1IWDA

Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
LPSFVDWRSKGAVNSIKNQKQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLRVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proposed amino acid sequence and the 1.63 A X-ray crystal structure of a plant cysteine protease, ervatamin B: Some insights into the structural basis of its stability and substrate specificity
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ERVATAMIN B
total genus 67
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1iwdA00
1CV8A 2OP3A 3WXFA 4PP2E 3P5VA 8PCHA 3HHIA 4X6IA 1O0EA 4YYVA 2WBFX 3KX1A 3S3RA 1PIPA 1GCBA 2IBIA 3N3GA 2YJ9A 4AXLA 3RVVA 4FK5A 3GCBA 4QH6A 1CVZA 1BQIA 1ZIVA 4WA6A 4N4ZA 1F29A 4W5BA 2AVWA 5CVOB 4AXMA 1AYUA 1F2BA 2FT2A 3H7DA 2HHNA 1PADA 4I07A 1YK7A 3CBJA 3H89A 4MZSA 1PCIA 2ATOA 3WXEA 3TNXA 2G6DA 4CDFB 3RVWA 3MHHA 4PP1A 4FJCA 1VSNA 4BSQA 3HWNA 1F2AA 4YV8A 4Q8HA 1PPDA 1Y4HA 3ERVA 1KHPA 5EGWA 1YK8A 1F2CA 2Y5BA 1PPNA 3K24A 2AYOA 1YALA 4CDCB 3N4CA 5K16A 3QJ3A 9PAPA 1QXPA 5F02A 3F5VA 3S3QA 2FTDA 2JQGR 3KSEA 4BS5A 4K7CA 1PPPA 3CBKA 1PPOA 2O6XA 1QMYA 2JQFR 2AYNA 4YYQA 1NL6A 2G8JA 3KKUA 2R9MA 4QRXA 4HWYA 2FO5A 4P6GA 2FUDA 1U9QX 3ZUAA 2YJ8A 1GECE 1KHQA 2DZZA 2R6NA 2C0YA 2F7DA 3P5XA 4I05A 4N8WA 1CB5A 3CH2X 3BCNA 1ICFA 3H8BA 2VHFA 3OF8A 4QRGA 4RY2A 4QBBA 1AYVA 1VJVA 3QSDA 1EF7A 3KWZA 1M6DA 1ME3A 2IPPB 2PREA 1SNKA 4YYRA 3KWBX 2DJGB 1AU3A 1PE6A 2YJCA 1BP4A 1NLJA 2XU4A 1QOLA 5JH3A 2FYEA 2AU1A 2AS8A 2DC9A 3OVZA 3DF0A 3CH3X 1EWMA 2DCAA 2DC6A 1U9WA 2G7YA 3HD3A 2ARYA 1QDQA 3IUTA 2FQ9A 1NB5A 2H7JA 3P5UA 1Q6KA 3NHEA 3O1GA 1CTEA 1PXVA 1MEMA 3PBHA 4YVAA 4CDDB 2E03A 5CHVA 2DJFB 2VHSA 2Y6EA 1U9XA 4YYSA 4I04A 1MEGA 1ZCMA 2DC7A 3M99A 2FRQA 5A24A 3WXGA 1CSBB 3USVA 7PCKA 4OELA 1AECA 1A6RA 2ACTA 3IHPA 3C9EA 1KFXL 2DCBA 3PDFA 4P6EA 3RVXA 4KLBA 4DMXA 5CVMA 1KXRA 5J94A 1KFUL 2GFOA 3F75A 2R9FA 1U9VA 3IMAA 4OEMA 1AYWA 1AU0A 1STFE 2E00A 2B1NA 2HXZA 2HD5A 4N79A 2CIOA 3MTNA 1CS8A 2P7UA 2YJ2A 4XUIA 4W5CA 2XU3A 4BPVA 2AUXA 2P86A 6PADA 1S4VA 2F1GA 3LFYA 1BY8A 3OF9A 3KFQA 4QRVA 1IWDA 1MS6A 3E1ZB 2AIMA 4X6HA 1JQPA 1TU6A 2B1MA 4PADA 3B79A 5JA7A 3O0UA 3BWKA 1CJLA 1MDWA 2BDZA 1K3BB 1NQCA 3IOQA 1MIRA 3MORA 1CPJA 2XU5A 2PADA 2R9OA 2BDLA 3H8CA 4W4UA 4XR7A 2P0RA 3H6SA 1Y08A 1THEA 1BGOA 3P5WA 3BPFA 5FPWA 4FIPA 1SP4B 1MHWA 4DMYA 3QT4A 2R9CA 1EWLA 3K9MA 4PI3A 2CB5A 3N3KA 3PW3A 2OULA 1YT7A 1NPZA 1ME4A 1CQDA 1AU4A 3D6SA 3BPMA 1DEUA 3IEJA 3V6EA 2DCDA 1XKGA 1AIMA 4G54A 2E02A 4BS6A 4MSXA 3LXSA 3KW9A 2AUZA 4YYWA 2E01A 2NQAA 2DCCA 1EWOA 1NB3A 2NQDB 3MHSA 2DZYA 2GHUA 2XU1A 4Q8GA 2PBHA 3U8EA 4CDEB 5PADA 1TLOA 1TL9A 5EF4A 3I3TA 3OISA 1U5IA 2NQIA 1YVBA 1ITOA 5CHTA 3IV2A 2G8EA 1FH0A 3AI8A 1ATKA 2PNSA 1DF0A 1GLOA 1HUCB 3PNRA 3BOWA 3OVXA 2FRAA 4YYUA 2DC8A 4ZUXU 4X6JA 3BC3A 2R9NA 1GMYA 3I06A 3K8UA 2OZ2A 1POPA 1X9YA 3HHAA 1PBHA 5CVNB 1AU2A 4MZOA 1EWPA 4CZWA 3V6CA 4BQVA 2YJBA 2HH5A 2NQGA
chains in the Genus database with same CATH superfamily
1CV8A 3PRPA 2OP3A 3BBAA 3WXFA 4PP2E 3P5VA 8PCHA 3HHIA 4X6IA 1O0EA 4YYVA 2WBFX 3IFUA 3KX1A 3S3RA 1PIPA 4OVZA 1UKFA 1GCBA 2IBIA 3N3GA 4RF1A 2YJ9A 4AXLA 4D8IA 3RVVA 4FK5A 3GCBA 4QH6A 1CVZA 1BQIA 1ZIVA 4WA6A 4N4ZA 1F29A 4W5BA 4BOSA 2AVWA 5CVOB 4AXMA 1AYUA 1F2BA 2FT2A 3H7DA 2HHNA 1PADA 4I07A 1YK7A 3CBJA 3H89A 4MZSA 1PCIA 2ATOA 3WXEA 2J7QC 3TNXA 2G6DA 4CDFB 3RVWA 3MHHA 4BOZA 4PP1A 4FJCA 1VSNA 4BSQA 3HWNA 1F2AA 4YV8A 4Q8HA 3PSEA 1PPDA 1Y4HA 3ERVA 3E9SA 1KHPA 5EGWA 1YK8A 1F2CA 2Y5BA 1PPNA 3K24A 2AYOA 3BY4A 1YALA 4CDCB 3N4CA 5K16A 3QJ3A 9PAPA 1QXPA 5F02A 3F5VA 3S3QA 2FTDA 2JQGR 3KSEA 4BS5A 4K7CA 1PPPA 3CBKA 1PPOA 3TRKA 2O6XA 4RNAA 1QMYA 2JQFR 2AYNA 4YYQA 1NL6A 3OQCA 2G8JA 4GUAA 3KKUA 2R9MA 4QRXA 4HWYA 2FO5A 4P6GA 3MTVA 2FUDA 1U9QX 3ZUAA 2YJ8A 1GECE 1KHQA 2DZZA 2R6NA 2C0YA 2F7DA 3P5XA 4I05A 4N8WA 1CB5A 3CH2X 5E6JA 3BCNA 1ICFA 5JZEA 3H8BA 2VHFA 4MM3B 3OF8A 2BTWB 4QRGA 4RY2A 4QBBA 4OVZB 1AYVA 1VJVA 3QSDA 3O65A 1EF7A 3KWZA 1M6DA 3C0RA 5EZQA 1ME3A 3PHXA 2IPPB 2PREA 1SNKA 4YYRA 3KWBX 2DJGB 1AU3A 1PE6A 2YJCA 1BP4A 1NLJA 2XU4A 1QOLA 4IUMA 5JH3A 2FYEA 2AU1A 2AS8A 2DC9A 3OVZA 3DF0A 3CH3X 1EWMA 2DCAA 2DC6A 1U9WA 2G7YA 2BTWA 3HD3A 2ARYA 1QDQA 3IUTA 2FQ9A 1NB5A 2H7JA 3P5UA 1Q6KA 3NHEA 3O1GA 1CTEA 1PXVA 1MEMA 3PBHA 2UZJA 4YVAA 4CDDB 2E03A 5CHVA 2DJFB 2VHSA 2Y6EA 2AGAA 1U9XA 4YYSA 4I04A 1MEGA 1ZCMA 2DC7A 3M99A 1YZBA 4IP3A 4D8EA 4BOUA 2FRQA 5A24A 3WXGA 1CSBB 3USVA 4PT5A 7PCKA 4OELA 1AECA 1A6RA 2ACTA 3IHPA 3C9EA 1KFXL 2DCBA 3PDFA 4P6EA 3PRMA 4ZTBA 3RVXA 4KLBA 4DMXA 5CVMA 2JRIA 4XZXA 1KXRA 1PVJA 5J94A 1KFUL 2GFOA 3F75A 2R9FA 1U9VA 3IMAA 4OEMA 1AYWA 1AU0A 1STFE 2FE8A 2E00A 3RNVA 4D8BA 4HXDB 2B1NA 2HXZA 2HD5A 4N79A 2CIOA 3MTNA 1CS8A 2P7UA 2YJ2A 4R3DA 4W5CA 4XUIA 2XU3A 4BPVA 3PHUA 2AUXA 2P86A 6PADA 2HWKA 1S4VA 2F1GA 3LFYA 1BY8A 3OF9A 3KFQA 4QRVA 4MI7A 1IWDA 1MS6A 3E1ZB 4BOPA 2AIMA 4X6HA 1JQPA 1TU6A 2JTCA 2B1MA 4PADA 3B79A 5JA7A 3O0UA 5KO3A 3BWKA 3MP2A 1CJLA 1MDWA 2BDZA 3W30A 1K3BB 1NQCA 3IOQA 3PHWA 1MIRA 3MORA 1CPJA 3PT2A 2XU5A 4OW0A 2BU3A 2PADA 2R9OA 2BDLA 3H8CA 4W4UA 4XR7A 2P0RA 3H6SA 4REZA 1Y08A 1THEA 1BGOA 3P5WA 2Z84A 3BPFA 5FPWA 4FIPA 1SP4B 1MHWA 4DMYA 3QT4A 2R9CA 1DKIA 1EWLA 3K9MA 5EZSA 4PI3A 2CB5A 3W31A 3N3KA 3PW3A 2OULA 1YT7A 1NPZA 1ME4A 1CQDA 1AU4A 3D6SA 3BPMA 1DEUA 3IEJA 3V6EA 3MJ5A 2DCDA 1XKGA 1AIMA 4G54A 2E02A 4BS6A 4MSXA 3LXSA 3KW9A 2AUZA 4YYWA 2DOSA 3ZNHA 2E01A 2NQAA 2DCCA 1EWOA 1NB3A 2NQDB 3MHSA 2DZYA 2GHUA 4RKXA 2XU1A 4Q8GA 2PBHA 3U8EA 4CDEB 4M0WA 5PADA 1TLOA 1TL9A 3B21A 5EF4A 3I3TA 3OISA 1U5IA 2NQIA 4WURA 1YVBA 3BB7A 1ITOA 5CHTA 3IV2A 2G8EA 1FH0A 3AI8A 1ATKA 2PNSA 1DF0A 1GLOA 1HUCB 3PNRA 3BOWA 3OVXA 4RF0A 2J7QA 2FRAA 4YYUA 2DC8A 4ZUXU 4X6JA 3BC3A 2R9NA 1GMYA 3I06A 4BOQA 3K8UA 2OZ2A 1POPA 1X9YA 3HHAA 1PBHA 3TMPA 5CVNB 1AU2A 4MZOA 1EWPA 4CZWA 3V6CA 4P16A 4BQVA 2YJBA 2HH5A 2NQGA 4A5UA
chains in the Genus database with same CATH topology
1CV8A 2OP3A 3WXFA 1GX3A 4PP2E 3P5VA 8PCHA 3HHIA 4X6IA 1O0EA 4YYVA 2VFCA 4BGFA 2WBFX 3KX1A 3S3RA 1PIPA 1GCBA 2VFBA 2IBIA 3N3GA 4NV8A 3D9WA 2YJ9A 4AXLA 3RVVA 4FK5A 3GCBA 4QH6A 1CVZA 1BQIA 1ZIVA 4WA6A 4N4ZA 1F29A 4W5BA 2AVWA 5CVOB 4AXMA 1AYUA 1F2BA 2FT2A 3H7DA 2HHNA 1PADA 4I07A 1YK7A 3CBJA 3H89A 4MZSA 1PCIA 2ATOA 3WXEA 3TNXA 2G6DA 4CDFB 3RVWA 1W4TA 3MHHA 4PP1A 4FJCA 1VSNA 4BSQA 3HWNA 1F2AA 4YV8A 4Q8HA 1PPDA 1Y4HA 3ERVA 1KHPA 5EGWA 1YK8A 1F2CA 2Y5BA 1PPNA 3K24A 2AYOA 1YALA 4CDCB 3N4CA 5K16A 3QJ3A 9PAPA 1QXPA 5F02A 3F5VA 3S3QA 2FTDA 2JQGR 3KSEA 4BS5A 4K7CA 1PPPA 3CBKA 4GUZA 1PPOA 2O6XA 1QMYA 2JQFR 2AYNA 4YYQA 1NL6A 2G8JA 3KKUA 2R9MA 4QRXA 4HWYA 2FO5A 4P6GA 2FUDA 1U9QX 3ZUAA 2YJ8A 1GECE 1KHQA 2DZZA 2R6NA 2C0YA 2F7DA 1W5RA 3P5XA 4I05A 4N8WA 1CB5A 3CH2X 3BCNA 2BSZA 1ICFA 3H8BA 2VHFA 3OF8A 4QRGA 4RY2A 4QBBA 1AYVA 1VJVA 3QSDA 1EF7A 3KWZA 1M6DA 1ME3A 2IPPB 2PREA 1SNKA 4YYRA 3KWBX 2DJGB 1AU3A 1PE6A 2YJCA 1BP4A 1NLJA 2XU4A 1QOLA 5JH3A 2FYEA 2AU1A 2AS8A 2DC9A 3OVZA 3DF0A 3CH3X 1EWMA 2DCAA 2DC6A 1U9WA 2G7YA 3HD3A 2ARYA 1QDQA 3IUTA 2FQ9A 1NB5A 2H7JA 3P5UA 1Q6KA 4NV7A 3NHEA 3O1GA 1CTEA 1PXVA 1MEMA 3PBHA 1E2TA 4YVAA 4CDDB 2E03A 5CHVA 2DJFB 2VHSA 2Y6EA 1U9XA 4YYSA 4I04A 1MEGA 1ZCMA 2DC7A 3M99A 2FRQA 5A24A 3WXGA 1CSBB 3USVA 7PCKA 4OELA 1AECA 1A6RA 2ACTA 3IHPA 3C9EA 1KFXL 2DCBA 3PDFA 4P6EA 3RVXA 4KLBA 4DMXA 5CVMA 1KXRA 5J94A 1KFUL 2GFOA 3F75A 2R9FA 1U9VA 3IMAA 4OEMA 1AYWA 1AU0A 1STFE 2E00A 2B1NA 2HXZA 2HD5A 4N79A 2CIOA 3MTNA 1CS8A 2P7UA 2YJ2A 4XUIA 4W5CA 2XU3A 4BPVA 2AUXA 2P86A 6PADA 1S4VA 2F1GA 3LFYA 1BY8A 3OF9A 3KFQA 4QRVA 1IWDA 1MS6A 3E1ZB 2AIMA 4X6HA 1JQPA 1TU6A 2B1MA 4PADA 3B79A 5JA7A 3O0UA 3BWKA 4B55A 1CJLA 1MDWA 2BDZA 1K3BB 1NQCA 3IOQA 4C5PA 1MIRA 1W6FA 1CPJA 3MORA 2XU5A 2PADA 2R9OA 2BDLA 3H8CA 4W4UA 4XR7A 2P0RA 3H6SA 1Y08A 1THEA 1BGOA 3P5WA 3BPFA 5FPWA 4FIPA 1SP4B 1MHWA 4DMYA 3QT4A 2R9CA 1EWLA 3K9MA 4PI3A 2CB5A 3N3KA 3PW3A 2OULA 1YT7A 1NPZA 1ME4A 1CQDA 1AU4A 3D6SA 3BPMA 1DEUA 3LTWA 3IEJA 3V6EA 2DCDA 1XKGA 1AIMA 4G54A 2E02A 4BS6A 4MSXA 3LXSA 3KW9A 2AUZA 4YYWA 2E01A 2NQAA 2DCCA 1EWOA 1NB3A 2NQDB 3MHSA 2DZYA 2GHUA 2XU1A 4Q8GA 2PBHA 3U8EA 4CDEB 5PADA 1TLOA 1TL9A 5EF4A 3I3TA 3OISA 1U5IA 2NQIA 1YVBA 1ITOA 5CHTA 3IV2A 2G8EA 1FH0A 3AI8A 1ATKA 2PNSA 1DF0A 1GLOA 1HUCB 3PNRA 3BOWA 3OVXA 2FRAA 4YYUA 2DC8A 4ZUXU 4X6JA 3BC3A 2R9NA 1GMYA 3I06A 3K8UA 2OZ2A 1POPA 1X9YA 3HHAA 1PBHA 5CVNB 1AU2A 4MZOA 1EWPA 4CZWA 3V6CA 4BQVA 2YJBA 2HH5A 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CV8 A;  2OP3 A;  3WXF A;  4PP2 E;  3P5V A;  8PCH A;  3HHI A;  4X6I A;  1O0E A;  4YYV A;  2WBF X;  3KX1 A;  3S3R A;  1PIP A;  1GCB A;  2IBI A;  3N3G A;  2YJ9 A;  4AXL A;  3RVV A;  4FK5 A;  3GCB A;  4QH6 A;  1CVZ A;  1BQI A;  1ZIV A;  4WA6 A;  4N4Z A;  1F29 A;  4W5B A;  2AVW A;  5CVO B;  4AXM A;  1AYU A;  1F2B A;  2FT2 A;  3H7D A;  2HHN A;  1PAD A;  4I07 A;  1YK7 A;  3CBJ A;  3H89 A;  4MZS A;  1PCI A;  2ATO A;  3WXE A;  3TNX A;  2G6D A;  4CDF B;  3RVW A;  3MHH A;  4PP1 A;  4FJC A;  1VSN A;  4BSQ A;  3HWN A;  1F2A A;  4YV8 A;  4Q8H A;  1PPD A;  1Y4H A;  3ERV A;  1KHP A;  5EGW A;  1YK8 A;  1F2C A;  2Y5B A;  1PPN A;  3K24 A;  2AYO A;  1YAL A;  4CDC B;  3N4C A;  5K16 A;  3QJ3 A;  9PAP A;  1QXP A;  5F02 A;  3F5V A;  3S3Q A;  2FTD A;  2JQG R;  3KSE A;  4BS5 A;  4K7C A;  1PPP A;  3CBK A;  1PPO A;  2O6X A;  1QMY A;  2JQF R;  2AYN A;  4YYQ A;  1NL6 A;  2G8J A;  3KKU A;  2R9M A;  4QRX A;  4HWY A;  2FO5 A;  4P6G A;  2FUD A;  1U9Q X;  3ZUA A;  2YJ8 A;  1GEC E;  1KHQ A;  2DZZ A;  2R6N A;  2C0Y A;  2F7D A;  3P5X A;  4I05 A;  4N8W A;  1CB5 A;  3CH2 X;  3BCN A;  1ICF A;  3H8B A;  2VHF A;  3OF8 A;  4QRG A;  4RY2 A;  4QBB A;  1AYV A;  1VJV A;  3QSD A;  1EF7 A;  3KWZ A;  1M6D A;  1ME3 A;  2IPP B;  2PRE A;  1SNK A;  4YYR A;  3KWB X;  2DJG B;  1AU3 A;  1PE6 A;  2YJC A;  1BP4 A;  1NLJ A;  2XU4 A;  1QOL A;  5JH3 A;  2FYE A;  2AU1 A;  2AS8 A;  2DC9 A;  3OVZ A;  3DF0 A;  3CH3 X;  1EWM A;  2DCA A;  2DC6 A;  1U9W A;  2G7Y A;  3HD3 A;  2ARY A;  1QDQ A;  3IUT A;  2FQ9 A;  1NB5 A;  2H7J A;  3P5U A;  1Q6K A;  3NHE A;  3O1G A;  1CTE A;  1PXV A;  1MEM A;  3PBH A;  4YVA A;  4CDD B;  2E03 A;  5CHV A;  2DJF B;  2VHS A;  2Y6E A;  1U9X A;  4YYS A;  4I04 A;  1MEG A;  1ZCM A;  2DC7 A;  3M99 A;  2FRQ A;  5A24 A;  3WXG A;  1CSB B;  3USV A;  7PCK A;  4OEL A;  1AEC A;  1A6R A;  2ACT A;  3IHP A;  3C9E A;  1KFX L;  2DCB A;  3PDF A;  4P6E A;  3RVX A;  4KLB A;  4DMX A;  5CVM A;  1KXR A;  5J94 A;  1KFU L;  2GFO A;  3F75 A;  2R9F A;  1U9V A;  3IMA A;  4OEM A;  1AYW A;  1AU0 A;  1STF E;  2E00 A;  2B1N A;  2HXZ A;  2HD5 A;  4N79 A;  2CIO A;  3MTN A;  1CS8 A;  2P7U A;  2YJ2 A;  4XUI A;  4W5C A;  2XU3 A;  4BPV A;  2AUX A;  2P86 A;  6PAD A;  1S4V A;  2F1G A;  3LFY A;  1BY8 A;  3OF9 A;  3KFQ A;  4QRV A;  1IWD A;  1MS6 A;  3E1Z B;  2AIM A;  4X6H A;  1JQP A;  1TU6 A;  2B1M A;  4PAD A;  3B79 A;  5JA7 A;  3O0U A;  3BWK A;  1CJL A;  1MDW A;  2BDZ A;  1K3B B;  1NQC A;  3IOQ A;  1MIR A;  3MOR A;  1CPJ A;  2XU5 A;  2PAD A;  2R9O A;  2BDL A;  3H8C A;  4W4U A;  4XR7 A;  2P0R A;  3H6S A;  1Y08 A;  1THE A;  1BGO A;  3P5W A;  3BPF A;  5FPW A;  4FIP A;  1SP4 B;  1MHW A;  4DMY A;  3QT4 A;  2R9C A;  1EWL A;  3K9M A;  4PI3 A;  2CB5 A;  3N3K A;  3PW3 A;  2OUL A;  1YT7 A;  1NPZ A;  1ME4 A;  1CQD A;  1AU4 A;  3D6S A;  3BPM A;  1DEU A;  3IEJ A;  3V6E A;  2DCD A;  1XKG A;  1AIM A;  4G54 A;  2E02 A;  4BS6 A;  4MSX A;  3LXS A;  3KW9 A;  2AUZ A;  4YYW A;  2E01 A;  2NQA A;  2DCC A;  1EWO A;  1NB3 A;  2NQD B;  3MHS A;  2DZY A;  2GHU A;  2XU1 A;  4Q8G A;  2PBH A;  3U8E A;  4CDE B;  5PAD A;  1TLO A;  1TL9 A;  5EF4 A;  3I3T A;  3OIS A;  1U5I A;  2NQI A;  1YVB A;  1ITO A;  5CHT A;  3IV2 A;  2G8E A;  1FH0 A;  3AI8 A;  1ATK A;  2PNS A;  1DF0 A;  1GLO A;  1HUC B;  3PNR A;  3BOW A;  3OVX A;  2FRA A;  4YYU A;  2DC8 A;  4ZUX U;  4X6J A;  3BC3 A;  2R9N A;  1GMY A;  3I06 A;  3K8U A;  2OZ2 A;  1POP A;  1X9Y A;  3HHA A;  1PBH A;  5CVN B;  1AU2 A;  4MZO A;  1EWP A;  4CZW A;  3V6C A;  4BQV A;  2YJB A;  2HH5 A;  2NQG A; 
#chains in the Genus database with same CATH topology
 1CV8 A;  3PRP A;  2OP3 A;  3BBA A;  3WXF A;  4PP2 E;  3P5V A;  8PCH A;  3HHI A;  4X6I A;  1O0E A;  4YYV A;  2WBF X;  3IFU A;  3KX1 A;  3S3R A;  1PIP A;  4OVZ A;  1UKF A;  1GCB A;  2IBI A;  3N3G A;  4RF1 A;  2YJ9 A;  4AXL A;  4D8I A;  3RVV A;  4FK5 A;  3GCB A;  4QH6 A;  1CVZ A;  1BQI A;  1ZIV A;  4WA6 A;  4N4Z A;  1F29 A;  4W5B A;  4BOS A;  2AVW A;  5CVO B;  4AXM A;  1AYU A;  1F2B A;  2FT2 A;  3H7D A;  2HHN A;  1PAD A;  4I07 A;  1YK7 A;  3CBJ A;  3H89 A;  4MZS A;  1PCI A;  2ATO A;  3WXE A;  2J7Q C;  3TNX A;  2G6D A;  4CDF B;  3RVW A;  3MHH A;  4BOZ A;  4PP1 A;  4FJC A;  1VSN A;  4BSQ A;  3HWN A;  1F2A A;  4YV8 A;  4Q8H A;  3PSE A;  1PPD A;  1Y4H A;  3ERV A;  3E9S A;  1KHP A;  5EGW A;  1YK8 A;  1F2C A;  2Y5B A;  1PPN A;  3K24 A;  2AYO A;  3BY4 A;  1YAL A;  4CDC B;  3N4C A;  5K16 A;  3QJ3 A;  9PAP A;  1QXP A;  5F02 A;  3F5V A;  3S3Q A;  2FTD A;  2JQG R;  3KSE A;  4BS5 A;  4K7C A;  1PPP A;  3CBK A;  1PPO A;  3TRK A;  2O6X A;  4RNA A;  1QMY A;  2JQF R;  2AYN A;  4YYQ A;  1NL6 A;  3OQC A;  2G8J A;  4GUA A;  3KKU A;  2R9M A;  4QRX A;  4HWY A;  2FO5 A;  4P6G A;  3MTV A;  2FUD A;  1U9Q X;  3ZUA A;  2YJ8 A;  1GEC E;  1KHQ A;  2DZZ A;  2R6N A;  2C0Y A;  2F7D A;  3P5X A;  4I05 A;  4N8W A;  1CB5 A;  3CH2 X;  5E6J A;  3BCN A;  1ICF A;  5JZE A;  3H8B A;  2VHF A;  4MM3 B;  3OF8 A;  2BTW B;  4QRG A;  4RY2 A;  4QBB A;  4OVZ B;  1AYV A;  1VJV A;  3QSD A;  3O65 A;  1EF7 A;  3KWZ A;  1M6D A;  3C0R A;  5EZQ A;  1ME3 A;  3PHX A;  2IPP B;  2PRE A;  1SNK A;  4YYR A;  3KWB X;  2DJG B;  1AU3 A;  1PE6 A;  2YJC A;  1BP4 A;  1NLJ A;  2XU4 A;  1QOL A;  4IUM A;  5JH3 A;  2FYE A;  2AU1 A;  2AS8 A;  2DC9 A;  3OVZ A;  3DF0 A;  3CH3 X;  1EWM A;  2DCA A;  2DC6 A;  1U9W A;  2G7Y A;  2BTW A;  3HD3 A;  2ARY A;  1QDQ A;  3IUT A;  2FQ9 A;  1NB5 A;  2H7J A;  3P5U A;  1Q6K A;  3NHE A;  3O1G A;  1CTE A;  1PXV A;  1MEM A;  3PBH A;  2UZJ A;  4YVA A;  4CDD B;  2E03 A;  5CHV A;  2DJF B;  2VHS A;  2Y6E A;  2AGA A;  1U9X A;  4YYS A;  4I04 A;  1MEG A;  1ZCM A;  2DC7 A;  3M99 A;  1YZB A;  4IP3 A;  4D8E A;  4BOU A;  2FRQ A;  5A24 A;  3WXG A;  1CSB B;  3USV A;  4PT5 A;  7PCK A;  4OEL A;  1AEC A;  1A6R A;  2ACT A;  3IHP A;  3C9E A;  1KFX L;  2DCB A;  3PDF A;  4P6E A;  3PRM A;  4ZTB A;  3RVX A;  4KLB A;  4DMX A;  5CVM A;  2JRI A;  4XZX A;  1KXR A;  1PVJ A;  5J94 A;  1KFU L;  2GFO A;  3F75 A;  2R9F A;  1U9V A;  3IMA A;  4OEM A;  1AYW A;  1AU0 A;  1STF E;  2FE8 A;  2E00 A;  3RNV A;  4D8B A;  4HXD B;  2B1N A;  2HXZ A;  2HD5 A;  4N79 A;  2CIO A;  3MTN A;  1CS8 A;  2P7U A;  2YJ2 A;  4R3D A;  4W5C A;  4XUI A;  2XU3 A;  4BPV A;  3PHU A;  2AUX A;  2P86 A;  6PAD A;  2HWK A;  1S4V A;  2F1G A;  3LFY A;  1BY8 A;  3OF9 A;  3KFQ A;  4QRV A;  4MI7 A;  1IWD A;  1MS6 A;  3E1Z B;  4BOP A;  2AIM A;  4X6H A;  1JQP A;  1TU6 A;  2JTC A;  2B1M A;  4PAD A;  3B79 A;  5JA7 A;  3O0U A;  5KO3 A;  3BWK A;  3MP2 A;  1CJL A;  1MDW A;  2BDZ A;  3W30 A;  1K3B B;  1NQC A;  3IOQ A;  3PHW A;  1MIR A;  3MOR A;  1CPJ A;  3PT2 A;  2XU5 A;  4OW0 A;  2BU3 A;  2PAD A;  2R9O A;  2BDL A;  3H8C A;  4W4U A;  4XR7 A;  2P0R A;  3H6S A;  4REZ A;  1Y08 A;  1THE A;  1BGO A;  3P5W A;  2Z84 A;  3BPF A;  5FPW A;  4FIP A;  1SP4 B;  1MHW A;  4DMY A;  3QT4 A;  2R9C A;  1DKI A;  1EWL A;  3K9M A;  5EZS A;  4PI3 A;  2CB5 A;  3W31 A;  3N3K A;  3PW3 A;  2OUL A;  1YT7 A;  1NPZ A;  1ME4 A;  1CQD A;  1AU4 A;  3D6S A;  3BPM A;  1DEU A;  3IEJ A;  3V6E A;  3MJ5 A;  2DCD A;  1XKG A;  1AIM A;  4G54 A;  2E02 A;  4BS6 A;  4MSX A;  3LXS A;  3KW9 A;  2AUZ A;  4YYW A;  2DOS A;  3ZNH A;  2E01 A;  2NQA A;  2DCC A;  1EWO A;  1NB3 A;  2NQD B;  3MHS A;  2DZY A;  2GHU A;  4RKX A;  2XU1 A;  4Q8G A;  2PBH A;  3U8E A;  4CDE B;  4M0W A;  5PAD A;  1TLO A;  1TL9 A;  3B21 A;  5EF4 A;  3I3T A;  3OIS A;  1U5I A;  2NQI A;  4WUR A;  1YVB A;  3BB7 A;  1ITO A;  5CHT A;  3IV2 A;  2G8E A;  1FH0 A;  3AI8 A;  1ATK A;  2PNS A;  1DF0 A;  1GLO A;  1HUC B;  3PNR A;  3BOW A;  3OVX A;  4RF0 A;  2J7Q A;  2FRA A;  4YYU A;  2DC8 A;  4ZUX U;  4X6J A;  3BC3 A;  2R9N A;  1GMY A;  3I06 A;  4BOQ A;  3K8U A;  2OZ2 A;  1POP A;  1X9Y A;  3HHA A;  1PBH A;  3TMP A;  5CVN B;  1AU2 A;  4MZO A;  1EWP A;  4CZW A;  3V6C A;  4P16 A;  4BQV A;  2YJB A;  2HH5 A;  2NQG A;  4A5U A; 
#chains in the Genus database with same CATH homology
 1CV8 A;  2OP3 A;  3WXF A;  1GX3 A;  4PP2 E;  3P5V A;  8PCH A;  3HHI A;  4X6I A;  1O0E A;  4YYV A;  2VFC A;  4BGF A;  2WBF X;  3KX1 A;  3S3R A;  1PIP A;  1GCB A;  2VFB A;  2IBI A;  3N3G A;  4NV8 A;  3D9W A;  2YJ9 A;  4AXL A;  3RVV A;  4FK5 A;  3GCB A;  4QH6 A;  1CVZ A;  1BQI A;  1ZIV A;  4WA6 A;  4N4Z A;  1F29 A;  4W5B A;  2AVW A;  5CVO B;  4AXM A;  1AYU A;  1F2B A;  2FT2 A;  3H7D A;  2HHN A;  1PAD A;  4I07 A;  1YK7 A;  3CBJ A;  3H89 A;  4MZS A;  1PCI A;  2ATO A;  3WXE A;  3TNX A;  2G6D A;  4CDF B;  3RVW A;  1W4T A;  3MHH A;  4PP1 A;  4FJC A;  1VSN A;  4BSQ A;  3HWN A;  1F2A A;  4YV8 A;  4Q8H A;  1PPD A;  1Y4H A;  3ERV A;  1KHP A;  5EGW A;  1YK8 A;  1F2C A;  2Y5B A;  1PPN A;  3K24 A;  2AYO A;  1YAL A;  4CDC B;  3N4C A;  5K16 A;  3QJ3 A;  9PAP A;  1QXP A;  5F02 A;  3F5V A;  3S3Q A;  2FTD A;  2JQG R;  3KSE A;  4BS5 A;  4K7C A;  1PPP A;  3CBK A;  4GUZ A;  1PPO A;  2O6X A;  1QMY A;  2JQF R;  2AYN A;  4YYQ A;  1NL6 A;  2G8J A;  3KKU A;  2R9M A;  4QRX A;  4HWY A;  2FO5 A;  4P6G A;  2FUD A;  1U9Q X;  3ZUA A;  2YJ8 A;  1GEC E;  1KHQ A;  2DZZ A;  2R6N A;  2C0Y A;  2F7D A;  1W5R A;  3P5X A;  4I05 A;  4N8W A;  1CB5 A;  3CH2 X;  3BCN A;  2BSZ A;  1ICF A;  3H8B A;  2VHF A;  3OF8 A;  4QRG A;  4RY2 A;  4QBB A;  1AYV A;  1VJV A;  3QSD A;  1EF7 A;  3KWZ A;  1M6D A;  1ME3 A;  2IPP B;  2PRE A;  1SNK A;  4YYR A;  3KWB X;  2DJG B;  1AU3 A;  1PE6 A;  2YJC A;  1BP4 A;  1NLJ A;  2XU4 A;  1QOL A;  5JH3 A;  2FYE A;  2AU1 A;  2AS8 A;  2DC9 A;  3OVZ A;  3DF0 A;  3CH3 X;  1EWM A;  2DCA A;  2DC6 A;  1U9W A;  2G7Y A;  3HD3 A;  2ARY A;  1QDQ A;  3IUT A;  2FQ9 A;  1NB5 A;  2H7J A;  3P5U A;  1Q6K A;  4NV7 A;  3NHE A;  3O1G A;  1CTE A;  1PXV A;  1MEM A;  3PBH A;  1E2T A;  4YVA A;  4CDD B;  2E03 A;  5CHV A;  2DJF B;  2VHS A;  2Y6E A;  1U9X A;  4YYS A;  4I04 A;  1MEG A;  1ZCM A;  2DC7 A;  3M99 A;  2FRQ A;  5A24 A;  3WXG A;  1CSB B;  3USV A;  7PCK A;  4OEL A;  1AEC A;  1A6R A;  2ACT A;  3IHP A;  3C9E A;  1KFX L;  2DCB A;  3PDF A;  4P6E A;  3RVX A;  4KLB A;  4DMX A;  5CVM A;  1KXR A;  5J94 A;  1KFU L;  2GFO A;  3F75 A;  2R9F A;  1U9V A;  3IMA A;  4OEM A;  1AYW A;  1AU0 A;  1STF E;  2E00 A;  2B1N A;  2HXZ A;  2HD5 A;  4N79 A;  2CIO A;  3MTN A;  1CS8 A;  2P7U A;  2YJ2 A;  4XUI A;  4W5C A;  2XU3 A;  4BPV A;  2AUX A;  2P86 A;  6PAD A;  1S4V A;  2F1G A;  3LFY A;  1BY8 A;  3OF9 A;  3KFQ A;  4QRV A;  1IWD A;  1MS6 A;  3E1Z B;  2AIM A;  4X6H A;  1JQP A;  1TU6 A;  2B1M A;  4PAD A;  3B79 A;  5JA7 A;  3O0U A;  3BWK A;  4B55 A;  1CJL A;  1MDW A;  2BDZ A;  1K3B B;  1NQC A;  3IOQ A;  4C5P A;  1MIR A;  1W6F A;  1CPJ A;  3MOR A;  2XU5 A;  2PAD A;  2R9O A;  2BDL A;  3H8C A;  4W4U A;  4XR7 A;  2P0R A;  3H6S A;  1Y08 A;  1THE A;  1BGO A;  3P5W A;  3BPF A;  5FPW A;  4FIP A;  1SP4 B;  1MHW A;  4DMY A;  3QT4 A;  2R9C A;  1EWL A;  3K9M A;  4PI3 A;  2CB5 A;  3N3K A;  3PW3 A;  2OUL A;  1YT7 A;  1NPZ A;  1ME4 A;  1CQD A;  1AU4 A;  3D6S A;  3BPM A;  1DEU A;  3LTW A;  3IEJ A;  3V6E A;  2DCD A;  1XKG A;  1AIM A;  4G54 A;  2E02 A;  4BS6 A;  4MSX A;  3LXS A;  3KW9 A;  2AUZ A;  4YYW A;  2E01 A;  2NQA A;  2DCC A;  1EWO A;  1NB3 A;  2NQD B;  3MHS A;  2DZY A;  2GHU A;  2XU1 A;  4Q8G A;  2PBH A;  3U8E A;  4CDE B;  5PAD A;  1TLO A;  1TL9 A;  5EF4 A;  3I3T A;  3OIS A;  1U5I A;  2NQI A;  1YVB A;  1ITO A;  5CHT A;  3IV2 A;  2G8E A;  1FH0 A;  3AI8 A;  1ATK A;  2PNS A;  1DF0 A;  1GLO A;  1HUC B;  3PNR A;  3BOW A;  3OVX A;  2FRA A;  4YYU A;  2DC8 A;  4ZUX U;  4X6J A;  3BC3 A;  2R9N A;  1GMY A;  3I06 A;  3K8U A;  2OZ2 A;  1POP A;  1X9Y A;  3HHA A;  1PBH A;  5CVN B;  1AU2 A;  4MZO A;  1EWP A;  4CZW A;  3V6C A;  4BQV A;  2YJB A;  2HH5 A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...