;  1GLO A;  2FT2 A;  3PSE A;  4FJC A;  9PAP A;  1Y4H A;  2HXZ A;  3TNX A;  4D8E A;  2B1N A;  3K9M A;  4AXL A;  2YJC A;  1CS8 A;  2AU1 A;  4ZTB A;  4QRV A;  1VSN A;  4P16 A;  1PAD A;  3RVX A;  2NQA A;  4KLB A;  4CDC B;  2PRE A;  3BPM A;  5EF4 A;  2FQ9 A;  2P7U A;  3PHU A;  3KWB X;  2F7D A;  3BBA A;  3BY4 A;  3PHW A;  3TRK A;  3N4C A;  1NQC A;  3S3Q A;  2BTW A;  1KHP A;  3OQC A;  3HHI A;  1KFU L;  1XKG A;  3B79 A;  3MHH A;  1AU2 A;  1YT7 A;  4WUR A;  5EZS A;  2FUD A;  3CH3 X;  3OIS A;  2E02 A;  1TL9 A;  2E01 A;  1ITO A;  4MZO A;  4YYQ A;  2YJB A;  1YZB A;  2J7Q A;  3E9S A;  3LFY A;  1DEU A;  2R9F A;  6PAD A;  5CVM A;  2OUL A;  5CVN B;  3BWK A;  2ATO A;  2HH5 A;  3F75 A;  1ME3 A;  4W4U A;  1U5I A;  2AIM A;  3MTV A;  1CTE A;  1AU3 A;  1HUC B;  1YK7 A;  5K16 A;  4CZW A;  5E6J A;  2OP3 A;  3HWN A;  1X9Y A;  3IFU A;  2E03 A;  1JQP A;  2VHF A;  2VHS A;  5EGW A;  4PAD A;  4BS6 A;  2FRA A;  4N8W A;  5A24 A;  4P6E A;  1PIP A;  1PCI A;  3WXE A;  1MEG A;  2DJF B;  3IUT A;  4BOP A;  1EWM A;  2NQG A;  3PNR A;  3KKU A;  2GHU A;  2G7Y A;  3MJ5 A;  3OF8 A;  1UKF A;  2DC7 A;  4PP1 A;  3PBH A;  2R6N A;  2F1G A;  1AYU A;  2YJ8 A;  2R9C A;  4QH6 A;  3KSE A;  1NB5 A;  1MIR A;  4XUI A;  4YYU A;  4D8I A;  2G8E A;  4I05 A;  2J7Q C;  1QMY A;  3BB7 A;  4I04 A;  4BOS A;  1GEC E;  1S4V A;  4K7C A;  5JH3 A;  5JA7 A;  1CVZ A;  2DC9 A;  3ERV A;  4XZX A;  3E1Z B;  2DZZ A;  3OVZ A;  3H8B A;  3MOR A;  4HXD B;  2XU1 A;  1GMY A;  5CHV A;  4FK5 A;  3H7D A;  1GCB A;  1BGO A;  1PPP A;  4YYW A;  1CJL A;  1ICF A;  1SP4 B;  4YVA A;  4G54 A;  3KWZ A;  4QBB A;  2PAD A;  2P86 A;  3ZNH A;  5CVO B;  3RVV A;  4R3D A;  2AGA A;  1CPJ A;  3ZUA A;  1THE A;  2P0R A;  2DJG B;  1K3B B;  2XU5 A;  3BOW A;  2H7J A;  4RF1 A;  4OEM A;  2Y5B A;  2IPP B;  1MHW A;  4BS5 A;  1POP A;  7PCK A;  4CDF B;  1U9Q X;  4WA6 A;  3V6C A;  3HD3 A;  3KX1 A;  3P5W A;  4RKX A;  4MI7 A;  4X6I A;  2OZ2 A;  3PRP A;  3TMP A;  2FTD A;  3IHP A;  4OVZ A;  1QXP A;  2AYO A;  3IEJ A;  2DCA A;  2YJ9 A;  1ZIV A;  5CHT A;  1NB3 A;  1AU4 A;  3PDF A;  3O0U A;  5FPW A;  2DCD A;  4PP2 E;  4BSQ A;  1EWO A;  1CSB B;  1QOL A;  2O6X A;  1PPN A;  3BCN A;  1DKI A;  3BPF A;  1KHQ A;  2E00 A;  1F2A A;  4N4Z A;  1M6D A;  1ME4 A;  3P5U A;  1YAL A;  4RY2 A;  4XR7 A;  1BY8 A;  4OVZ B;  1F29 A;  3WXG A;  5PAD A;  4YYS A;  1Q6K A;  1PPO A;  2BDZ A;  5F02 A;  3HHA A;  4BOZ A;  2BU3 A;  3PHX A;  1DF0 A;  3DF0 A;  2CB5 A;  1AIM A;  2HHN A;  2AYN A;  2DC6 A;  4GUA A;  4PT5 A;  3AI8 A;  4YYV A;  3P5X A;  2JQG R;  3U8E A;  4HWY A;  8PCH A;  1FH0 A;  4AXM A;  4MSX A;  1F2B A;  3QJ3 A;  1NL6 A;  3KW9 A;  4RF0 A;  3MP2 A;  3PT2 A;  4RNA A;  2JQF R;  1NPZ A;  1AEC A;  1TU6 A;  3C9E A;  3RVW A;  4IP3 A;  3OF9 A;  1YK8 A;  3I3T A;  1PVJ A;  2AVW A;  3K24 A;  3M99 A;  1EWL A;  4Q8H A;  4DMY A;  4CDD B;  3CBK A;  1PBH A;  4BPV A;  3CH2 X;  2FO5 A; 
#chains in the Genus database with same CATH homology
 4FIP A;  3IMA A;  1BP4 A;  2IBI A;  3OVX A;  3P5V A;  1U9W A;  4CDE B;  1U9X A;  1VJV A;  2NQD B;  1PE6 A;  4X6H A;  3H89 A;  3CBJ A;  3WXF A;  3MTN A;  3F5V A;  1EWP A;  3MHS A;  4YYR A;  1MS6 A;  2XU4 A;  3PW3 A;  4PI3 A;  2NQI A;  3H6S A;  1SNK A;  1O0E A;  1A6R A;  2DC8 A;  2ARY A;  4BQV A;  1AYV A;  2C0Y A;  3IV2 A;  1EF7 A;  2XU3 A;  4OEL A;  3N3G A;  4QRG A;  3GCB A;  4ZUX U;  3KFQ A;  1CB5 A;  3BC3 A;  2DCB A;  1W5R A;  2R9M A;  2PBH A;  2AUZ A;  2GFO A;  4MZS A;  3D9W A;  4YV8 A;  5J94 A;  2FYE A;  3USV A;  2PNS A;  3IOQ A;  4Q8G A;  1U9V A;  4I07 A;  1MDW A;  1IWD A;  1CQD A;  2BDL A;  4BGF A;  1ZCM A;  1NLJ A;  1ATK A;  1PXV A;  4QRX A;  1QDQ A;  3D6S A;  3QT4 A;  1STF E;  1CV8 A;  1KXR A;  4DMX A;  2G6D A;  1AU0 A;  3LXS A;  2AUX A;  2Y6E A;  2ACT A;  2YJ2 A;  4W5C A;  1MEM A;  2R9O A;  1BQI A;  3O1G A;  3N3K A;  2FRQ A;  2DCC A;  2R9N A;  2DZY A;  3V6E A;  3K8U A;  1AYW A;  3H8C A;  1Y08 A;  1PPD A;  3QSD A;  1KFX L;  1F2C A;  4N79 A;  2G8J A;  1YVB A;  2HD5 A;  3I06 A;  4P6G A;  1TLO A;  1GX3 A;  2WBF X;  4W5B A;  2CIO A;  2AS8 A;  3NHE A;  3S3R A;  2B1M A;  4X6J A;  3LTW A;  1GLO A;  2FT2 A;  4FJC A;  9PAP A;  1Y4H A;  2HXZ A;  3TNX A;  2B1N A;  3K9M A;  4AXL A;  2YJC A;  1CS8 A;  2AU1 A;  4QRV A;  1VSN A;  1PAD A;  3RVX A;  2NQA A;  4KLB A;  4CDC B;  2PRE A;  3BPM A;  5EF4 A;  2FQ9 A;  2P7U A;  3KWB X;  2F7D A;  3N4C A;  1NQC A;  3S3Q A;  1KHP A;  3HHI A;  1KFU L;  1XKG A;  3B79 A;  3MHH A;  1AU2 A;  1YT7 A;  2FUD A;  3CH3 X;  3OIS A;  2E02 A;  1TL9 A;  2BSZ A;  2E01 A;  1ITO A;  4MZO A;  4YYQ A;  2YJB A;  3LFY A;  1DEU A;  2R9F A;  6PAD A;  5CVM A;  2OUL A;  5CVN B;  3BWK A;  2ATO A;  2HH5 A;  3F75 A;  1ME3 A;  4W4U A;  1U5I A;  2AIM A;  1CTE A;  1AU3 A;  1HUC B;  1YK7 A;  2VFC A;  5K16 A;  4CZW A;  2OP3 A;  3HWN A;  1X9Y A;  2E03 A;  1JQP A;  2VHF A;  2VHS A;  5EGW A;  4PAD A;  4BS6 A;  2FRA A;  4N8W A;  5A24 A;  4P6E A;  1PIP A;  1PCI A;  3WXE A;  1MEG A;  2DJF B;  3IUT A;  1EWM A;  2NQG A;  3PNR A;  3KKU A;  2GHU A;  2G7Y A;  3OF8 A;  2DC7 A;  4PP1 A;  3PBH A;  2R6N A;  4C5P A;  2F1G A;  1AYU A;  2YJ8 A;  2R9C A;  4QH6 A;  3KSE A;  1NB5 A;  1MIR A;  4XUI A;  4YYU A;  2G8E A;  4I05 A;  1QMY A;  4I04 A;  4NV7 A;  2VFB A;  1GEC E;  1S4V A;  4K7C A;  5JH3 A;  5JA7 A;  1CVZ A;  2DC9 A;  3ERV A;  3E1Z B;  2DZZ A;  3OVZ A;  3H8B A;  3MOR A;  2XU1 A;  1GMY A;  5CHV A;  4FK5 A;  3H7D A;  1GCB A;  1BGO A;  1PPP A;  4YYW A;  1CJL A;  1ICF A;  1SP4 B;  4YVA A;  4G54 A;  3KWZ A;  4QBB A;  2PAD A;  2P86 A;  5CVO B;  3RVV A;  1CPJ A;  3ZUA A;  1THE A;  2P0R A;  2DJG B;  1K3B B;  2XU5 A;  3BOW A;  2H7J A;  1W6F A;  4OEM A;  2Y5B A;  2IPP B;  1MHW A;  4BS5 A;  1POP A;  7PCK A;  4CDF B;  1U9Q X;  4WA6 A;  3V6C A;  3HD3 A;  3KX1 A;  3P5W A;  4X6I A;  2OZ2 A;  2FTD A;  3IHP A;  1QXP A;  2AYO A;  3IEJ A;  2DCA A;  2YJ9 A;  1ZIV A;  5CHT A;  4GUZ A;  1NB3 A;  1AU4 A;  3PDF A;  3O0U A;  5FPW A;  2DCD A;  4PP2 E;  4B55 A;  4BSQ A;  1EWO A;  1CSB B;  1QOL A;  2O6X A;  1PPN A;  3BCN A;  1W4T A;  3BPF A;  1KHQ A;  2E00 A;  1F2A A;  4N4Z A;  1M6D A;  1ME4 A;  3P5U A;  1YAL A;  4RY2 A;  4XR7 A;  1BY8 A;  1F29 A;  3WXG A;  5PAD A;  4YYS A;  1Q6K A;  1PPO A;  2BDZ A;  5F02 A;  3HHA A;  1DF0 A;  3DF0 A;  2CB5 A;  1AIM A;  2HHN A;  2AYN A;  2DC6 A;  3AI8 A;  4YYV A;  3P5X A;  2JQG R;  3U8E A;  4HWY A;  8PCH A;  1FH0 A;  4AXM A;  4MSX A;  1F2B A;  3QJ3 A;  1NL6 A;  3KW9 A;  1E2T A;  2JQF R;  1NPZ A;  1AEC A;  1TU6 A;  3C9E A;  3RVW A;  3OF9 A;  1YK8 A;  3I3T A;  2AVW A;  4NV8 A;  3K24 A;  3M99 A;  1EWL A;  4Q8H A;  4DMY A;  4CDD B;  3CBK A;  1PBH A;  4BPV A;  3CH2 X;  2FO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...