1IWDA

Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
LPSFVDWRSKGAVNSIKNQKQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLRVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ERVATAMIN B
publication title Proposed amino acid sequence and the 1.63 A X-ray crystal structure of a plant cysteine protease, ervatamin B: Some insights into the structural basis of its stability and substrate specificity
pubmed doi rcsb
total genus 67
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1iwdA00
3C9EA 5F02A 1SP4B 2PNSA 1PPNA 3OF8A 3H89A 1THEA 2NQIA 4DMYA 1F2CA 3D6SA 1X9YA 3PBHA 1ITOA 5CHTA 2IPPB 1CPJA 1U5IA 3ERVA 4XR7A 3H6SA 3BWKA 1NB3A 1MEMA 2R9FA 1NLJA 4QRGA 1KFUL 3K9MA 2FUDA 1GCBA 2E02A 1BGOA 1POPA 1CQDA 4BQVA 3CBKA 2Y5BA 1PBHA 1F29A 3HD3A 1PADA 6PADA 3V6EA 3OF9A 9PAPA 3H8BA 1GMYA 2G6DA 2FT2A 1CV8A 1DF0A 4W4UA 5K16A 3BPFA 3QJ3A 2E01A 2PADA 2ATOA 4WA6A 3CH2X 4FK5A 1K3BB 2JQFR 4QH6A 2AIMA 1JQPA 2FQ9A 3V6CA 2R9MA 2G7YA 1NL6A 1TU6A 3MORA 1KHQA 3K24A 3OVZA 1QXPA 3HHIA 2JQGR 2DJGB 4P6GA 4W5CA 3ZUAA 4G54A 3WXFA 1CB5A 3U8EA 4KLBA 3RVVA 2O6XA 3IOQA 3CBJA 1QMYA 1PXVA 1DEUA 1FH0A 2YJCA 2YJ9A 3BOWA 3HHAA 2PREA 4OELA 1U9XA 3KKUA 7PCKA 2B1MA 1EWLA 4P6EA 3LXSA 4PI3A 3BC3A 2HXZA 1F2BA 1AU3A 4YYWA 1U9VA 3USVA 2C0YA 1NQCA 2AYNA 2FYEA 1ZIVA 1PIPA 1AYVA 2DCAA 1ME3A 1YT7A 4CZWA 3BCNA 2R9NA 4I07A 4XUIA 2AYOA 2AUZA 3WXGA 1GLOA 3KX1A 3RVXA 1M6DA 3P5UA 2DJFB 4X6IA 4I04A 2AS8A 2CB5A 1BQIA 1KFXL 3IEJA 1MDWA 2ARYA 1CS8A 2DCDA 2BDZA 4YV8A 4YVAA 4YYSA 3F5VA 3S3QA 2GFOA 3OVXA 4FJCA 4CDEB 3QT4A 1BY8A 1STFE 2BDLA 3KWZA 1CSBB 1U9WA 3HWNA 2HD5A 2NQDB 2ACTA 1AIMA 3E1ZB 1PPOA 4AXMA 1F2AA 1AECA 4BS5A 1AU0A 4PADA 1QOLA 1ICFA 1S4VA 2B1NA 4N4ZA 1IWDA 2XU1A 1GECE 1AU2A 3P5XA 4CDCB 3MHHA 2F7DA 5CVOB 2F1GA 3B79A 2H7JA 2WBFX 2HH5A 2XU5A 3QSDA 3O0UA 2FRQA 1AYWA 2PBHA 1Y08A 2VHSA 4PP2E 3O1GA 3OISA 4QRXA 2AVWA 4YYVA 5PADA 2E00A 4YYUA 2HHNA 3GCBA 1EWOA 5FPWA 4BPVA 2NQAA 1QDQA 2R6NA 5JA7A 2P86A 4X6JA 1MEGA 3LFYA 3MHSA 4I05A 2YJBA 1YK8A 1ZCMA 5J94A 4OEMA 2G8EA 4N8WA 4RY2A 3KW9A 3IHPA 1Q6KA 2CIOA 3S3RA 3K8UA 3CH3X 2DC9A 1YALA 3PW3A 3P5VA 3IMAA 4K7CA 4YYQA 1BP4A 2OP3A 2P7UA 5CVNB 5EGWA 1YK7A 5CVMA 2DC8A 4W5BA 4QBBA 3AI8A 3NHEA 3RVWA 2OZ2A 1YVBA 2FO5A 1CJLA 4MZOA 2YJ8A 3PNRA 3IUTA 1VJVA 2G8JA 4PP1A 2VHFA 4MSXA 3N3GA 1VSNA 3IV2A 3I06A 3KWBX 3H7DA 1ATKA 1Y4HA 1KXRA 2DZZA 4BS6A 1TL9A 2FTDA 3M99A 2DZYA 2XU3A 2YJ2A 3BPMA 1MIRA 2P0RA 1EWMA 4ZUXU 4YYRA 3I3TA 4MZSA 2DCBA 3N4CA 2OULA 3MTNA 1AYUA 3WXEA 2DCCA 1XKGA 1CTEA 4AXLA 1PCIA 4BSQA 1U9QX 2R9CA 4X6HA 3PDFA 2E03A 3KSEA 8PCHA 3KFQA 1PE6A 1A6RA 4N79A 1ME4A 2IBIA 1NB5A 1KHPA 5EF4A 1MS6A 1AU4A 4FIPA 3H8CA 1PPDA 1CVZA 2NQGA 1NPZA 3P5WA 1O0EA 2FRAA 1HUCB 5JH3A 2DC6A 3N3KA 4CDDB 2DC7A 1EWPA 2GHUA 4Q8HA 4QRVA 1EF7A 3F75A 5CHVA 1MHWA 4DMXA 1SNKA 4HWYA 4Q8GA 3DF0A 2Y6EA 5A24A 2AUXA 3TNXA 2XU4A 1TLOA 2AU1A 1PPPA 4CDFB 2R9OA
chains in the Genus database with same CATH superfamily
3C9EA 5F02A 1SP4B 2PNSA 1PPNA 3RNVA 3OF8A 3H89A 1THEA 2NQIA 4DMYA 1F2CA 3D6SA 1X9YA 3PBHA 1ITOA 5CHTA 2IPPB 1CPJA 1U5IA 3ERVA 4XR7A 3H6SA 3BWKA 1NB3A 1MEMA 2R9FA 1NLJA 4QRGA 1KFUL 3K9MA 2FUDA 1GCBA 2E02A 1BGOA 4BOQA 1POPA 1CQDA 4BQVA 4A5UA 3CBKA 2Y5BA 1PBHA 4RNAA 1F29A 3B21A 3HD3A 1PADA 6PADA 3MTVA 3V6EA 3OF9A 9PAPA 3H8BA 1GMYA 2G6DA 2FT2A 1CV8A 5E6JA 2J7QC 1DF0A 3PHUA 4W4UA 5K16A 3BPFA 3QJ3A 2E01A 2PADA 4OVZB 2ATOA 4WA6A 3CH2X 3BBAA 4FK5A 1K3BB 2JQFR 4QH6A 2AIMA 1JQPA 2FQ9A 3V6CA 3E9SA 2R9MA 2G7YA 1NL6A 1TU6A 3MORA 1KHQA 3K24A 3OVZA 2BTWB 1QXPA 3HHIA 4P16A 2JQGR 2DJGB 4P6GA 4W5CA 3ZUAA 4G54A 3WXFA 1CB5A 3U8EA 4KLBA 4MM3B 3RVVA 2O6XA 3IOQA 3CBJA 1QMYA 1PXVA 1DEUA 1FH0A 4OVZA 4BOZA 1YZBA 2YJCA 2YJ9A 3BOWA 3HHAA 2PREA 2FE8A 4OELA 1U9XA 3KKUA 7PCKA 3BY4A 2JRIA 4M0WA 2B1MA 1EWLA 4R3DA 5EZSA 4P6EA 3LXSA 4PI3A 1UKFA 2HXZA 3BC3A 1F2BA 1AU3A 4YYWA 1U9VA 3USVA 2C0YA 1NQCA 2AYNA 4OW0A 2FYEA 1ZIVA 1PIPA 1AYVA 2DCAA 1ME3A 1YT7A 4CZWA 3BCNA 2R9NA 4I07A 4XUIA 2AGAA 2AYOA 2AUZA 3WXGA 4PT5A 1GLOA 3KX1A 3RVXA 1M6DA 3P5UA 3BB7A 2DJFB 3PHWA 4X6IA 3TRKA 2HWKA 4I04A 2AS8A 2CB5A 1BQIA 1KFXL 3IEJA 1MDWA 2ARYA 1CS8A 2DCDA 2BDZA 4YV8A 2JTCA 4YVAA 4YYSA 3F5VA 3S3QA 2GFOA 3OVXA 4FJCA 4MI7A 4CDEB 3QT4A 1BY8A 1STFE 2BDLA 3KWZA 1CSBB 1U9WA 3HWNA 2HD5A 2NQDB 2ACTA 4D8EA 1AIMA 3E1ZB 1PPOA 4AXMA 1F2AA 1AECA 4BS5A 1AU0A 1QOLA 4PADA 3IFUA 1ICFA 3PSEA 1S4VA 5EZQA 2B1NA 4N4ZA 2BU3A 1IWDA 2XU1A 3W31A 1GECE 1AU2A 3C0RA 3P5XA 4RF1A 4CDCB 3PRMA 3MJ5A 3MHHA 2F7DA 5CVOB 2F1GA 2UZJA 3B79A 2H7JA 2WBFX 2HH5A 2XU5A 3MP2A 3QSDA 3PHXA 4BOUA 3O0UA 2FRQA 1AYWA 2PBHA 1Y08A 2VHSA 4PP2E 3O1GA 3OISA 4QRXA 2AVWA 4YYVA 5PADA 2E00A 4YYUA 1DKIA 2HHNA 3GCBA 1EWOA 5FPWA 4BPVA 2NQAA 3W30A 1QDQA 2R6NA 5JA7A 2P86A 4X6JA 1MEGA 3LFYA 3MHSA 4I05A 2YJBA 1YK8A 1ZCMA 5J94A 4OEMA 2G8EA 4N8WA 4RY2A 3KW9A 3IHPA 1Q6KA 2CIOA 3S3RA 3K8UA 3CH3X 4ZTBA 4REZA 2DC9A 1YALA 3PW3A 2Z84A 3P5VA 3IMAA 4K7CA 4YYQA 1BP4A 2OP3A 2P7UA 5CVNB 5EGWA 4IP3A 1YK7A 5CVMA 2DC8A 4W5BA 4XZXA 4QBBA 3AI8A 3O65A 3NHEA 3RVWA 2OZ2A 1YVBA 3PT2A 2FO5A 1CJLA 4MZOA 2J7QA 2YJ8A 4D8IA 3PNRA 3OQCA 3IUTA 1VJVA 2G8JA 4PP1A 2VHFA 4MSXA 3N3GA 1VSNA 3IV2A 3I06A 3KWBX 3H7DA 1ATKA 4BOSA 1Y4HA 1KXRA 2DZZA 4BS6A 1TL9A 2FTDA 3M99A 5JZEA 4BOPA 2DZYA 2XU3A 2YJ2A 3BPMA 1MIRA 2P0RA 5KO3A 1EWMA 4ZUXU 4YYRA 3I3TA 4MZSA 2DCBA 3N4CA 2OULA 3MTNA 1AYUA 3WXEA 2DCCA 1XKGA 1CTEA 4AXLA 1PCIA 4BSQA 1U9QX 2R9CA 4X6HA 4IUMA 3PDFA 2E03A 3KSEA 3PRPA 8PCHA 4GUAA 3KFQA 1PE6A 1A6RA 4N79A 1ME4A 2IBIA 1NB5A 1KHPA 5EF4A 1MS6A 1AU4A 4FIPA 3H8CA 1PPDA 1CVZA 2NQGA 4WURA 1NPZA 3P5WA 1O0EA 4RF0A 2FRAA 1HUCB 4HXDB 5JH3A 2DC6A 3N3KA 4CDDB 4D8BA 3TMPA 2DC7A 1EWPA 2GHUA 4Q8HA 4QRVA 1PVJA 1EF7A 3F75A 5CHVA 1MHWA 4DMXA 2BTWA 4RKXA 1SNKA 4HWYA 4Q8GA 3DF0A 2Y6EA 5A24A 2AUXA 3ZNHA 3TNXA 2XU4A 1TLOA 2AU1A 1PPPA 4CDFB 2DOSA 2R9OA
chains in the Genus database with same CATH topology
3C9EA 5F02A 1SP4B 2PNSA 1PPNA 3OF8A 3H89A 1THEA 2NQIA 4DMYA 1F2CA 3D6SA 1X9YA 3PBHA 1ITOA 5CHTA 3LTWA 2IPPB 1CPJA 1U5IA 3ERVA 4XR7A 3H6SA 3BWKA 1NB3A 1MEMA 2R9FA 1NLJA 4QRGA 1KFUL 3K9MA 2FUDA 1GCBA 2E02A 1BGOA 1POPA 1CQDA 4BQVA 3CBKA 2Y5BA 1PBHA 1F29A 3HD3A 1PADA 6PADA 3V6EA 3OF9A 9PAPA 3H8BA 1GMYA 4NV8A 2G6DA 2FT2A 1CV8A 1DF0A 4W4UA 5K16A 3BPFA 3QJ3A 2E01A 2PADA 2ATOA 4WA6A 3CH2X 4FK5A 1K3BB 4C5PA 2JQFR 4QH6A 2AIMA 1JQPA 2FQ9A 3V6CA 2R9MA 2G7YA 1NL6A 1TU6A 3MORA 1KHQA 3K24A 3OVZA 1QXPA 3HHIA 2JQGR 2DJGB 4P6GA 4W5CA 3ZUAA 4G54A 3WXFA 1CB5A 3U8EA 4KLBA 3RVVA 2O6XA 3IOQA 3CBJA 1QMYA 1PXVA 1DEUA 1FH0A 2YJCA 2YJ9A 3BOWA 1GX3A 3HHAA 2PREA 4OELA 1U9XA 3KKUA 7PCKA 2B1MA 1EWLA 4P6EA 2BSZA 3LXSA 4PI3A 3BC3A 2HXZA 1F2BA 1AU3A 4YYWA 1U9VA 3USVA 2C0YA 1NQCA 2AYNA 1W4TA 2FYEA 1ZIVA 1PIPA 1AYVA 2DCAA 1ME3A 1YT7A 4CZWA 3BCNA 2R9NA 4I07A 4XUIA 2AYOA 2AUZA 3WXGA 1GLOA 3KX1A 3RVXA 1M6DA 3P5UA 2DJFB 4X6IA 4I04A 2AS8A 2CB5A 1BQIA 1KFXL 3IEJA 1MDWA 2ARYA 1CS8A 2DCDA 2BDZA 4YV8A 4NV7A 4YVAA 4YYSA 1E2TA 3F5VA 3S3QA 2GFOA 3OVXA 4FJCA 4CDEB 3QT4A 1BY8A 1STFE 2BDLA 3KWZA 1CSBB 1U9WA 3HWNA 2HD5A 2NQDB 2ACTA 1AIMA 3E1ZB 1PPOA 4AXMA 1F2AA 1AECA 4BS5A 1AU0A 1QOLA 4PADA 1ICFA 1S4VA 2B1NA 4N4ZA 1IWDA 2XU1A 1GECE 1AU2A 3P5XA 4CDCB 3MHHA 2F7DA 3D9WA 5CVOB 2F1GA 3B79A 2H7JA 2WBFX 2HH5A 2XU5A 3QSDA 3O0UA 2FRQA 1AYWA 2PBHA 1Y08A 2VHSA 4PP2E 3O1GA 3OISA 4QRXA 2AVWA 4YYVA 5PADA 2E00A 4YYUA 2HHNA 3GCBA 1EWOA 5FPWA 4BPVA 2NQAA 1QDQA 2R6NA 5JA7A 2P86A 4X6JA 1MEGA 3LFYA 3MHSA 4I05A 2YJBA 1YK8A 1ZCMA 5J94A 4OEMA 2G8EA 4N8WA 4RY2A 3KW9A 3IHPA 1Q6KA 2CIOA 3S3RA 3K8UA 3CH3X 2DC9A 1YALA 3PW3A 4BGFA 3P5VA 3IMAA 4K7CA 4YYQA 1BP4A 2OP3A 1W6FA 2P7UA 5CVNB 5EGWA 1YK7A 5CVMA 2DC8A 4W5BA 4B55A 4QBBA 3AI8A 3NHEA 3RVWA 2OZ2A 1YVBA 2FO5A 1CJLA 4MZOA 2YJ8A 3PNRA 3IUTA 1VJVA 2G8JA 2VFBA 4PP1A 2VHFA 4MSXA 3N3GA 2VFCA 1VSNA 3IV2A 3I06A 3KWBX 3H7DA 1ATKA 1Y4HA 1KXRA 2DZZA 4BS6A 1TL9A 2FTDA 3M99A 2DZYA 2XU3A 2YJ2A 3BPMA 1MIRA 2P0RA 1EWMA 4ZUXU 4YYRA 1W5RA 3I3TA 4MZSA 2DCBA 3N4CA 2OULA 3MTNA 1AYUA 3WXEA 2DCCA 1XKGA 1CTEA 4AXLA 1PCIA 4BSQA 1U9QX 2R9CA 4X6HA 3PDFA 2E03A 3KSEA 8PCHA 3KFQA 1PE6A 1A6RA 4N79A 1ME4A 2IBIA 1NB5A 1KHPA 5EF4A 1MS6A 1AU4A 4FIPA 3H8CA 4GUZA 1PPDA 1CVZA 2NQGA 1NPZA 3P5WA 1O0EA 2FRAA 1HUCB 5JH3A 2DC6A 3N3KA 4CDDB 2DC7A 1EWPA 2GHUA 4Q8HA 4QRVA 1EF7A 3F75A 5CHVA 1MHWA 4DMXA 1SNKA 4HWYA 4Q8GA 3DF0A 2Y6EA 5A24A 2AUXA 3TNXA 2XU4A 1TLOA 2AU1A 1PPPA 4CDFB 2R9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9E A;  5F02 A;  1SP4 B;  2PNS A;  1PPN A;  3OF8 A;  3H89 A;  1THE A;  2NQI A;  4DMY A;  1F2C A;  3D6S A;  1X9Y A;  3PBH A;  1ITO A;  5CHT A;  2IPP B;  1CPJ A;  1U5I A;  3ERV A;  4XR7 A;  3H6S A;  3BWK A;  1NB3 A;  1MEM A;  2R9F A;  1NLJ A;  4QRG A;  1KFU L;  3K9M A;  2FUD A;  1GCB A;  2E02 A;  1BGO A;  1POP A;  1CQD A;  4BQV A;  3CBK A;  2Y5B A;  1PBH A;  1F29 A;  3HD3 A;  1PAD A;  6PAD A;  3V6E A;  3OF9 A;  9PAP A;  3H8B A;  1GMY A;  2G6D A;  2FT2 A;  1CV8 A;  1DF0 A;  4W4U A;  5K16 A;  3BPF A;  3QJ3 A;  2E01 A;  2PAD A;  2ATO A;  4WA6 A;  3CH2 X;  4FK5 A;  1K3B B;  2JQF R;  4QH6 A;  2AIM A;  1JQP A;  2FQ9 A;  3V6C A;  2R9M A;  2G7Y A;  1NL6 A;  1TU6 A;  3MOR A;  1KHQ A;  3K24 A;  3OVZ A;  1QXP A;  3HHI A;  2JQG R;  2DJG B;  4P6G A;  4W5C A;  3ZUA A;  4G54 A;  3WXF A;  1CB5 A;  3U8E A;  4KLB A;  3RVV A;  2O6X A;  3IOQ A;  3CBJ A;  1QMY A;  1PXV A;  1DEU A;  1FH0 A;  2YJC A;  2YJ9 A;  3BOW A;  3HHA A;  2PRE A;  4OEL A;  1U9X A;  3KKU A;  7PCK A;  2B1M A;  1EWL A;  4P6E A;  3LXS A;  4PI3 A;  3BC3 A;  2HXZ A;  1F2B A;  1AU3 A;  4YYW A;  1U9V A;  3USV A;  2C0Y A;  1NQC A;  2AYN A;  2FYE A;  1ZIV A;  1PIP A;  1AYV A;  2DCA A;  1ME3 A;  1YT7 A;  4CZW A;  3BCN A;  2R9N A;  4I07 A;  4XUI A;  2AYO A;  2AUZ A;  3WXG A;  1GLO A;  3KX1 A;  3RVX A;  1M6D A;  3P5U A;  2DJF B;  4X6I A;  4I04 A;  2AS8 A;  2CB5 A;  1BQI A;  1KFX L;  3IEJ A;  1MDW A;  2ARY A;  1CS8 A;  2DCD A;  2BDZ A;  4YV8 A;  4YVA A;  4YYS A;  3F5V A;  3S3Q A;  2GFO A;  3OVX A;  4FJC A;  4CDE B;  3QT4 A;  1BY8 A;  1STF E;  2BDL A;  3KWZ A;  1CSB B;  1U9W A;  3HWN A;  2HD5 A;  2NQD B;  2ACT A;  1AIM A;  3E1Z B;  1PPO A;  4AXM A;  1F2A A;  1AEC A;  4BS5 A;  1AU0 A;  4PAD A;  1QOL A;  1ICF A;  1S4V A;  2B1N A;  4N4Z A;  1IWD A;  2XU1 A;  1GEC E;  1AU2 A;  3P5X A;  4CDC B;  3MHH A;  2F7D A;  5CVO B;  2F1G A;  3B79 A;  2H7J A;  2WBF X;  2HH5 A;  2XU5 A;  3QSD A;  3O0U A;  2FRQ A;  1AYW A;  2PBH A;  1Y08 A;  2VHS A;  4PP2 E;  3O1G A;  3OIS A;  4QRX A;  2AVW A;  4YYV A;  5PAD A;  2E00 A;  4YYU A;  2HHN A;  3GCB A;  1EWO A;  5FPW A;  4BPV A;  2NQA A;  1QDQ A;  2R6N A;  5JA7 A;  2P86 A;  4X6J A;  1MEG A;  3LFY A;  3MHS A;  4I05 A;  2YJB A;  1YK8 A;  1ZCM A;  5J94 A;  4OEM A;  2G8E A;  4N8W A;  4RY2 A;  3KW9 A;  3IHP A;  1Q6K A;  2CIO A;  3S3R A;  3K8U A;  3CH3 X;  2DC9 A;  1YAL A;  3PW3 A;  3P5V A;  3IMA A;  4K7C A;  4YYQ A;  1BP4 A;  2OP3 A;  2P7U A;  5CVN B;  5EGW A;  1YK7 A;  5CVM A;  2DC8 A;  4W5B A;  4QBB A;  3AI8 A;  3NHE A;  3RVW A;  2OZ2 A;  1YVB A;  2FO5 A;  1CJL A;  4MZO A;  2YJ8 A;  3PNR A;  3IUT A;  1VJV A;  2G8J A;  4PP1 A;  2VHF A;  4MSX A;  3N3G A;  1VSN A;  3IV2 A;  3I06 A;  3KWB X;  3H7D A;  1ATK A;  1Y4H A;  1KXR A;  2DZZ A;  4BS6 A;  1TL9 A;  2FTD A;  3M99 A;  2DZY A;  2XU3 A;  2YJ2 A;  3BPM A;  1MIR A;  2P0R A;  1EWM A;  4ZUX U;  4YYR A;  3I3T A;  4MZS A;  2DCB A;  3N4C A;  2OUL A;  3MTN A;  1AYU A;  3WXE A;  2DCC A;  1XKG A;  1CTE A;  4AXL A;  1PCI A;  4BSQ A;  1U9Q X;  2R9C A;  4X6H A;  3PDF A;  2E03 A;  3KSE A;  8PCH A;  3KFQ A;  1PE6 A;  1A6R A;  4N79 A;  1ME4 A;  2IBI A;  1NB5 A;  1KHP A;  5EF4 A;  1MS6 A;  1AU4 A;  4FIP A;  3H8C A;  1PPD A;  1CVZ A;  2NQG A;  1NPZ A;  3P5W A;  1O0E A;  2FRA A;  1HUC B;  5JH3 A;  2DC6 A;  3N3K A;  4CDD B;  2DC7 A;  1EWP A;  2GHU A;  4Q8H A;  4QRV A;  1EF7 A;  3F75 A;  5CHV A;  1MHW A;  4DMX A;  1SNK A;  4HWY A;  4Q8G A;  3DF0 A;  2Y6E A;  5A24 A;  2AUX A;  3TNX A;  2XU4 A;  1TLO A;  2AU1 A;  1PPP A;  4CDF B;  2R9O A; 
#chains in the Genus database with same CATH topology
 3C9E A;  5F02 A;  1SP4 B;  2PNS A;  1PPN A;  3RNV A;  3OF8 A;  3H89 A;  1THE A;  2NQI A;  4DMY A;  1F2C A;  3D6S A;  1X9Y A;  3PBH A;  1ITO A;  5CHT A;  2IPP B;  1CPJ A;  1U5I A;  3ERV A;  4XR7 A;  3H6S A;  3BWK A;  1NB3 A;  1MEM A;  2R9F A;  1NLJ A;  4QRG A;  1KFU L;  3K9M A;  2FUD A;  1GCB A;  2E02 A;  1BGO A;  4BOQ A;  1POP A;  1CQD A;  4BQV A;  4A5U A;  3CBK A;  2Y5B A;  1PBH A;  4RNA A;  1F29 A;  3B21 A;  3HD3 A;  1PAD A;  6PAD A;  3MTV A;  3V6E A;  3OF9 A;  9PAP A;  3H8B A;  1GMY A;  2G6D A;  2FT2 A;  1CV8 A;  5E6J A;  2J7Q C;  1DF0 A;  3PHU A;  4W4U A;  5K16 A;  3BPF A;  3QJ3 A;  2E01 A;  2PAD A;  4OVZ B;  2ATO A;  4WA6 A;  3CH2 X;  3BBA A;  4FK5 A;  1K3B B;  2JQF R;  4QH6 A;  2AIM A;  1JQP A;  2FQ9 A;  3V6C A;  3E9S A;  2R9M A;  2G7Y A;  1NL6 A;  1TU6 A;  3MOR A;  1KHQ A;  3K24 A;  3OVZ A;  2BTW B;  1QXP A;  3HHI A;  4P16 A;  2JQG R;  2DJG B;  4P6G A;  4W5C A;  3ZUA A;  4G54 A;  3WXF A;  1CB5 A;  3U8E A;  4KLB A;  4MM3 B;  3RVV A;  2O6X A;  3IOQ A;  3CBJ A;  1QMY A;  1PXV A;  1DEU A;  1FH0 A;  4OVZ A;  4BOZ A;  1YZB A;  2YJC A;  2YJ9 A;  3BOW A;  3HHA A;  2PRE A;  2FE8 A;  4OEL A;  1U9X A;  3KKU A;  7PCK A;  3BY4 A;  2JRI A;  4M0W A;  2B1M A;  1EWL A;  4R3D A;  5EZS A;  4P6E A;  3LXS A;  4PI3 A;  1UKF A;  2HXZ A;  3BC3 A;  1F2B A;  1AU3 A;  4YYW A;  1U9V A;  3USV A;  2C0Y A;  1NQC A;  2AYN A;  4OW0 A;  2FYE A;  1ZIV A;  1PIP A;  1AYV A;  2DCA A;  1ME3 A;  1YT7 A;  4CZW A;  3BCN A;  2R9N A;  4I07 A;  4XUI A;  2AGA A;  2AYO A;  2AUZ A;  3WXG A;  4PT5 A;  1GLO A;  3KX1 A;  3RVX A;  1M6D A;  3P5U A;  3BB7 A;  2DJF B;  3PHW A;  4X6I A;  3TRK A;  2HWK A;  4I04 A;  2AS8 A;  2CB5 A;  1BQI A;  1KFX L;  3IEJ A;  1MDW A;  2ARY A;  1CS8 A;  2DCD A;  2BDZ A;  4YV8 A;  2JTC A;  4YVA A;  4YYS A;  3F5V A;  3S3Q A;  2GFO A;  3OVX A;  4FJC A;  4MI7 A;  4CDE B;  3QT4 A;  1BY8 A;  1STF E;  2BDL A;  3KWZ A;  1CSB B;  1U9W A;  3HWN A;  2HD5 A;  2NQD B;  2ACT A;  4D8E A;  1AIM A;  3E1Z B;  1PPO A;  4AXM A;  1F2A A;  1AEC A;  4BS5 A;  1AU0 A;  1QOL A;  4PAD A;  3IFU A;  1ICF A;  3PSE A;  1S4V A;  5EZQ A;  2B1N A;  4N4Z A;  2BU3 A;  1IWD A;  2XU1 A;  3W31 A;  1GEC E;  1AU2 A;  3C0R A;  3P5X A;  4RF1 A;  4CDC B;  3PRM A;  3MJ5 A;  3MHH A;  2F7D A;  5CVO B;  2F1G A;  2UZJ A;  3B79 A;  2H7J A;  2WBF X;  2HH5 A;  2XU5 A;  3MP2 A;  3QSD A;  3PHX A;  4BOU A;  3O0U A;  2FRQ A;  1AYW A;  2PBH A;  1Y08 A;  2VHS A;  4PP2 E;  3O1G A;  3OIS A;  4QRX A;  2AVW A;  4YYV A;  5PAD A;  2E00 A;  4YYU A;  1DKI A;  2HHN A;  3GCB A;  1EWO A;  5FPW A;  4BPV A;  2NQA A;  3W30 A;  1QDQ A;  2R6N A;  5JA7 A;  2P86 A;  4X6J A;  1MEG A;  3LFY A;  3MHS A;  4I05 A;  2YJB A;  1YK8 A;  1ZCM A;  5J94 A;  4OEM A;  2G8E A;  4N8W A;  4RY2 A;  3KW9 A;  3IHP A;  1Q6K A;  2CIO A;  3S3R A;  3K8U A;  3CH3 X;  4ZTB A;  4REZ A;  2DC9 A;  1YAL A;  3PW3 A;  2Z84 A;  3P5V A;  3IMA A;  4K7C A;  4YYQ A;  1BP4 A;  2OP3 A;  2P7U A;  5CVN B;  5EGW A;  4IP3 A;  1YK7 A;  5CVM A;  2DC8 A;  4W5B A;  4XZX A;  4QBB A;  3AI8 A;  3O65 A;  3NHE A;  3RVW A;  2OZ2 A;  1YVB A;  3PT2 A;  2FO5 A;  1CJL A;  4MZO A;  2J7Q A;  2YJ8 A;  4D8I A;  3PNR A;  3OQC A;  3IUT A;  1VJV A;  2G8J A;  4PP1 A;  2VHF A;  4MSX A;  3N3G A;  1VSN A;  3IV2 A;  3I06 A;  3KWB X;  3H7D A;  1ATK A;  4BOS A;  1Y4H A;  1KXR A;  2DZZ A;  4BS6 A;  1TL9 A;  2FTD A;  3M99 A;  5JZE A;  4BOP A;  2DZY A;  2XU3 A;  2YJ2 A;  3BPM A;  1MIR A;  2P0R A;  5KO3 A;  1EWM A;  4ZUX U;  4YYR A;  3I3T A;  4MZS A;  2DCB A;  3N4C A;  2OUL A;  3MTN A;  1AYU A;  3WXE A;  2DCC A;  1XKG A;  1CTE A;  4AXL A;  1PCI A;  4BSQ A;  1U9Q X;  2R9C A;  4X6H A;  4IUM A;  3PDF A;  2E03 A;  3KSE A;  3PRP A;  8PCH A;  4GUA A;  3KFQ A;  1PE6 A;  1A6R A;  4N79 A;  1ME4 A;  2IBI A;  1NB5 A;  1KHP A;  5EF4 A;  1MS6 A;  1AU4 A;  4FIP A;  3H8C A;  1PPD A;  1CVZ A;  2NQG A;  4WUR A;  1NPZ A;  3P5W A;  1O0E A;  4RF0 A;  2FRA A;  1HUC B;  4HXD B;  5JH3 A;  2DC6 A;  3N3K A;  4CDD B;  4D8B A;  3TMP A;  2DC7 A;  1EWP A;  2GHU A;  4Q8H A;  4QRV A;  1PVJ A;  1EF7 A;  3F75 A;  5CHV A;  1MHW A;  4DMX A;  2BTW A;  4RKX A;  1SNK A;  4HWY A;  4Q8G A;  3DF0 A;  2Y6E A;  5A24 A;  2AUX A;  3ZNH A;  3TNX A;  2XU4 A;  1TLO A;  2AU1 A;  1PPP A;  4CDF B;  2DOS A;  2R9O A; 
#chains in the Genus database with same CATH homology
 3C9E A;  5F02 A;  1SP4 B;  2PNS A;  1PPN A;  3OF8 A;  3H89 A;  1THE A;  2NQI A;  4DMY A;  1F2C A;  3D6S A;  1X9Y A;  3PBH A;  1ITO A;  5CHT A;  3LTW A;  2IPP B;  1CPJ A;  1U5I A;  3ERV A;  4XR7 A;  3H6S A;  3BWK A;  1NB3 A;  1MEM A;  2R9F A;  1NLJ A;  4QRG A;  1KFU L;  3K9M A;  2FUD A;  1GCB A;  2E02 A;  1BGO A;  1POP A;  1CQD A;  4BQV A;  3CBK A;  2Y5B A;  1PBH A;  1F29 A;  3HD3 A;  1PAD A;  6PAD A;  3V6E A;  3OF9 A;  9PAP A;  3H8B A;  1GMY A;  4NV8 A;  2G6D A;  2FT2 A;  1CV8 A;  1DF0 A;  4W4U A;  5K16 A;  3BPF A;  3QJ3 A;  2E01 A;  2PAD A;  2ATO A;  4WA6 A;  3CH2 X;  4FK5 A;  1K3B B;  4C5P A;  2JQF R;  4QH6 A;  2AIM A;  1JQP A;  2FQ9 A;  3V6C A;  2R9M A;  2G7Y A;  1NL6 A;  1TU6 A;  3MOR A;  1KHQ A;  3K24 A;  3OVZ A;  1QXP A;  3HHI A;  2JQG R;  2DJG B;  4P6G A;  4W5C A;  3ZUA A;  4G54 A;  3WXF A;  1CB5 A;  3U8E A;  4KLB A;  3RVV A;  2O6X A;  3IOQ A;  3CBJ A;  1QMY A;  1PXV A;  1DEU A;  1FH0 A;  2YJC A;  2YJ9 A;  3BOW A;  1GX3 A;  3HHA A;  2PRE A;  4OEL A;  1U9X A;  3KKU A;  7PCK A;  2B1M A;  1EWL A;  4P6E A;  2BSZ A;  3LXS A;  4PI3 A;  3BC3 A;  2HXZ A;  1F2B A;  1AU3 A;  4YYW A;  1U9V A;  3USV A;  2C0Y A;  1NQC A;  2AYN A;  1W4T A;  2FYE A;  1ZIV A;  1PIP A;  1AYV A;  2DCA A;  1ME3 A;  1YT7 A;  4CZW A;  3BCN A;  2R9N A;  4I07 A;  4XUI A;  2AYO A;  2AUZ A;  3WXG A;  1GLO A;  3KX1 A;  3RVX A;  1M6D A;  3P5U A;  2DJF B;  4X6I A;  4I04 A;  2AS8 A;  2CB5 A;  1BQI A;  1KFX L;  3IEJ A;  1MDW A;  2ARY A;  1CS8 A;  2DCD A;  2BDZ A;  4YV8 A;  4NV7 A;  4YVA A;  4YYS A;  1E2T A;  3F5V A;  3S3Q A;  2GFO A;  3OVX A;  4FJC A;  4CDE B;  3QT4 A;  1BY8 A;  1STF E;  2BDL A;  3KWZ A;  1CSB B;  1U9W A;  3HWN A;  2HD5 A;  2NQD B;  2ACT A;  1AIM A;  3E1Z B;  1PPO A;  4AXM A;  1F2A A;  1AEC A;  4BS5 A;  1AU0 A;  1QOL A;  4PAD A;  1ICF A;  1S4V A;  2B1N A;  4N4Z A;  1IWD A;  2XU1 A;  1GEC E;  1AU2 A;  3P5X A;  4CDC B;  3MHH A;  2F7D A;  3D9W A;  5CVO B;  2F1G A;  3B79 A;  2H7J A;  2WBF X;  2HH5 A;  2XU5 A;  3QSD A;  3O0U A;  2FRQ A;  1AYW A;  2PBH A;  1Y08 A;  2VHS A;  4PP2 E;  3O1G A;  3OIS A;  4QRX A;  2AVW A;  4YYV A;  5PAD A;  2E00 A;  4YYU A;  2HHN A;  3GCB A;  1EWO A;  5FPW A;  4BPV A;  2NQA A;  1QDQ A;  2R6N A;  5JA7 A;  2P86 A;  4X6J A;  1MEG A;  3LFY A;  3MHS A;  4I05 A;  2YJB A;  1YK8 A;  1ZCM A;  5J94 A;  4OEM A;  2G8E A;  4N8W A;  4RY2 A;  3KW9 A;  3IHP A;  1Q6K A;  2CIO A;  3S3R A;  3K8U A;  3CH3 X;  2DC9 A;  1YAL A;  3PW3 A;  4BGF A;  3P5V A;  3IMA A;  4K7C A;  4YYQ A;  1BP4 A;  2OP3 A;  1W6F A;  2P7U A;  5CVN B;  5EGW A;  1YK7 A;  5CVM A;  2DC8 A;  4W5B A;  4B55 A;  4QBB A;  3AI8 A;  3NHE A;  3RVW A;  2OZ2 A;  1YVB A;  2FO5 A;  1CJL A;  4MZO A;  2YJ8 A;  3PNR A;  3IUT A;  1VJV A;  2G8J A;  2VFB A;  4PP1 A;  2VHF A;  4MSX A;  3N3G A;  2VFC A;  1VSN A;  3IV2 A;  3I06 A;  3KWB X;  3H7D A;  1ATK A;  1Y4H A;  1KXR A;  2DZZ A;  4BS6 A;  1TL9 A;  2FTD A;  3M99 A;  2DZY A;  2XU3 A;  2YJ2 A;  3BPM A;  1MIR A;  2P0R A;  1EWM A;  4ZUX U;  4YYR A;  1W5R A;  3I3T A;  4MZS A;  2DCB A;  3N4C A;  2OUL A;  3MTN A;  1AYU A;  3WXE A;  2DCC A;  1XKG A;  1CTE A;  4AXL A;  1PCI A;  4BSQ A;  1U9Q X;  2R9C A;  4X6H A;  3PDF A;  2E03 A;  3KSE A;  8PCH A;  3KFQ A;  1PE6 A;  1A6R A;  4N79 A;  1ME4 A;  2IBI A;  1NB5 A;  1KHP A;  5EF4 A;  1MS6 A;  1AU4 A;  4FIP A;  3H8C A;  4GUZ A;  1PPD A;  1CVZ A;  2NQG A;  1NPZ A;  3P5W A;  1O0E A;  2FRA A;  1HUC B;  5JH3 A;  2DC6 A;  3N3K A;  4CDD B;  2DC7 A;  1EWP A;  2GHU A;  4Q8H A;  4QRV A;  1EF7 A;  3F75 A;  5CHV A;  1MHW A;  4DMX A;  1SNK A;  4HWY A;  4Q8G A;  3DF0 A;  2Y6E A;  5A24 A;  2AUX A;  3TNX A;  2XU4 A;  1TLO A;  2AU1 A;  1PPP A;  4CDF B;  2R9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...