3H7DA

The crystal structure of the cathepsin k variant m5 in complex with chondroitin-4-sulfate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APDSVDYREKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGESKGNKHWIIKNSWGENWGMGGYIKMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity analysis of cathepsin K/chondroitin 4-sulfate interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 69
structure length 215
sequence length 215
chains with identical sequence E
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h7dA00
3OVXA 4W5BA 9PAPA 1MEMA 3IHPA 4P6GA 2AYOA 4W4UA 1BP4A 3KX1A 1CSBB 5JH3A 1PE6A 1ME3A 2Y6EA 2XU4A 2DC6A 2YJ9A 3P5WA 3MORA 5PADA 5CHTA 1PBHA 2AS8A 5JA7A 2AIMA 1QXPA 1GECE 2HD5A 3OVZA 3CBJA 2AUZA 1F2BA 2FTDA 5EF4A 3USVA 2E01A 4FIPA 2XU3A 1F2CA 4YYSA 2DCCA 1ICFA 4QRVA 3AI8A 4QH6A 1TLOA 2Y5BA 2R9MA 4YYQA 2NQIA 2R9NA 3CH3X 4ZUXU 3K8UA 2FO5A 3BPFA 6PADA 2FUDA 2ARYA 1NQCA 3KKUA 2VHFA 3HWNA 3F5VA 3GCBA 2NQAA 4G54A 2E00A 1NB5A 1AU0A 8PCHA 2DZYA 2OZ2A 3BC3A 2FQ9A 1NPZA 3K9MA 3KWBX 4X6JA 3S3RA 5J94A 4YYVA 3CH2X 3KWZA 4K7CA 3BOWA 3QT4A 1PPDA 2DC9A 3V6EA 1BQIA 1PADA 2FT2A 1PXVA 2P0RA 3KFQA 1A6RA 2AVWA 2XU5A 1EWMA 5A24A 3H8BA 3LFYA 1K3BB 3H6SA 2BDZA 2HH5A 4QRXA 2DCAA 1ZCMA 3PDFA 1STFE 5CHVA 5CVMA 1U9VA 2PREA 1NLJA 4I05A 1Y08A 1KHQA 3MHSA 3OF9A 1U5IA 4CDEB 1U9XA 2P86A 2R6NA 3PNRA 4CDFB 1U9QX 2DC7A 3O0UA 3HD3A 4AXLA 2G8EA 4BQVA 2G6DA 2AYNA 2CIOA 1MEGA 2PBHA 1NB3A 4XUIA 5F02A 4I07A 3LXSA 2DCBA 2B1MA 3H89A 2PNSA 1KFUL 3RVVA 2AUXA 1CJLA 4I04A 2P7UA 2HXZA 2WBFX 2DZZA 3BWKA 2YJCA 2JQGR 1GLOA 2R9OA 1KHPA 4X6HA 1PPPA 1AIMA 1JQPA 1IWDA 1YT7A 2ACTA 3RVWA 1AU3A 1YVBA 2F1GA 2DJFB 4YVAA 1F2AA 4YYUA 3NHEA 1AECA 4P6EA 4HWYA 3KSEA 3D6SA 1ZIVA 1AYWA 4QBBA 1VSNA 1AYVA 1CTEA 3U8EA 1BGOA 2IPPB 3QJ3A 3IOQA 1EWLA 3N3KA 1EWPA 1DEUA 1EF7A 4Q8HA 4BS5A 3WXEA 3C9EA 4AXMA 1PCIA 4PI3A 4PADA 2FRQA 4KLBA 3K24A 1PPOA 2G8JA 4FJCA 3KW9A 3B79A 1EWOA 2IBIA 3ERVA 2XU1A 7PCKA 3E1ZB 2PADA 3IV2A 3WXFA 1PIPA 3P5XA 4N4ZA 3CBKA 1CQDA 4DMYA 1KFXL 1TL9A 2OP3A 2R9CA 3HHIA 1YK7A 4N79A 3V6CA 1MS6A 2AU1A 1CV8A 3TNXA 1CPJA 2OULA 3N3GA 4PP2E 4WA6A 3DF0A 1MDWA 3MHHA 4YYWA 1GMYA 1Q6KA 1ME4A 1AYUA 4CDCB 2VHSA 3IUTA 2FYEA 2NQGA 3IMAA 4CDDB 3N4CA 3HHAA 1Y4HA 5EGWA 1CVZA 4N8WA 1ITOA 4MZSA 2YJBA 3IEJA 4X6IA 5FPWA 2O6XA 4DMXA 1VJVA 5CVNB 5CVOB 2DJGB 4RY2A 1POPA 2GHUA 3H8CA 4MZOA 1KXRA 4Q8GA 3P5UA 2FRAA 1BY8A 3P5VA 5K16A 3PW3A 1O0EA 1SNKA 1SP4B 4CZWA 3I06A 2B1NA 1XKGA 3OF8A 4OEMA 2G7YA 1PPNA 1QDQA 2GFOA 1S4VA 3ZUAA 2E03A 4OELA 4BPVA 1QOLA 1F29A 4YYRA 4BSQA 1THEA 2H7JA 2YJ2A 4W5CA 1YALA 2R9FA 1AU4A 2ATOA 2CB5A 4MSXA 3O1GA 4PP1A 2F7DA 3RVXA 1QMYA 4FK5A 2NQDB 1MHWA 2DC8A 2JQFR 3BPMA 4XR7A 3H7DA 3BCNA 1M6DA 1ATKA 1CS8A 3PBHA 1YK8A 2DCDA 2HHNA 3M99A 1TU6A 2C0YA 1HUCB 2YJ8A 3WXGA 1CB5A 1X9YA 3MTNA 4QRGA 1MIRA 3OISA 3F75A 1U9WA 1FH0A 3QSDA 3I3TA 1DF0A 2BDLA 4BS6A 4YV8A 1AU2A 1NL6A 3S3QA 2E02A 1GCBA
chains in the Genus database with same CATH superfamily
3OVXA 4W5BA 3PHUA 9PAPA 1MEMA 3IHPA 4P6GA 2AYOA 4W4UA 1BP4A 3KX1A 1CSBB 5E6JA 5JH3A 1PE6A 1ME3A 2Y6EA 2XU4A 2DC6A 2YJ9A 3P5WA 4MI7A 3MORA 5PADA 5CHTA 1PBHA 4BOQA 2AS8A 5JA7A 4RKXA 5KO3A 2AIMA 1QXPA 3PRMA 1GECE 2HD5A 3OVZA 3CBJA 2AUZA 1F2BA 2FTDA 5EF4A 3USVA 2E01A 4FIPA 2XU3A 4REZA 1F2CA 4ZTBA 4YYSA 2DCCA 4IP3A 1ICFA 4QRVA 3AI8A 4QH6A 3TMPA 1TLOA 3C0RA 2Y5BA 2R9MA 2UZJA 4YYQA 2NQIA 2R9NA 3CH3X 4ZUXU 3K8UA 2FO5A 3BPFA 4D8EA 6PADA 2FUDA 2ARYA 1NQCA 3KKUA 2VHFA 3HWNA 3F5VA 3GCBA 2NQAA 4G54A 2E00A 1NB5A 1AU0A 3OQCA 8PCHA 2DZYA 2OZ2A 2J7QA 3BC3A 2FQ9A 1NPZA 3PSEA 2AGAA 3K9MA 3KWBX 4X6JA 3S3RA 5J94A 4YYVA 3CH2X 3KWZA 4K7CA 3BOWA 3QT4A 1PPDA 2DC9A 3V6EA 1UKFA 1BQIA 1PADA 2FT2A 1PXVA 2P0RA 3KFQA 1A6RA 4BOUA 2AVWA 2XU5A 1EWMA 5A24A 3H8BA 4RF1A 3LFYA 3B21A 1K3BB 4A5UA 3W30A 3H6SA 4PT5A 4RF0A 2BDZA 2HH5A 4QRXA 2DCAA 1ZCMA 3PDFA 1STFE 5CHVA 5CVMA 1U9VA 2PREA 1NLJA 4I05A 1Y08A 1KHQA 3MHSA 3OF9A 1U5IA 4CDEB 1U9XA 2P86A 2R6NA 3PNRA 4CDFB 1U9QX 2DC7A 3O0UA 3HD3A 3ZNHA 4AXLA 2G8EA 4BQVA 2G6DA 3PHXA 2AYNA 2CIOA 1MEGA 2PBHA 4D8IA 1NB3A 4XUIA 5F02A 4BOPA 4I07A 3LXSA 2DCBA 2B1MA 3H89A 2PNSA 1KFUL 3RVVA 3RNVA 2AUXA 4I04A 1CJLA 2JRIA 2P7UA 2HXZA 2WBFX 2DZZA 3BWKA 2YJCA 2JQGR 1GLOA 3W31A 2R9OA 1KHPA 4X6HA 1PPPA 1AIMA 1JQPA 1IWDA 1YT7A 2ACTA 3RVWA 1AU3A 1YVBA 4MM3B 3BY4A 2F1GA 2DJFB 4YVAA 1F2AA 1YZBA 4YYUA 5JZEA 3NHEA 1AECA 2J7QC 4P6EA 1DKIA 4HWYA 3KSEA 3D6SA 1ZIVA 1AYWA 2JTCA 4QBBA 1VSNA 1AYVA 2FE8A 1CTEA 3U8EA 1BGOA 2IPPB 3QJ3A 3IOQA 1EWLA 3N3KA 1EWPA 4OVZA 1DEUA 1EF7A 4Q8HA 4BS5A 3WXEA 3C9EA 4AXMA 1PCIA 4IUMA 4PI3A 4PADA 2Z84A 2FRQA 4RNAA 4KLBA 3MJ5A 3K24A 1PPOA 2G8JA 4FJCA 4M0WA 3KW9A 3B79A 1EWOA 2IBIA 3ERVA 2XU1A 7PCKA 3E1ZB 2PADA 3IV2A 3WXFA 3PHWA 4XZXA 3IFUA 1PIPA 3P5XA 4N4ZA 3CBKA 1CQDA 4DMYA 1KFXL 1TL9A 4WURA 2OP3A 2R9CA 3HHIA 1YK7A 4N79A 3V6CA 1MS6A 3BBAA 2AU1A 1CV8A 3TNXA 1CPJA 2OULA 4OVZB 3N3GA 4PP2E 4WA6A 3DF0A 4BOSA 1MDWA 2BU3A 3MHHA 4YYWA 1GMYA 4P16A 1Q6KA 1ME4A 1AYUA 4CDCB 2VHSA 3IUTA 2FYEA 2NQGA 3IMAA 4CDDB 3N4CA 3HHAA 1Y4HA 5EGWA 1CVZA 4N8WA 2HWKA 1ITOA 4MZSA 2YJBA 3IEJA 4BOZA 4X6IA 2BTWA 2DOSA 5FPWA 2O6XA 4DMXA 1VJVA 3O65A 5CVNB 5CVOB 2DJGB 4RY2A 1POPA 2GHUA 3H8CA 4MZOA 1KXRA 4Q8GA 3P5UA 2FRAA 1BY8A 3P5VA 5K16A 3PW3A 1O0EA 1SNKA 1SP4B 4CZWA 3I06A 2B1NA 1XKGA 3OF8A 4OEMA 2G7YA 1PPNA 4D8BA 1QDQA 2GFOA 1S4VA 3BB7A 5EZSA 3ZUAA 2E03A 4OELA 4BPVA 1QOLA 1F29A 2BTWB 4YYRA 4BSQA 1THEA 2H7JA 3MP2A 2YJ2A 4W5CA 1YALA 2R9FA 1AU4A 2ATOA 2CB5A 4MSXA 3O1GA 2F7DA 4PP1A 3RVXA 1QMYA 4FK5A 2NQDB 4OW0A 1MHWA 2DC8A 2JQFR 3TRKA 3BPMA 4XR7A 3H7DA 3BCNA 4HXDB 1M6DA 1ATKA 3E9SA 1CS8A 3PBHA 1YK8A 2DCDA 2HHNA 3M99A 1TU6A 2C0YA 1HUCB 2YJ8A 3WXGA 1CB5A 3MTNA 1X9YA 1PVJA 4R3DA 4QRGA 1MIRA 3OISA 5EZQA 3F75A 1U9WA 1FH0A 3MTVA 3PRPA 3QSDA 3I3TA 1DF0A 4GUAA 2BDLA 4BS6A 4YV8A 1AU2A 3PT2A 1NL6A 3S3QA 2E02A 1GCBA
chains in the Genus database with same CATH topology
3OVXA 4W5BA 9PAPA 1MEMA 3IHPA 4P6GA 2AYOA 4W4UA 1BP4A 3KX1A 1CSBB 4BGFA 5JH3A 1PE6A 1ME3A 2Y6EA 4NV7A 2XU4A 2DC6A 2YJ9A 3P5WA 3MORA 5PADA 4C5PA 5CHTA 1PBHA 4B55A 2AS8A 5JA7A 2AIMA 1QXPA 1GECE 1E2TA 2HD5A 3OVZA 3CBJA 2AUZA 1F2BA 2FTDA 5EF4A 3USVA 2E01A 4FIPA 2XU3A 1F2CA 4YYSA 2DCCA 1ICFA 4QRVA 3AI8A 4QH6A 1TLOA 2Y5BA 2R9MA 4YYQA 2NQIA 2R9NA 3CH3X 4ZUXU 3K8UA 2FO5A 3BPFA 6PADA 2FUDA 2ARYA 1NQCA 3KKUA 2VHFA 3HWNA 3F5VA 3GCBA 2NQAA 4G54A 2E00A 1NB5A 1AU0A 8PCHA 2DZYA 2OZ2A 3BC3A 2FQ9A 1NPZA 3K9MA 3KWBX 4X6JA 3S3RA 5J94A 4YYVA 3CH2X 3KWZA 4K7CA 3BOWA 2VFBA 3QT4A 1PPDA 2DC9A 3V6EA 1BQIA 1PADA 2FT2A 1PXVA 2P0RA 3KFQA 1A6RA 2AVWA 2XU5A 1EWMA 5A24A 3H8BA 3LFYA 1K3BB 3H6SA 2BDZA 2HH5A 4QRXA 2DCAA 1ZCMA 3PDFA 1STFE 5CHVA 5CVMA 1U9VA 2PREA 1NLJA 4I05A 4NV8A 1Y08A 1KHQA 3MHSA 3OF9A 1U5IA 4CDEB 1W6FA 1U9XA 2P86A 2R6NA 3PNRA 4CDFB 1U9QX 2DC7A 3O0UA 3HD3A 4AXLA 2G8EA 4BQVA 2G6DA 2AYNA 2CIOA 1MEGA 2PBHA 1NB3A 4XUIA 5F02A 4I07A 3LXSA 2DCBA 2B1MA 3H89A 1W5RA 2PNSA 1KFUL 3RVVA 2AUXA 1CJLA 4I04A 2P7UA 2HXZA 2WBFX 2DZZA 3BWKA 1GX3A 2YJCA 2JQGR 1GLOA 2R9OA 1KHPA 4X6HA 1PPPA 1AIMA 1JQPA 4GUZA 1IWDA 1YT7A 2ACTA 3RVWA 3D9WA 1AU3A 1YVBA 2F1GA 2DJFB 4YVAA 1F2AA 4YYUA 3LTWA 3NHEA 1AECA 4P6EA 4HWYA 3KSEA 3D6SA 1ZIVA 1AYWA 4QBBA 1VSNA 1AYVA 1CTEA 3U8EA 1BGOA 2IPPB 3QJ3A 3IOQA 1EWLA 3N3KA 1EWPA 1DEUA 1EF7A 4Q8HA 4BS5A 3WXEA 3C9EA 4AXMA 1PCIA 4PI3A 4PADA 2FRQA 4KLBA 3K24A 1PPOA 2G8JA 4FJCA 3KW9A 3B79A 1EWOA 2IBIA 3ERVA 2XU1A 7PCKA 3E1ZB 2PADA 3IV2A 3WXFA 1PIPA 3P5XA 4N4ZA 3CBKA 1CQDA 4DMYA 1KFXL 1TL9A 2OP3A 2R9CA 3HHIA 1YK7A 4N79A 3V6CA 1MS6A 2AU1A 1CV8A 3TNXA 1CPJA 2OULA 3N3GA 4PP2E 4WA6A 3DF0A 1MDWA 3MHHA 4YYWA 1GMYA 1Q6KA 1ME4A 1AYUA 4CDCB 2VHSA 3IUTA 2FYEA 2NQGA 3IMAA 4CDDB 3N4CA 3HHAA 1Y4HA 5EGWA 1CVZA 2VFCA 4N8WA 1ITOA 4MZSA 2YJBA 3IEJA 4X6IA 5FPWA 2O6XA 4DMXA 1VJVA 5CVNB 5CVOB 2DJGB 4RY2A 1POPA 2GHUA 3H8CA 4MZOA 1KXRA 4Q8GA 3P5UA 2FRAA 1BY8A 3P5VA 5K16A 3PW3A 1O0EA 1SNKA 1SP4B 4CZWA 3I06A 2B1NA 1XKGA 3OF8A 4OEMA 2G7YA 1PPNA 1W4TA 1QDQA 2GFOA 1S4VA 3ZUAA 2E03A 4OELA 4BPVA 1QOLA 1F29A 4YYRA 4BSQA 1THEA 2H7JA 2YJ2A 4W5CA 1YALA 2R9FA 1AU4A 2ATOA 2CB5A 4MSXA 3O1GA 4PP1A 2F7DA 3RVXA 1QMYA 4FK5A 2NQDB 1MHWA 2DC8A 2JQFR 3BPMA 4XR7A 3H7DA 3BCNA 1M6DA 1ATKA 1CS8A 3PBHA 1YK8A 2DCDA 2HHNA 3M99A 1TU6A 2C0YA 1HUCB 2YJ8A 3WXGA 1CB5A 1X9YA 3MTNA 2BSZA 4QRGA 1MIRA 3OISA 3F75A 1U9WA 1FH0A 3QSDA 3I3TA 1DF0A 2BDLA 4BS6A 4YV8A 1AU2A 1NL6A 3S3QA 2E02A 1GCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVX A;  4W5B A;  9PAP A;  1MEM A;  3IHP A;  4P6G A;  2AYO A;  4W4U A;  1BP4 A;  3KX1 A;  1CSB B;  5JH3 A;  1PE6 A;  1ME3 A;  2Y6E A;  2XU4 A;  2DC6 A;  2YJ9 A;  3P5W A;  3MOR A;  5PAD A;  5CHT A;  1PBH A;  2AS8 A;  5JA7 A;  2AIM A;  1QXP A;  1GEC E;  2HD5 A;  3OVZ A;  3CBJ A;  2AUZ A;  1F2B A;  2FTD A;  5EF4 A;  3USV A;  2E01 A;  4FIP A;  2XU3 A;  1F2C A;  4YYS A;  2DCC A;  1ICF A;  4QRV A;  3AI8 A;  4QH6 A;  1TLO A;  2Y5B A;  2R9M A;  4YYQ A;  2NQI A;  2R9N A;  3CH3 X;  4ZUX U;  3K8U A;  2FO5 A;  3BPF A;  6PAD A;  2FUD A;  2ARY A;  1NQC A;  3KKU A;  2VHF A;  3HWN A;  3F5V A;  3GCB A;  2NQA A;  4G54 A;  2E00 A;  1NB5 A;  1AU0 A;  8PCH A;  2DZY A;  2OZ2 A;  3BC3 A;  2FQ9 A;  1NPZ A;  3K9M A;  3KWB X;  4X6J A;  3S3R A;  5J94 A;  4YYV A;  3CH2 X;  3KWZ A;  4K7C A;  3BOW A;  3QT4 A;  1PPD A;  2DC9 A;  3V6E A;  1BQI A;  1PAD A;  2FT2 A;  1PXV A;  2P0R A;  3KFQ A;  1A6R A;  2AVW A;  2XU5 A;  1EWM A;  5A24 A;  3H8B A;  3LFY A;  1K3B B;  3H6S A;  2BDZ A;  2HH5 A;  4QRX A;  2DCA A;  1ZCM A;  3PDF A;  1STF E;  5CHV A;  5CVM A;  1U9V A;  2PRE A;  1NLJ A;  4I05 A;  1Y08 A;  1KHQ A;  3MHS A;  3OF9 A;  1U5I A;  4CDE B;  1U9X A;  2P86 A;  2R6N A;  3PNR A;  4CDF B;  1U9Q X;  2DC7 A;  3O0U A;  3HD3 A;  4AXL A;  2G8E A;  4BQV A;  2G6D A;  2AYN A;  2CIO A;  1MEG A;  2PBH A;  1NB3 A;  4XUI A;  5F02 A;  4I07 A;  3LXS A;  2DCB A;  2B1M A;  3H89 A;  2PNS A;  1KFU L;  3RVV A;  2AUX A;  1CJL A;  4I04 A;  2P7U A;  2HXZ A;  2WBF X;  2DZZ A;  3BWK A;  2YJC A;  2JQG R;  1GLO A;  2R9O A;  1KHP A;  4X6H A;  1PPP A;  1AIM A;  1JQP A;  1IWD A;  1YT7 A;  2ACT A;  3RVW A;  1AU3 A;  1YVB A;  2F1G A;  2DJF B;  4YVA A;  1F2A A;  4YYU A;  3NHE A;  1AEC A;  4P6E A;  4HWY A;  3KSE A;  3D6S A;  1ZIV A;  1AYW A;  4QBB A;  1VSN A;  1AYV A;  1CTE A;  3U8E A;  1BGO A;  2IPP B;  3QJ3 A;  3IOQ A;  1EWL A;  3N3K A;  1EWP A;  1DEU A;  1EF7 A;  4Q8H A;  4BS5 A;  3WXE A;  3C9E A;  4AXM A;  1PCI A;  4PI3 A;  4PAD A;  2FRQ A;  4KLB A;  3K24 A;  1PPO A;  2G8J A;  4FJC A;  3KW9 A;  3B79 A;  1EWO A;  2IBI A;  3ERV A;  2XU1 A;  7PCK A;  3E1Z B;  2PAD A;  3IV2 A;  3WXF A;  1PIP A;  3P5X A;  4N4Z A;  3CBK A;  1CQD A;  4DMY A;  1KFX L;  1TL9 A;  2OP3 A;  2R9C A;  3HHI A;  1YK7 A;  4N79 A;  3V6C A;  1MS6 A;  2AU1 A;  1CV8 A;  3TNX A;  1CPJ A;  2OUL A;  3N3G A;  4PP2 E;  4WA6 A;  3DF0 A;  1MDW A;  3MHH A;  4YYW A;  1GMY A;  1Q6K A;  1ME4 A;  1AYU A;  4CDC B;  2VHS A;  3IUT A;  2FYE A;  2NQG A;  3IMA A;  4CDD B;  3N4C A;  3HHA A;  1Y4H A;  5EGW A;  1CVZ A;  4N8W A;  1ITO A;  4MZS A;  2YJB A;  3IEJ A;  4X6I A;  5FPW A;  2O6X A;  4DMX A;  1VJV A;  5CVN B;  5CVO B;  2DJG B;  4RY2 A;  1POP A;  2GHU A;  3H8C A;  4MZO A;  1KXR A;  4Q8G A;  3P5U A;  2FRA A;  1BY8 A;  3P5V A;  5K16 A;  3PW3 A;  1O0E A;  1SNK A;  1SP4 B;  4CZW A;  3I06 A;  2B1N A;  1XKG A;  3OF8 A;  4OEM A;  2G7Y A;  1PPN A;  1QDQ A;  2GFO A;  1S4V A;  3ZUA A;  2E03 A;  4OEL A;  4BPV A;  1QOL A;  1F29 A;  4YYR A;  4BSQ A;  1THE A;  2H7J A;  2YJ2 A;  4W5C A;  1YAL A;  2R9F A;  1AU4 A;  2ATO A;  2CB5 A;  4MSX A;  3O1G A;  4PP1 A;  2F7D A;  3RVX A;  1QMY A;  4FK5 A;  2NQD B;  1MHW A;  2DC8 A;  2JQF R;  3BPM A;  4XR7 A;  3H7D A;  3BCN A;  1M6D A;  1ATK A;  1CS8 A;  3PBH A;  1YK8 A;  2DCD A;  2HHN A;  3M99 A;  1TU6 A;  2C0Y A;  1HUC B;  2YJ8 A;  3WXG A;  1CB5 A;  1X9Y A;  3MTN A;  4QRG A;  1MIR A;  3OIS A;  3F75 A;  1U9W A;  1FH0 A;  3QSD A;  3I3T A;  1DF0 A;  2BDL A;  4BS6 A;  4YV8 A;  1AU2 A;  1NL6 A;  3S3Q A;  2E02 A;  1GCB A; 
#chains in the Genus database with same CATH topology
 3OVX A;  4W5B A;  3PHU A;  9PAP A;  1MEM A;  3IHP A;  4P6G A;  2AYO A;  4W4U A;  1BP4 A;  3KX1 A;  1CSB B;  5E6J A;  5JH3 A;  1PE6 A;  1ME3 A;  2Y6E A;  2XU4 A;  2DC6 A;  2YJ9 A;  3P5W A;  4MI7 A;  3MOR A;  5PAD A;  5CHT A;  1PBH A;  4BOQ A;  2AS8 A;  5JA7 A;  4RKX A;  5KO3 A;  2AIM A;  1QXP A;  3PRM A;  1GEC E;  2HD5 A;  3OVZ A;  3CBJ A;  2AUZ A;  1F2B A;  2FTD A;  5EF4 A;  3USV A;  2E01 A;  4FIP A;  2XU3 A;  4REZ A;  1F2C A;  4ZTB A;  4YYS A;  2DCC A;  4IP3 A;  1ICF A;  4QRV A;  3AI8 A;  4QH6 A;  3TMP A;  1TLO A;  3C0R A;  2Y5B A;  2R9M A;  2UZJ A;  4YYQ A;  2NQI A;  2R9N A;  3CH3 X;  4ZUX U;  3K8U A;  2FO5 A;  3BPF A;  4D8E A;  6PAD A;  2FUD A;  2ARY A;  1NQC A;  3KKU A;  2VHF A;  3HWN A;  3F5V A;  3GCB A;  2NQA A;  4G54 A;  2E00 A;  1NB5 A;  1AU0 A;  3OQC A;  8PCH A;  2DZY A;  2OZ2 A;  2J7Q A;  3BC3 A;  2FQ9 A;  1NPZ A;  3PSE A;  2AGA A;  3K9M A;  3KWB X;  4X6J A;  3S3R A;  5J94 A;  4YYV A;  3CH2 X;  3KWZ A;  4K7C A;  3BOW A;  3QT4 A;  1PPD A;  2DC9 A;  3V6E A;  1UKF A;  1BQI A;  1PAD A;  2FT2 A;  1PXV A;  2P0R A;  3KFQ A;  1A6R A;  4BOU A;  2AVW A;  2XU5 A;  1EWM A;  5A24 A;  3H8B A;  4RF1 A;  3LFY A;  3B21 A;  1K3B B;  4A5U A;  3W30 A;  3H6S A;  4PT5 A;  4RF0 A;  2BDZ A;  2HH5 A;  4QRX A;  2DCA A;  1ZCM A;  3PDF A;  1STF E;  5CHV A;  5CVM A;  1U9V A;  2PRE A;  1NLJ A;  4I05 A;  1Y08 A;  1KHQ A;  3MHS A;  3OF9 A;  1U5I A;  4CDE B;  1U9X A;  2P86 A;  2R6N A;  3PNR A;  4CDF B;  1U9Q X;  2DC7 A;  3O0U A;  3HD3 A;  3ZNH A;  4AXL A;  2G8E A;  4BQV A;  2G6D A;  3PHX A;  2AYN A;  2CIO A;  1MEG A;  2PBH A;  4D8I A;  1NB3 A;  4XUI A;  5F02 A;  4BOP A;  4I07 A;  3LXS A;  2DCB A;  2B1M A;  3H89 A;  2PNS A;  1KFU L;  3RVV A;  3RNV A;  2AUX A;  4I04 A;  1CJL A;  2JRI A;  2P7U A;  2HXZ A;  2WBF X;  2DZZ A;  3BWK A;  2YJC A;  2JQG R;  1GLO A;  3W31 A;  2R9O A;  1KHP A;  4X6H A;  1PPP A;  1AIM A;  1JQP A;  1IWD A;  1YT7 A;  2ACT A;  3RVW A;  1AU3 A;  1YVB A;  4MM3 B;  3BY4 A;  2F1G A;  2DJF B;  4YVA A;  1F2A A;  1YZB A;  4YYU A;  5JZE A;  3NHE A;  1AEC A;  2J7Q C;  4P6E A;  1DKI A;  4HWY A;  3KSE A;  3D6S A;  1ZIV A;  1AYW A;  2JTC A;  4QBB A;  1VSN A;  1AYV A;  2FE8 A;  1CTE A;  3U8E A;  1BGO A;  2IPP B;  3QJ3 A;  3IOQ A;  1EWL A;  3N3K A;  1EWP A;  4OVZ A;  1DEU A;  1EF7 A;  4Q8H A;  4BS5 A;  3WXE A;  3C9E A;  4AXM A;  1PCI A;  4IUM A;  4PI3 A;  4PAD A;  2Z84 A;  2FRQ A;  4RNA A;  4KLB A;  3MJ5 A;  3K24 A;  1PPO A;  2G8J A;  4FJC A;  4M0W A;  3KW9 A;  3B79 A;  1EWO A;  2IBI A;  3ERV A;  2XU1 A;  7PCK A;  3E1Z B;  2PAD A;  3IV2 A;  3WXF A;  3PHW A;  4XZX A;  3IFU A;  1PIP A;  3P5X A;  4N4Z A;  3CBK A;  1CQD A;  4DMY A;  1KFX L;  1TL9 A;  4WUR A;  2OP3 A;  2R9C A;  3HHI A;  1YK7 A;  4N79 A;  3V6C A;  1MS6 A;  3BBA A;  2AU1 A;  1CV8 A;  3TNX A;  1CPJ A;  2OUL A;  4OVZ B;  3N3G A;  4PP2 E;  4WA6 A;  3DF0 A;  4BOS A;  1MDW A;  2BU3 A;  3MHH A;  4YYW A;  1GMY A;  4P16 A;  1Q6K A;  1ME4 A;  1AYU A;  4CDC B;  2VHS A;  3IUT A;  2FYE A;  2NQG A;  3IMA A;  4CDD B;  3N4C A;  3HHA A;  1Y4H A;  5EGW A;  1CVZ A;  4N8W A;  2HWK A;  1ITO A;  4MZS A;  2YJB A;  3IEJ A;  4BOZ A;  4X6I A;  2BTW A;  2DOS A;  5FPW A;  2O6X A;  4DMX A;  1VJV A;  3O65 A;  5CVN B;  5CVO B;  2DJG B;  4RY2 A;  1POP A;  2GHU A;  3H8C A;  4MZO A;  1KXR A;  4Q8G A;  3P5U A;  2FRA A;  1BY8 A;  3P5V A;  5K16 A;  3PW3 A;  1O0E A;  1SNK A;  1SP4 B;  4CZW A;  3I06 A;  2B1N A;  1XKG A;  3OF8 A;  4OEM A;  2G7Y A;  1PPN A;  4D8B A;  1QDQ A;  2GFO A;  1S4V A;  3BB7 A;  5EZS A;  3ZUA A;  2E03 A;  4OEL A;  4BPV A;  1QOL A;  1F29 A;  2BTW B;  4YYR A;  4BSQ A;  1THE A;  2H7J A;  3MP2 A;  2YJ2 A;  4W5C A;  1YAL A;  2R9F A;  1AU4 A;  2ATO A;  2CB5 A;  4MSX A;  3O1G A;  2F7D A;  4PP1 A;  3RVX A;  1QMY A;  4FK5 A;  2NQD B;  4OW0 A;  1MHW A;  2DC8 A;  2JQF R;  3TRK A;  3BPM A;  4XR7 A;  3H7D A;  3BCN A;  4HXD B;  1M6D A;  1ATK A;  3E9S A;  1CS8 A;  3PBH A;  1YK8 A;  2DCD A;  2HHN A;  3M99 A;  1TU6 A;  2C0Y A;  1HUC B;  2YJ8 A;  3WXG A;  1CB5 A;  3MTN A;  1X9Y A;  1PVJ A;  4R3D A;  4QRG A;  1MIR A;  3OIS A;  5EZQ A;  3F75 A;  1U9W A;  1FH0 A;  3MTV A;  3PRP A;  3QSD A;  3I3T A;  1DF0 A;  4GUA A;  2BDL A;  4BS6 A;  4YV8 A;  1AU2 A;  3PT2 A;  1NL6 A;  3S3Q A;  2E02 A;  1GCB A; 
#chains in the Genus database with same CATH homology
 3OVX A;  4W5B A;  9PAP A;  1MEM A;  3IHP A;  4P6G A;  2AYO A;  4W4U A;  1BP4 A;  3KX1 A;  1CSB B;  4BGF A;  5JH3 A;  1PE6 A;  1ME3 A;  2Y6E A;  4NV7 A;  2XU4 A;  2DC6 A;  2YJ9 A;  3P5W A;  3MOR A;  5PAD A;  4C5P A;  5CHT A;  1PBH A;  4B55 A;  2AS8 A;  5JA7 A;  2AIM A;  1QXP A;  1GEC E;  1E2T A;  2HD5 A;  3OVZ A;  3CBJ A;  2AUZ A;  1F2B A;  2FTD A;  5EF4 A;  3USV A;  2E01 A;  4FIP A;  2XU3 A;  1F2C A;  4YYS A;  2DCC A;  1ICF A;  4QRV A;  3AI8 A;  4QH6 A;  1TLO A;  2Y5B A;  2R9M A;  4YYQ A;  2NQI A;  2R9N A;  3CH3 X;  4ZUX U;  3K8U A;  2FO5 A;  3BPF A;  6PAD A;  2FUD A;  2ARY A;  1NQC A;  3KKU A;  2VHF A;  3HWN A;  3F5V A;  3GCB A;  2NQA A;  4G54 A;  2E00 A;  1NB5 A;  1AU0 A;  8PCH A;  2DZY A;  2OZ2 A;  3BC3 A;  2FQ9 A;  1NPZ A;  3K9M A;  3KWB X;  4X6J A;  3S3R A;  5J94 A;  4YYV A;  3CH2 X;  3KWZ A;  4K7C A;  3BOW A;  2VFB A;  3QT4 A;  1PPD A;  2DC9 A;  3V6E A;  1BQI A;  1PAD A;  2FT2 A;  1PXV A;  2P0R A;  3KFQ A;  1A6R A;  2AVW A;  2XU5 A;  1EWM A;  5A24 A;  3H8B A;  3LFY A;  1K3B B;  3H6S A;  2BDZ A;  2HH5 A;  4QRX A;  2DCA A;  1ZCM A;  3PDF A;  1STF E;  5CHV A;  5CVM A;  1U9V A;  2PRE A;  1NLJ A;  4I05 A;  4NV8 A;  1Y08 A;  1KHQ A;  3MHS A;  3OF9 A;  1U5I A;  4CDE B;  1W6F A;  1U9X A;  2P86 A;  2R6N A;  3PNR A;  4CDF B;  1U9Q X;  2DC7 A;  3O0U A;  3HD3 A;  4AXL A;  2G8E A;  4BQV A;  2G6D A;  2AYN A;  2CIO A;  1MEG A;  2PBH A;  1NB3 A;  4XUI A;  5F02 A;  4I07 A;  3LXS A;  2DCB A;  2B1M A;  3H89 A;  1W5R A;  2PNS A;  1KFU L;  3RVV A;  2AUX A;  1CJL A;  4I04 A;  2P7U A;  2HXZ A;  2WBF X;  2DZZ A;  3BWK A;  1GX3 A;  2YJC A;  2JQG R;  1GLO A;  2R9O A;  1KHP A;  4X6H A;  1PPP A;  1AIM A;  1JQP A;  4GUZ A;  1IWD A;  1YT7 A;  2ACT A;  3RVW A;  3D9W A;  1AU3 A;  1YVB A;  2F1G A;  2DJF B;  4YVA A;  1F2A A;  4YYU A;  3LTW A;  3NHE A;  1AEC A;  4P6E A;  4HWY A;  3KSE A;  3D6S A;  1ZIV A;  1AYW A;  4QBB A;  1VSN A;  1AYV A;  1CTE A;  3U8E A;  1BGO A;  2IPP B;  3QJ3 A;  3IOQ A;  1EWL A;  3N3K A;  1EWP A;  1DEU A;  1EF7 A;  4Q8H A;  4BS5 A;  3WXE A;  3C9E A;  4AXM A;  1PCI A;  4PI3 A;  4PAD A;  2FRQ A;  4KLB A;  3K24 A;  1PPO A;  2G8J A;  4FJC A;  3KW9 A;  3B79 A;  1EWO A;  2IBI A;  3ERV A;  2XU1 A;  7PCK A;  3E1Z B;  2PAD A;  3IV2 A;  3WXF A;  1PIP A;  3P5X A;  4N4Z A;  3CBK A;  1CQD A;  4DMY A;  1KFX L;  1TL9 A;  2OP3 A;  2R9C A;  3HHI A;  1YK7 A;  4N79 A;  3V6C A;  1MS6 A;  2AU1 A;  1CV8 A;  3TNX A;  1CPJ A;  2OUL A;  3N3G A;  4PP2 E;  4WA6 A;  3DF0 A;  1MDW A;  3MHH A;  4YYW A;  1GMY A;  1Q6K A;  1ME4 A;  1AYU A;  4CDC B;  2VHS A;  3IUT A;  2FYE A;  2NQG A;  3IMA A;  4CDD B;  3N4C A;  3HHA A;  1Y4H A;  5EGW A;  1CVZ A;  2VFC A;  4N8W A;  1ITO A;  4MZS A;  2YJB A;  3IEJ A;  4X6I A;  5FPW A;  2O6X A;  4DMX A;  1VJV A;  5CVN B;  5CVO B;  2DJG B;  4RY2 A;  1POP A;  2GHU A;  3H8C A;  4MZO A;  1KXR A;  4Q8G A;  3P5U A;  2FRA A;  1BY8 A;  3P5V A;  5K16 A;  3PW3 A;  1O0E A;  1SNK A;  1SP4 B;  4CZW A;  3I06 A;  2B1N A;  1XKG A;  3OF8 A;  4OEM A;  2G7Y A;  1PPN A;  1W4T A;  1QDQ A;  2GFO A;  1S4V A;  3ZUA A;  2E03 A;  4OEL A;  4BPV A;  1QOL A;  1F29 A;  4YYR A;  4BSQ A;  1THE A;  2H7J A;  2YJ2 A;  4W5C A;  1YAL A;  2R9F A;  1AU4 A;  2ATO A;  2CB5 A;  4MSX A;  3O1G A;  4PP1 A;  2F7D A;  3RVX A;  1QMY A;  4FK5 A;  2NQD B;  1MHW A;  2DC8 A;  2JQF R;  3BPM A;  4XR7 A;  3H7D A;  3BCN A;  1M6D A;  1ATK A;  1CS8 A;  3PBH A;  1YK8 A;  2DCD A;  2HHN A;  3M99 A;  1TU6 A;  2C0Y A;  1HUC B;  2YJ8 A;  3WXG A;  1CB5 A;  1X9Y A;  3MTN A;  2BSZ A;  4QRG A;  1MIR A;  3OIS A;  3F75 A;  1U9W A;  1FH0 A;  3QSD A;  3I3T A;  1DF0 A;  2BDL A;  4BS6 A;  4YV8 A;  1AU2 A;  1NL6 A;  3S3Q A;  2E02 A;  1GCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...