1IWDA

Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
LPSFVDWRSKGAVNSIKNQKQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLRVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERVATAMIN B
publication title Proposed amino acid sequence and the 1.63 A X-ray crystal structure of a plant cysteine protease, ervatamin B: Some insights into the structural basis of its stability and substrate specificity
pubmed doi rcsb
molecule tags Hydrolase
total genus 67
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1iwdA00
3HD3A 3F5VA 2Y6EA 4OEMA 2C0YA 2AUZA 2FUDA 3I06A 5EF4A 3P5UA 1K3BB 1CPJA 3WXFA 3ZUAA 1Q6KA 1AU4A 2F7DA 3MTNA 3S3RA 2DCDA 4MZSA 4X6JA 4PP1A 3V6EA 1NB3A 1AECA 5J94A 1SP4B 6PADA 1TLOA 2IBIA 1A6RA 1U5IA 2B1MA 3QSDA 4MZOA 1AU3A 2PBHA 3H8BA 3KSEA 1MHWA 4I04A 4XR7A 2G8EA 5K16A 3IEJA 1U9XA 1Y08A 2ATOA 3LFYA 3V6CA 1MS6A 4HWYA 3IOQA 2G8JA 2FO5A 3OISA 1S4VA 2DC7A 2AYNA 2YJ9A 3PBHA 1PPNA 2AUXA 1VJVA 3MORA 1KXRA 4CDDB 3NHEA 2JQFR 1NB5A 2XU4A 3U8EA 2BDLA 2NQGA 2DCCA 3BOWA 1YK8A 4QH6A 2HH5A 1PE6A 4X6HA 1JQPA 4QBBA 4W5CA 4RY2A 1BGOA 3DF0A 1PCIA 1Y4HA 4DMYA 1XKGA 1ICFA 1TU6A 2HXZA 3WXGA 4BQVA 2CIOA 1CVZA 3KWBX 1MEGA 1PADA 5A24A 3BWKA 4YV8A 2OZ2A 2P86A 3H6SA 2AIMA 2PREA 3WXEA 3OVZA 3P5WA 4X6IA 4OELA 2CB5A 2FQ9A 1AIMA 3B79A 1F2BA 1EWOA 4DMXA 1YK7A 3IV2A 3C9EA 5JH3A 1F29A 1BY8A 1F2CA 2E01A 3IUTA 3QJ3A 4W4UA 2ARYA 5JA7A 3RVXA 3BC3A 4I07A 1AU2A 4QRVA 4BPVA 3BCNA 2R9CA 3HWNA 3MHHA 4Q8GA 4MSXA 1KHQA 1PPOA 1QMYA 1ITOA 3K9MA 2DJGB 2OP3A 1AYWA 3I3TA 1KFUL 2HD5A 4FIPA 3BPMA 5CHTA 9PAPA 2E03A 3CH2X 1NL6A 3USVA 3N3GA 2ACTA 1CSBB 1CTEA 1PBHA 2P7UA 1GLOA 1HUCB 3N3KA 1ATKA 4KLBA 4YYVA 7PCKA 3F75A 3PW3A 3OF8A 4YYUA 4WA6A 2DC9A 3N4CA 2NQAA 2DC8A 2WBFX 2GHUA 5CVOB 3BPFA 4N8WA 2R9FA 1QOLA 1U9WA 4XUIA 1EWLA 3P5XA 5F02A 4YYWA 2DC6A 2NQDB 1POPA 2PADA 4QRGA 1GECE 2DZYA 1CV8A 1VSNA 3MHSA 2DCBA 3HHAA 2E02A 2VHFA 1NLJA 3LXSA 1M6DA 4FK5A 3P5VA 2OULA 4G54A 1CJLA 1ME3A 1QDQA 3GCBA 3KKUA 1U9VA 3CBKA 2E00A 4YYSA 3PDFA 5CHVA 4PI3A 3OF9A 4CDEB 2VHSA 4Q8HA 2DZZA 2F1GA 1DEUA 1AYVA 1PIPA 2BDZA 3OVXA 3KWZA 4CDCB 2AYOA 5CVNB 1QXPA 1EWPA 1PPDA 2XU1A 2AVWA 1CB5A 1CS8A 4YYQA 1ZCMA 4YVAA 4N79A 3HHIA 2PNSA 1F2AA 1ME4A 1GCBA 2YJ8A 2FRAA 2R6NA 2P0RA 3KW9A 3QT4A 1MDWA 3IMAA 3H8CA 2IPPB 3PNRA 4BS5A 2B1NA 1NPZA 1MEMA 1YVBA 4BS6A 2XU3A 1PPPA 2DJFB 3M99A 4AXMA 2FTDA 4P6GA 5EGWA 3ERVA 1U9QX 4ZUXU 3H89A 1ZIVA 3O1GA 2R9MA 1SNKA 3H7DA 4YYRA 1BQIA 3D6SA 3RVWA 3CH3X 3K8UA 4FJCA 1NQCA 1FH0A 2FRQA 2YJCA 3K24A 4I05A 5FPWA 1X9YA 1AYUA 3S3QA 4BSQA 1BP4A 3O0UA 4AXLA 2R9NA 3CBJA 1AU0A 1PXVA 2Y5BA 2G7YA 2HHNA 2AS8A 1KFXL 2AU1A 3RVVA 5CVMA 4K7CA 3KX1A 1O0EA 3AI8A 8PCHA 1STFE 1GMYA 1EF7A 4PADA 4N4ZA 1THEA 4CZWA 1YT7A 2G6DA 1YALA 3KFQA 1IWDA 2O6XA 3E1ZB 4W5BA 2NQIA 2YJ2A 2XU5A 2JQGR 3IHPA 2FYEA 2YJBA 1EWMA 4CDFB 2H7JA 1KHPA 2DCAA 4P6EA 2FT2A 1DF0A 4PP2E 4QRXA 5PADA 1TL9A 2GFOA 1MIRA 3TNXA 2R9OA 1CQDA
chains in the Genus database with same CATH superfamily
3HD3A 3F5VA 4D8EA 2Y6EA 4OEMA 2C0YA 2AUZA 2FUDA 3I06A 5EF4A 3P5UA 1K3BB 1CPJA 3WXFA 4OVZA 3ZUAA 1Q6KA 1AU4A 2F7DA 4MM3B 3MTNA 2FE8A 2JTCA 3S3RA 2DCDA 3E9SA 4MZSA 4X6JA 4PP1A 3V6EA 1NB3A 1AECA 5J94A 1SP4B 6PADA 1TLOA 2IBIA 1A6RA 1U5IA 2B1MA 3QSDA 5E6JA 4P16A 4MZOA 1AU3A 3O65A 2PBHA 3H8BA 3KSEA 4OW0A 1MHWA 4I04A 4XR7A 2G8EA 5K16A 3IEJA 4A5UA 1U9XA 1Y08A 2ATOA 3LFYA 3V6CA 1MS6A 4HWYA 3IOQA 2G8JA 2FO5A 3OISA 3B21A 1S4VA 2DC7A 2AYNA 2YJ9A 3MTVA 3PBHA 1PPNA 2AUXA 1VJVA 3MORA 1KXRA 4CDDB 3NHEA 2JQFR 1NB5A 4REZA 2XU4A 3U8EA 2BDLA 2NQGA 2DCCA 3BOWA 1PVJA 3W31A 1YK8A 4QH6A 2HH5A 1PE6A 4X6HA 1JQPA 4QBBA 4W5CA 4RY2A 3ZNHA 1BGOA 3DF0A 1PCIA 1Y4HA 4DMYA 1XKGA 1ICFA 1TU6A 2HXZA 3WXGA 4BQVA 2CIOA 1CVZA 3KWBX 1MEGA 1PADA 5A24A 3BWKA 4XZXA 4MI7A 4YV8A 2OZ2A 2P86A 3H6SA 5KO3A 3PT2A 2AIMA 2PREA 3WXEA 3OVZA 3P5WA 4X6IA 4OELA 2CB5A 2FQ9A 1AIMA 3B79A 1F2BA 1EWOA 4DMXA 1YK7A 2BU3A 3IV2A 3PHXA 2AGAA 3C9EA 3MP2A 5JH3A 1F29A 3W30A 1BY8A 1F2CA 2E01A 3IUTA 3QJ3A 4W4UA 2ARYA 5JA7A 3RVXA 3BC3A 4I07A 1AU2A 4QRVA 4BPVA 3BCNA 2R9CA 3HWNA 3MHHA 4Q8GA 4MSXA 1KHQA 1PPOA 2Z84A 1QMYA 1ITOA 3K9MA 2DJGB 2OP3A 1AYWA 3I3TA 1KFUL 2HD5A 4FIPA 3BPMA 5CHTA 4RF0A 9PAPA 2E03A 3CH2X 1NL6A 3USVA 3PHUA 3N3GA 2JRIA 2BTWB 4BOQA 2ACTA 1CSBB 4RF1A 1CTEA 1PBHA 2P7UA 1GLOA 4BOZA 1HUCB 3N3KA 1ATKA 1YZBA 4KLBA 4YYVA 7PCKA 3F75A 3PW3A 4BOPA 3OF8A 4YYUA 4WA6A 2DC9A 3N4CA 2NQAA 2DC8A 2WBFX 2GHUA 5CVOB 3BPFA 4N8WA 2R9FA 1QOLA 1U9WA 4XUIA 1EWLA 2UZJA 3P5XA 5F02A 4YYWA 2DC6A 3TRKA 2NQDB 1POPA 3PHWA 5EZSA 2PADA 4QRGA 1GECE 3PSEA 4IP3A 2DZYA 1CV8A 1VSNA 3MHSA 4GUAA 2DCBA 3HHAA 2E02A 2VHFA 3MJ5A 1NLJA 3LXSA 1M6DA 4FK5A 3P5VA 2OULA 4G54A 2J7QA 1CJLA 1ME3A 1QDQA 3GCBA 3KKUA 1U9VA 3CBKA 2E00A 4YYSA 3PDFA 5CHVA 4PI3A 3OF9A 4CDEB 2VHSA 4RKXA 4Q8HA 2DZZA 2F1GA 1DEUA 1AYVA 1PIPA 4ZTBA 5EZQA 2BDZA 3OVXA 3KWZA 4CDCB 2AYOA 5CVNB 1QXPA 1EWPA 1PPDA 2J7QC 2XU1A 2AVWA 1CB5A 1CS8A 4YYQA 1ZCMA 4YVAA 2HWKA 4N79A 3HHIA 2PNSA 1F2AA 1ME4A 3RNVA 1GCBA 2YJ8A 2FRAA 2R6NA 2P0RA 3KW9A 3QT4A 4M0WA 1MDWA 3IMAA 3H8CA 2IPPB 3PNRA 4BS5A 2B1NA 1NPZA 1MEMA 1YVBA 4BS6A 2XU3A 1PPPA 2DJFB 3M99A 1DKIA 3BY4A 4AXMA 2FTDA 4PT5A 4IUMA 4P6GA 5EGWA 4D8IA 3ERVA 1U9QX 4ZUXU 3H89A 1ZIVA 3O1GA 4WURA 2R9MA 3C0RA 2DOSA 1SNKA 3H7DA 4YYRA 1BQIA 3D6SA 3RVWA 3CH3X 3K8UA 4FJCA 1NQCA 1FH0A 2FRQA 2YJCA 3K24A 4I05A 5FPWA 5JZEA 1X9YA 1AYUA 3S3QA 4BSQA 1BP4A 3O0UA 4AXLA 2R9NA 3CBJA 1AU0A 1PXVA 3PRMA 2Y5BA 2G7YA 1UKFA 2HHNA 2AS8A 1KFXL 2AU1A 3RVVA 5CVMA 4K7CA 3KX1A 4BOSA 1O0EA 4OVZB 3OQCA 3TMPA 3AI8A 8PCHA 1STFE 2BTWA 4HXDB 1GMYA 1EF7A 3BB7A 4PADA 4N4ZA 1THEA 4CZWA 4D8BA 3PRPA 1YT7A 2G6DA 1YALA 3KFQA 3E1ZB 1IWDA 2O6XA 4W5BA 2NQIA 2YJ2A 3BBAA 4RNAA 2XU5A 2JQGR 3IHPA 2FYEA 2YJBA 1EWMA 4CDFB 3IFUA 4R3DA 2H7JA 1KHPA 2DCAA 4P6EA 2FT2A 1DF0A 4PP2E 4BOUA 4QRXA 5PADA 1TL9A 2GFOA 1MIRA 3TNXA 2R9OA 1CQDA
chains in the Genus database with same CATH topology
3HD3A 3F5VA 2Y6EA 4OEMA 2C0YA 2AUZA 2FUDA 3I06A 5EF4A 3P5UA 1K3BB 1CPJA 3WXFA 3ZUAA 1Q6KA 1AU4A 2F7DA 3MTNA 3S3RA 2DCDA 4MZSA 4X6JA 4PP1A 4C5PA 3V6EA 1NB3A 1AECA 5J94A 1SP4B 6PADA 1TLOA 2IBIA 1A6RA 1U5IA 2B1MA 3QSDA 4MZOA 1AU3A 2PBHA 3H8BA 3KSEA 1MHWA 4I04A 4XR7A 2G8EA 5K16A 3IEJA 1U9XA 1Y08A 2ATOA 3LFYA 3V6CA 1MS6A 1W4TA 4HWYA 3IOQA 4B55A 2G8JA 2FO5A 1GX3A 3OISA 1S4VA 2DC7A 2AYNA 2YJ9A 3PBHA 1PPNA 2AUXA 1VJVA 3MORA 1KXRA 4CDDB 3NHEA 2JQFR 1NB5A 2XU4A 3U8EA 2BDLA 2NQGA 2DCCA 3BOWA 1YK8A 4QH6A 2HH5A 1PE6A 4X6HA 1JQPA 4QBBA 4W5CA 4RY2A 1BGOA 3DF0A 1PCIA 1Y4HA 4DMYA 1XKGA 1ICFA 1TU6A 2HXZA 3WXGA 4BQVA 2CIOA 1CVZA 3KWBX 1MEGA 1PADA 5A24A 3BWKA 4YV8A 2OZ2A 2P86A 3H6SA 2AIMA 2PREA 3WXEA 3OVZA 3P5WA 4X6IA 1W6FA 4OELA 2CB5A 2FQ9A 1AIMA 3B79A 1F2BA 1EWOA 4DMXA 1YK7A 3IV2A 3C9EA 5JH3A 1F29A 1BY8A 1F2CA 2E01A 3IUTA 3QJ3A 3D9WA 4W4UA 2ARYA 5JA7A 3RVXA 3BC3A 4I07A 1AU2A 4QRVA 4BPVA 3BCNA 2R9CA 3HWNA 3MHHA 4Q8GA 4MSXA 1KHQA 1PPOA 1QMYA 1ITOA 3K9MA 2DJGB 2OP3A 1AYWA 3I3TA 1KFUL 2HD5A 4FIPA 3BPMA 5CHTA 9PAPA 2E03A 2VFBA 3CH2X 1NL6A 3USVA 3N3GA 2ACTA 1CSBB 1CTEA 1PBHA 2P7UA 1GLOA 1HUCB 3N3KA 1ATKA 4KLBA 4YYVA 7PCKA 3F75A 3PW3A 3OF8A 4NV7A 4YYUA 4WA6A 2DC9A 3N4CA 2NQAA 2DC8A 2WBFX 2GHUA 5CVOB 3BPFA 4N8WA 2R9FA 1QOLA 1U9WA 4XUIA 1EWLA 3P5XA 5F02A 4YYWA 2DC6A 2NQDB 1POPA 2PADA 4QRGA 1GECE 4BGFA 2DZYA 1CV8A 1VSNA 3MHSA 2DCBA 3HHAA 2E02A 2VHFA 1NLJA 3LXSA 1M6DA 4FK5A 3P5VA 2OULA 4G54A 1CJLA 1ME3A 1QDQA 3GCBA 3KKUA 1U9VA 3CBKA 2E00A 4YYSA 3PDFA 5CHVA 4PI3A 3OF9A 4CDEB 2VHSA 4Q8HA 2DZZA 2F1GA 1DEUA 1AYVA 1PIPA 2BDZA 3OVXA 3KWZA 4CDCB 1W5RA 2AYOA 5CVNB 1QXPA 1EWPA 4NV8A 1PPDA 2XU1A 2AVWA 1CB5A 1CS8A 4YYQA 1ZCMA 4YVAA 4N79A 3HHIA 2PNSA 1F2AA 1ME4A 3LTWA 2BSZA 1GCBA 2YJ8A 2FRAA 2R6NA 2P0RA 3KW9A 3QT4A 1MDWA 3IMAA 3H8CA 1E2TA 2IPPB 3PNRA 4BS5A 2B1NA 1NPZA 1MEMA 1YVBA 4BS6A 2XU3A 1PPPA 2DJFB 3M99A 4AXMA 2FTDA 4P6GA 5EGWA 3ERVA 1U9QX 4ZUXU 3H89A 1ZIVA 3O1GA 2R9MA 1SNKA 3H7DA 4YYRA 1BQIA 3D6SA 3RVWA 3CH3X 3K8UA 4GUZA 4FJCA 1NQCA 1FH0A 2FRQA 2YJCA 3K24A 4I05A 5FPWA 1X9YA 1AYUA 3S3QA 4BSQA 1BP4A 3O0UA 4AXLA 2R9NA 3CBJA 1AU0A 1PXVA 2Y5BA 2G7YA 2HHNA 2AS8A 1KFXL 2AU1A 3RVVA 5CVMA 4K7CA 3KX1A 1O0EA 3AI8A 8PCHA 1STFE 1GMYA 1EF7A 2VFCA 4PADA 4N4ZA 1THEA 4CZWA 1YT7A 2G6DA 1YALA 3KFQA 1IWDA 2O6XA 3E1ZB 4W5BA 2NQIA 2YJ2A 2XU5A 2JQGR 3IHPA 2FYEA 2YJBA 1EWMA 4CDFB 2H7JA 1KHPA 2DCAA 4P6EA 2FT2A 1DF0A 4PP2E 4QRXA 5PADA 1TL9A 2GFOA 1MIRA 3TNXA 2R9OA 1CQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD3 A;  3F5V A;  2Y6E A;  4OEM A;  2C0Y A;  2AUZ A;  2FUD A;  3I06 A;  5EF4 A;  3P5U A;  1K3B B;  1CPJ A;  3WXF A;  3ZUA A;  1Q6K A;  1AU4 A;  2F7D A;  3MTN A;  3S3R A;  2DCD A;  4MZS A;  4X6J A;  4PP1 A;  3V6E A;  1NB3 A;  1AEC A;  5J94 A;  1SP4 B;  6PAD A;  1TLO A;  2IBI A;  1A6R A;  1U5I A;  2B1M A;  3QSD A;  4MZO A;  1AU3 A;  2PBH A;  3H8B A;  3KSE A;  1MHW A;  4I04 A;  4XR7 A;  2G8E A;  5K16 A;  3IEJ A;  1U9X A;  1Y08 A;  2ATO A;  3LFY A;  3V6C A;  1MS6 A;  4HWY A;  3IOQ A;  2G8J A;  2FO5 A;  3OIS A;  1S4V A;  2DC7 A;  2AYN A;  2YJ9 A;  3PBH A;  1PPN A;  2AUX A;  1VJV A;  3MOR A;  1KXR A;  4CDD B;  3NHE A;  2JQF R;  1NB5 A;  2XU4 A;  3U8E A;  2BDL A;  2NQG A;  2DCC A;  3BOW A;  1YK8 A;  4QH6 A;  2HH5 A;  1PE6 A;  4X6H A;  1JQP A;  4QBB A;  4W5C A;  4RY2 A;  1BGO A;  3DF0 A;  1PCI A;  1Y4H A;  4DMY A;  1XKG A;  1ICF A;  1TU6 A;  2HXZ A;  3WXG A;  4BQV A;  2CIO A;  1CVZ A;  3KWB X;  1MEG A;  1PAD A;  5A24 A;  3BWK A;  4YV8 A;  2OZ2 A;  2P86 A;  3H6S A;  2AIM A;  2PRE A;  3WXE A;  3OVZ A;  3P5W A;  4X6I A;  4OEL A;  2CB5 A;  2FQ9 A;  1AIM A;  3B79 A;  1F2B A;  1EWO A;  4DMX A;  1YK7 A;  3IV2 A;  3C9E A;  5JH3 A;  1F29 A;  1BY8 A;  1F2C A;  2E01 A;  3IUT A;  3QJ3 A;  4W4U A;  2ARY A;  5JA7 A;  3RVX A;  3BC3 A;  4I07 A;  1AU2 A;  4QRV A;  4BPV A;  3BCN A;  2R9C A;  3HWN A;  3MHH A;  4Q8G A;  4MSX A;  1KHQ A;  1PPO A;  1QMY A;  1ITO A;  3K9M A;  2DJG B;  2OP3 A;  1AYW A;  3I3T A;  1KFU L;  2HD5 A;  4FIP A;  3BPM A;  5CHT A;  9PAP A;  2E03 A;  3CH2 X;  1NL6 A;  3USV A;  3N3G A;  2ACT A;  1CSB B;  1CTE A;  1PBH A;  2P7U A;  1GLO A;  1HUC B;  3N3K A;  1ATK A;  4KLB A;  4YYV A;  7PCK A;  3F75 A;  3PW3 A;  3OF8 A;  4YYU A;  4WA6 A;  2DC9 A;  3N4C A;  2NQA A;  2DC8 A;  2WBF X;  2GHU A;  5CVO B;  3BPF A;  4N8W A;  2R9F A;  1QOL A;  1U9W A;  4XUI A;  1EWL A;  3P5X A;  5F02 A;  4YYW A;  2DC6 A;  2NQD B;  1POP A;  2PAD A;  4QRG A;  1GEC E;  2DZY A;  1CV8 A;  1VSN A;  3MHS A;  2DCB A;  3HHA A;  2E02 A;  2VHF A;  1NLJ A;  3LXS A;  1M6D A;  4FK5 A;  3P5V A;  2OUL A;  4G54 A;  1CJL A;  1ME3 A;  1QDQ A;  3GCB A;  3KKU A;  1U9V A;  3CBK A;  2E00 A;  4YYS A;  3PDF A;  5CHV A;  4PI3 A;  3OF9 A;  4CDE B;  2VHS A;  4Q8H A;  2DZZ A;  2F1G A;  1DEU A;  1AYV A;  1PIP A;  2BDZ A;  3OVX A;  3KWZ A;  4CDC B;  2AYO A;  5CVN B;  1QXP A;  1EWP A;  1PPD A;  2XU1 A;  2AVW A;  1CB5 A;  1CS8 A;  4YYQ A;  1ZCM A;  4YVA A;  4N79 A;  3HHI A;  2PNS A;  1F2A A;  1ME4 A;  1GCB A;  2YJ8 A;  2FRA A;  2R6N A;  2P0R A;  3KW9 A;  3QT4 A;  1MDW A;  3IMA A;  3H8C A;  2IPP B;  3PNR A;  4BS5 A;  2B1N A;  1NPZ A;  1MEM A;  1YVB A;  4BS6 A;  2XU3 A;  1PPP A;  2DJF B;  3M99 A;  4AXM A;  2FTD A;  4P6G A;  5EGW A;  3ERV A;  1U9Q X;  4ZUX U;  3H89 A;  1ZIV A;  3O1G A;  2R9M A;  1SNK A;  3H7D A;  4YYR A;  1BQI A;  3D6S A;  3RVW A;  3CH3 X;  3K8U A;  4FJC A;  1NQC A;  1FH0 A;  2FRQ A;  2YJC A;  3K24 A;  4I05 A;  5FPW A;  1X9Y A;  1AYU A;  3S3Q A;  4BSQ A;  1BP4 A;  3O0U A;  4AXL A;  2R9N A;  3CBJ A;  1AU0 A;  1PXV A;  2Y5B A;  2G7Y A;  2HHN A;  2AS8 A;  1KFX L;  2AU1 A;  3RVV A;  5CVM A;  4K7C A;  3KX1 A;  1O0E A;  3AI8 A;  8PCH A;  1STF E;  1GMY A;  1EF7 A;  4PAD A;  4N4Z A;  1THE A;  4CZW A;  1YT7 A;  2G6D A;  1YAL A;  3KFQ A;  1IWD A;  2O6X A;  3E1Z B;  4W5B A;  2NQI A;  2YJ2 A;  2XU5 A;  2JQG R;  3IHP A;  2FYE A;  2YJB A;  1EWM A;  4CDF B;  2H7J A;  1KHP A;  2DCA A;  4P6E A;  2FT2 A;  1DF0 A;  4PP2 E;  4QRX A;  5PAD A;  1TL9 A;  2GFO A;  1MIR A;  3TNX A;  2R9O A;  1CQD A; 
#chains in the Genus database with same CATH topology
 3HD3 A;  3F5V A;  4D8E A;  2Y6E A;  4OEM A;  2C0Y A;  2AUZ A;  2FUD A;  3I06 A;  5EF4 A;  3P5U A;  1K3B B;  1CPJ A;  3WXF A;  4OVZ A;  3ZUA A;  1Q6K A;  1AU4 A;  2F7D A;  4MM3 B;  3MTN A;  2FE8 A;  2JTC A;  3S3R A;  2DCD A;  3E9S A;  4MZS A;  4X6J A;  4PP1 A;  3V6E A;  1NB3 A;  1AEC A;  5J94 A;  1SP4 B;  6PAD A;  1TLO A;  2IBI A;  1A6R A;  1U5I A;  2B1M A;  3QSD A;  5E6J A;  4P16 A;  4MZO A;  1AU3 A;  3O65 A;  2PBH A;  3H8B A;  3KSE A;  4OW0 A;  1MHW A;  4I04 A;  4XR7 A;  2G8E A;  5K16 A;  3IEJ A;  4A5U A;  1U9X A;  1Y08 A;  2ATO A;  3LFY A;  3V6C A;  1MS6 A;  4HWY A;  3IOQ A;  2G8J A;  2FO5 A;  3OIS A;  3B21 A;  1S4V A;  2DC7 A;  2AYN A;  2YJ9 A;  3MTV A;  3PBH A;  1PPN A;  2AUX A;  1VJV A;  3MOR A;  1KXR A;  4CDD B;  3NHE A;  2JQF R;  1NB5 A;  4REZ A;  2XU4 A;  3U8E A;  2BDL A;  2NQG A;  2DCC A;  3BOW A;  1PVJ A;  3W31 A;  1YK8 A;  4QH6 A;  2HH5 A;  1PE6 A;  4X6H A;  1JQP A;  4QBB A;  4W5C A;  4RY2 A;  3ZNH A;  1BGO A;  3DF0 A;  1PCI A;  1Y4H A;  4DMY A;  1XKG A;  1ICF A;  1TU6 A;  2HXZ A;  3WXG A;  4BQV A;  2CIO A;  1CVZ A;  3KWB X;  1MEG A;  1PAD A;  5A24 A;  3BWK A;  4XZX A;  4MI7 A;  4YV8 A;  2OZ2 A;  2P86 A;  3H6S A;  5KO3 A;  3PT2 A;  2AIM A;  2PRE A;  3WXE A;  3OVZ A;  3P5W A;  4X6I A;  4OEL A;  2CB5 A;  2FQ9 A;  1AIM A;  3B79 A;  1F2B A;  1EWO A;  4DMX A;  1YK7 A;  2BU3 A;  3IV2 A;  3PHX A;  2AGA A;  3C9E A;  3MP2 A;  5JH3 A;  1F29 A;  3W30 A;  1BY8 A;  1F2C A;  2E01 A;  3IUT A;  3QJ3 A;  4W4U A;  2ARY A;  5JA7 A;  3RVX A;  3BC3 A;  4I07 A;  1AU2 A;  4QRV A;  4BPV A;  3BCN A;  2R9C A;  3HWN A;  3MHH A;  4Q8G A;  4MSX A;  1KHQ A;  1PPO A;  2Z84 A;  1QMY A;  1ITO A;  3K9M A;  2DJG B;  2OP3 A;  1AYW A;  3I3T A;  1KFU L;  2HD5 A;  4FIP A;  3BPM A;  5CHT A;  4RF0 A;  9PAP A;  2E03 A;  3CH2 X;  1NL6 A;  3USV A;  3PHU A;  3N3G A;  2JRI A;  2BTW B;  4BOQ A;  2ACT A;  1CSB B;  4RF1 A;  1CTE A;  1PBH A;  2P7U A;  1GLO A;  4BOZ A;  1HUC B;  3N3K A;  1ATK A;  1YZB A;  4KLB A;  4YYV A;  7PCK A;  3F75 A;  3PW3 A;  4BOP A;  3OF8 A;  4YYU A;  4WA6 A;  2DC9 A;  3N4C A;  2NQA A;  2DC8 A;  2WBF X;  2GHU A;  5CVO B;  3BPF A;  4N8W A;  2R9F A;  1QOL A;  1U9W A;  4XUI A;  1EWL A;  2UZJ A;  3P5X A;  5F02 A;  4YYW A;  2DC6 A;  3TRK A;  2NQD B;  1POP A;  3PHW A;  5EZS A;  2PAD A;  4QRG A;  1GEC E;  3PSE A;  4IP3 A;  2DZY A;  1CV8 A;  1VSN A;  3MHS A;  4GUA A;  2DCB A;  3HHA A;  2E02 A;  2VHF A;  3MJ5 A;  1NLJ A;  3LXS A;  1M6D A;  4FK5 A;  3P5V A;  2OUL A;  4G54 A;  2J7Q A;  1CJL A;  1ME3 A;  1QDQ A;  3GCB A;  3KKU A;  1U9V A;  3CBK A;  2E00 A;  4YYS A;  3PDF A;  5CHV A;  4PI3 A;  3OF9 A;  4CDE B;  2VHS A;  4RKX A;  4Q8H A;  2DZZ A;  2F1G A;  1DEU A;  1AYV A;  1PIP A;  4ZTB A;  5EZQ A;  2BDZ A;  3OVX A;  3KWZ A;  4CDC B;  2AYO A;  5CVN B;  1QXP A;  1EWP A;  1PPD A;  2J7Q C;  2XU1 A;  2AVW A;  1CB5 A;  1CS8 A;  4YYQ A;  1ZCM A;  4YVA A;  2HWK A;  4N79 A;  3HHI A;  2PNS A;  1F2A A;  1ME4 A;  3RNV A;  1GCB A;  2YJ8 A;  2FRA A;  2R6N A;  2P0R A;  3KW9 A;  3QT4 A;  4M0W A;  1MDW A;  3IMA A;  3H8C A;  2IPP B;  3PNR A;  4BS5 A;  2B1N A;  1NPZ A;  1MEM A;  1YVB A;  4BS6 A;  2XU3 A;  1PPP A;  2DJF B;  3M99 A;  1DKI A;  3BY4 A;  4AXM A;  2FTD A;  4PT5 A;  4IUM A;  4P6G A;  5EGW A;  4D8I A;  3ERV A;  1U9Q X;  4ZUX U;  3H89 A;  1ZIV A;  3O1G A;  4WUR A;  2R9M A;  3C0R A;  2DOS A;  1SNK A;  3H7D A;  4YYR A;  1BQI A;  3D6S A;  3RVW A;  3CH3 X;  3K8U A;  4FJC A;  1NQC A;  1FH0 A;  2FRQ A;  2YJC A;  3K24 A;  4I05 A;  5FPW A;  5JZE A;  1X9Y A;  1AYU A;  3S3Q A;  4BSQ A;  1BP4 A;  3O0U A;  4AXL A;  2R9N A;  3CBJ A;  1AU0 A;  1PXV A;  3PRM A;  2Y5B A;  2G7Y A;  1UKF A;  2HHN A;  2AS8 A;  1KFX L;  2AU1 A;  3RVV A;  5CVM A;  4K7C A;  3KX1 A;  4BOS A;  1O0E A;  4OVZ B;  3OQC A;  3TMP A;  3AI8 A;  8PCH A;  1STF E;  2BTW A;  4HXD B;  1GMY A;  1EF7 A;  3BB7 A;  4PAD A;  4N4Z A;  1THE A;  4CZW A;  4D8B A;  3PRP A;  1YT7 A;  2G6D A;  1YAL A;  3KFQ A;  3E1Z B;  1IWD A;  2O6X A;  4W5B A;  2NQI A;  2YJ2 A;  3BBA A;  4RNA A;  2XU5 A;  2JQG R;  3IHP A;  2FYE A;  2YJB A;  1EWM A;  4CDF B;  3IFU A;  4R3D A;  2H7J A;  1KHP A;  2DCA A;  4P6E A;  2FT2 A;  1DF0 A;  4PP2 E;  4BOU A;  4QRX A;  5PAD A;  1TL9 A;  2GFO A;  1MIR A;  3TNX A;  2R9O A;  1CQD A; 
#chains in the Genus database with same CATH homology
 3HD3 A;  3F5V A;  2Y6E A;  4OEM A;  2C0Y A;  2AUZ A;  2FUD A;  3I06 A;  5EF4 A;  3P5U A;  1K3B B;  1CPJ A;  3WXF A;  3ZUA A;  1Q6K A;  1AU4 A;  2F7D A;  3MTN A;  3S3R A;  2DCD A;  4MZS A;  4X6J A;  4PP1 A;  4C5P A;  3V6E A;  1NB3 A;  1AEC A;  5J94 A;  1SP4 B;  6PAD A;  1TLO A;  2IBI A;  1A6R A;  1U5I A;  2B1M A;  3QSD A;  4MZO A;  1AU3 A;  2PBH A;  3H8B A;  3KSE A;  1MHW A;  4I04 A;  4XR7 A;  2G8E A;  5K16 A;  3IEJ A;  1U9X A;  1Y08 A;  2ATO A;  3LFY A;  3V6C A;  1MS6 A;  1W4T A;  4HWY A;  3IOQ A;  4B55 A;  2G8J A;  2FO5 A;  1GX3 A;  3OIS A;  1S4V A;  2DC7 A;  2AYN A;  2YJ9 A;  3PBH A;  1PPN A;  2AUX A;  1VJV A;  3MOR A;  1KXR A;  4CDD B;  3NHE A;  2JQF R;  1NB5 A;  2XU4 A;  3U8E A;  2BDL A;  2NQG A;  2DCC A;  3BOW A;  1YK8 A;  4QH6 A;  2HH5 A;  1PE6 A;  4X6H A;  1JQP A;  4QBB A;  4W5C A;  4RY2 A;  1BGO A;  3DF0 A;  1PCI A;  1Y4H A;  4DMY A;  1XKG A;  1ICF A;  1TU6 A;  2HXZ A;  3WXG A;  4BQV A;  2CIO A;  1CVZ A;  3KWB X;  1MEG A;  1PAD A;  5A24 A;  3BWK A;  4YV8 A;  2OZ2 A;  2P86 A;  3H6S A;  2AIM A;  2PRE A;  3WXE A;  3OVZ A;  3P5W A;  4X6I A;  1W6F A;  4OEL A;  2CB5 A;  2FQ9 A;  1AIM A;  3B79 A;  1F2B A;  1EWO A;  4DMX A;  1YK7 A;  3IV2 A;  3C9E A;  5JH3 A;  1F29 A;  1BY8 A;  1F2C A;  2E01 A;  3IUT A;  3QJ3 A;  3D9W A;  4W4U A;  2ARY A;  5JA7 A;  3RVX A;  3BC3 A;  4I07 A;  1AU2 A;  4QRV A;  4BPV A;  3BCN A;  2R9C A;  3HWN A;  3MHH A;  4Q8G A;  4MSX A;  1KHQ A;  1PPO A;  1QMY A;  1ITO A;  3K9M A;  2DJG B;  2OP3 A;  1AYW A;  3I3T A;  1KFU L;  2HD5 A;  4FIP A;  3BPM A;  5CHT A;  9PAP A;  2E03 A;  2VFB A;  3CH2 X;  1NL6 A;  3USV A;  3N3G A;  2ACT A;  1CSB B;  1CTE A;  1PBH A;  2P7U A;  1GLO A;  1HUC B;  3N3K A;  1ATK A;  4KLB A;  4YYV A;  7PCK A;  3F75 A;  3PW3 A;  3OF8 A;  4NV7 A;  4YYU A;  4WA6 A;  2DC9 A;  3N4C A;  2NQA A;  2DC8 A;  2WBF X;  2GHU A;  5CVO B;  3BPF A;  4N8W A;  2R9F A;  1QOL A;  1U9W A;  4XUI A;  1EWL A;  3P5X A;  5F02 A;  4YYW A;  2DC6 A;  2NQD B;  1POP A;  2PAD A;  4QRG A;  1GEC E;  4BGF A;  2DZY A;  1CV8 A;  1VSN A;  3MHS A;  2DCB A;  3HHA A;  2E02 A;  2VHF A;  1NLJ A;  3LXS A;  1M6D A;  4FK5 A;  3P5V A;  2OUL A;  4G54 A;  1CJL A;  1ME3 A;  1QDQ A;  3GCB A;  3KKU A;  1U9V A;  3CBK A;  2E00 A;  4YYS A;  3PDF A;  5CHV A;  4PI3 A;  3OF9 A;  4CDE B;  2VHS A;  4Q8H A;  2DZZ A;  2F1G A;  1DEU A;  1AYV A;  1PIP A;  2BDZ A;  3OVX A;  3KWZ A;  4CDC B;  1W5R A;  2AYO A;  5CVN B;  1QXP A;  1EWP A;  4NV8 A;  1PPD A;  2XU1 A;  2AVW A;  1CB5 A;  1CS8 A;  4YYQ A;  1ZCM A;  4YVA A;  4N79 A;  3HHI A;  2PNS A;  1F2A A;  1ME4 A;  3LTW A;  2BSZ A;  1GCB A;  2YJ8 A;  2FRA A;  2R6N A;  2P0R A;  3KW9 A;  3QT4 A;  1MDW A;  3IMA A;  3H8C A;  1E2T A;  2IPP B;  3PNR A;  4BS5 A;  2B1N A;  1NPZ A;  1MEM A;  1YVB A;  4BS6 A;  2XU3 A;  1PPP A;  2DJF B;  3M99 A;  4AXM A;  2FTD A;  4P6G A;  5EGW A;  3ERV A;  1U9Q X;  4ZUX U;  3H89 A;  1ZIV A;  3O1G A;  2R9M A;  1SNK A;  3H7D A;  4YYR A;  1BQI A;  3D6S A;  3RVW A;  3CH3 X;  3K8U A;  4GUZ A;  4FJC A;  1NQC A;  1FH0 A;  2FRQ A;  2YJC A;  3K24 A;  4I05 A;  5FPW A;  1X9Y A;  1AYU A;  3S3Q A;  4BSQ A;  1BP4 A;  3O0U A;  4AXL A;  2R9N A;  3CBJ A;  1AU0 A;  1PXV A;  2Y5B A;  2G7Y A;  2HHN A;  2AS8 A;  1KFX L;  2AU1 A;  3RVV A;  5CVM A;  4K7C A;  3KX1 A;  1O0E A;  3AI8 A;  8PCH A;  1STF E;  1GMY A;  1EF7 A;  2VFC A;  4PAD A;  4N4Z A;  1THE A;  4CZW A;  1YT7 A;  2G6D A;  1YAL A;  3KFQ A;  1IWD A;  2O6X A;  3E1Z B;  4W5B A;  2NQI A;  2YJ2 A;  2XU5 A;  2JQG R;  3IHP A;  2FYE A;  2YJB A;  1EWM A;  4CDF B;  2H7J A;  1KHP A;  2DCA A;  4P6E A;  2FT2 A;  1DF0 A;  4PP2 E;  4QRX A;  5PAD A;  1TL9 A;  2GFO A;  1MIR A;  3TNX A;  2R9O A;  1CQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...