1IWDA

Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
LPSFVDWRSKGAVNSIKNQKQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLRVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proposed amino acid sequence and the 1.63 A X-ray crystal structure of a plant cysteine protease, ervatamin B: Some insights into the structural basis of its stability and substrate specificity
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ERVATAMIN B
total genus 67
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1iwdA00
5J94A 1QXPA 3IMAA 2P86A 4FJCA 2FRAA 3HWNA 4W5BA 8PCHA 2R9CA 1AIMA 3MHSA 1Q6KA 1CJLA 1POPA 1U9QX 3P5UA 4OELA 2AIMA 1GCBA 3OF8A 2HH5A 3CH2X 5CHVA 1BY8A 1QDQA 1ZIVA 2F1GA 1JQPA 2R9FA 2DJGB 4CZWA 2AS8A 4Q8HA 1ICFA 1YALA 2BDLA 4CDEB 1SNKA 3V6CA 1Y4HA 1Y08A 1MS6A 2FO5A 2P0RA 4MZOA 2FQ9A 1PPOA 1KHPA 3B79A 2AYNA 4OEMA 1NLJA 2GFOA 2CB5A 1ATKA 4WA6A 4K7CA 4HWYA 5FPWA 3S3QA 4YYRA 4AXMA 2DC7A 2AU1A 3K8UA 3AI8A 4I05A 2XU1A 1AU2A 4MSXA 2DZYA 1AYWA 3H89A 2G8EA 3IV2A 4PP1A 1QOLA 3P5WA 1CTEA 3RVVA 1PE6A 2G7YA 3WXEA 4YYWA 4I07A 2FYEA 4YYSA 2NQDB 5CVMA 3MORA 3H7DA 1KXRA 3I3TA 4YYVA 2VHFA 5EGWA 2DC8A 4CDDB 2GHUA 1S4VA 2B1MA 3HHIA 3D6SA 3P5VA 3GCBA 2YJ9A 3F75A 1THEA 3TNXA 1CV8A 3LFYA 1CSBB 3QSDA 2JQGR 1EWPA 2IPPB 4BS6A 3USVA 1VSNA 3H8CA 1CB5A 1F29A 4RY2A 3H6SA 2G6DA 3I06A 2DC6A 1NQCA 2YJCA 3BOWA 4PI3A 6PADA 7PCKA 2YJBA 4FIPA 2ARYA 2FUDA 3HHAA 2B1NA 1GMYA 1XKGA 3CBJA 2YJ2A 3KSEA 4X6HA 3WXGA 3BC3A 2NQGA 2OP3A 1YT7A 4XR7A 1QMYA 2DJFB 1PBHA 2P7UA 1BGOA 2OZ2A 1PIPA 3KWBX 1A6RA 3V6EA 2IBIA 3O0UA 2R6NA 9PAPA 4QBBA 3N3KA 4MZSA 2HXZA 5PADA 1PCIA 2VHSA 1U9VA 2AYOA 3ZUAA 2G8JA 3IOQA 3WXFA 1EF7A 3KX1A 1MDWA 1O0EA 4BPVA 3BWKA 2BDZA 1YK8A 3KW9A 1F2AA 3K24A 1EWMA 1ME3A 1KHQA 4CDFB 2PNSA 3N3GA 4FK5A 3NHEA 3BPFA 4ZUXU 3M99A 3DF0A 4DMYA 1MIRA 1GLOA 2H7JA 1DF0A 2Y6EA 2E03A 1EWLA 5CHTA 5F02A 2CIOA 2OULA 1KFUL 4PP2E 4XUIA 1YK7A 1PPPA 1NPZA 2R9OA 5EF4A 1M6DA 2PREA 5K16A 2DCAA 4YYQA 1TLOA 2DCCA 3U8EA 3N4CA 3O1GA 4DMXA 3OISA 2E02A 4P6GA 4P6EA 1NB5A 1MEMA 3S3RA 2R9NA 2E00A 3E1ZB 2FTDA 1VJVA 4PADA 3IEJA 4W5CA 3QT4A 3PNRA 3PDFA 2HD5A 1HUCB 2Y5BA 3BPMA 1YVBA 4QRGA 5CVNB 1X9YA 2R9MA 1K3BB 1DEUA 1U9XA 1MEGA 3C9EA 4KLBA 1ME4A 3KWZA 3CH3X 3KFQA 2JQFR 1PPNA 3HD3A 1STFE 3IHPA 1IWDA 2NQAA 1FH0A 3OVZA 1CVZA 2DZZA 4Q8GA 3MTNA 3OVXA 2HHNA 1CPJA 5JH3A 4BS5A 1F2CA 2ACTA 2FT2A 4BQVA 3P5XA 5A24A 3IUTA 2XU4A 3ERVA 3MHHA 5JA7A 2DCBA 1ITOA 3CBKA 1SP4B 3K9MA 1BP4A 2XU5A 1U9WA 1AU0A 4X6JA 1TL9A 3PBHA 2FRQA 1F2BA 5CVOB 2NQIA 3RVWA 2PBHA 4G54A 4N8WA 2WBFX 3QJ3A 4X6IA 1GECE 4YVAA 4W4UA 4QH6A 1AYVA 1NL6A 1PADA 4YYUA 4N79A 2XU3A 1TU6A 4YV8A 1PPDA 1AYUA 3F5VA 2AVWA 4CDCB 2DCDA 1EWOA 1CS8A 1NB3A 1U5IA 1ZCMA 2DC9A 2AUZA 2ATOA 2PADA 4BSQA 4QRXA 2F7DA 4AXLA 3PW3A 3LXSA 1BQIA 4QRVA 1MHWA 3RVXA 1AU4A 1AECA 1CQDA 2C0YA 3KKUA 2O6XA 2YJ8A 1AU3A 2E01A 1PXVA 3BCNA 4I04A 3H8BA 2AUXA 1KFXL 4N4ZA 3OF9A
chains in the Genus database with same CATH superfamily
4XZXA 5J94A 1QXPA 4MI7A 3IMAA 2P86A 4FJCA 2FRAA 3HWNA 4W5BA 8PCHA 2R9CA 1AIMA 3MHSA 1Q6KA 2FE8A 1CJLA 1POPA 1U9QX 3P5UA 4IUMA 4OELA 2AIMA 3W30A 1GCBA 3BB7A 3OF8A 4RF1A 2HH5A 3CH2X 5CHVA 4WURA 1BY8A 1QDQA 1ZIVA 2F1GA 1JQPA 2R9FA 2DJGB 4CZWA 2AS8A 4Q8HA 1ICFA 1YALA 2BDLA 4CDEB 1SNKA 3V6CA 4BOZA 4RF0A 1Y4HA 1Y08A 1MS6A 2FO5A 2P0RA 4MZOA 2FQ9A 1PPOA 1KHPA 3B79A 2AYNA 3PHUA 4OEMA 1NLJA 2GFOA 2CB5A 1ATKA 4WA6A 4K7CA 4HWYA 5FPWA 3PHXA 3S3QA 4YYRA 4AXMA 2DC7A 2AU1A 3K8UA 2Z84A 3AI8A 4I05A 2XU1A 1AU2A 4MSXA 2DZYA 1AYWA 4HXDB 3H89A 2G8EA 3IV2A 4PP1A 1QOLA 3P5WA 4RKXA 1CTEA 3RVVA 1PE6A 2G7YA 3WXEA 4YYWA 4I07A 2FYEA 4YYSA 2NQDB 5E6JA 4BOSA 5CVMA 3MORA 3H7DA 1KXRA 2BU3A 3I3TA 4YYVA 2VHFA 4OVZB 5EGWA 2DC8A 4CDDB 2GHUA 3PHWA 1S4VA 4D8EA 2B1MA 3HHIA 3D6SA 3P5VA 3GCBA 2YJ9A 3F75A 1THEA 3TNXA 1CV8A 3W31A 3LFYA 1CSBB 5KO3A 3QSDA 2JQGR 1EWPA 2IPPB 4BS6A 3USVA 1VSNA 3H8CA 1CB5A 1F29A 4RY2A 3H6SA 2G6DA 3PRPA 3I06A 2DC6A 3PRMA 1NQCA 4A5UA 2YJCA 3BOWA 4PI3A 6PADA 2BTWA 7PCKA 2YJBA 4FIPA 2ARYA 2FUDA 3HHAA 2B1NA 1GMYA 1XKGA 3CBJA 2AGAA 2YJ2A 3KSEA 4X6HA 4ZTBA 2JTCA 2HWKA 3WXGA 3BC3A 2NQGA 2OP3A 1YT7A 4XR7A 1QMYA 2DJFB 1PBHA 2P7UA 1BGOA 2OZ2A 4GUAA 3O65A 1PIPA 3KWBX 1YZBA 3TMPA 2JRIA 1A6RA 3V6EA 2IBIA 4RNAA 3O0UA 2R6NA 4REZA 9PAPA 4QBBA 3N3KA 4MZSA 2HXZA 5PADA 1PCIA 2VHSA 1U9VA 2AYOA 3ZUAA 2G8JA 3IOQA 3WXFA 1EF7A 3KX1A 1MDWA 1O0EA 4BPVA 3BWKA 2BDZA 1YK8A 3KW9A 1F2AA 3K24A 1EWMA 1ME3A 3RNVA 1KHQA 4CDFB 2PNSA 3MTVA 4BOUA 3N3GA 4FK5A 3NHEA 3BPFA 4ZUXU 3M99A 3DF0A 3TRKA 4DMYA 1MIRA 1GLOA 2H7JA 1DF0A 2Y6EA 2E03A 1EWLA 5CHTA 5F02A 2CIOA 2OULA 1KFUL 4PP2E 4XUIA 1YK7A 5JZEA 1PPPA 3B21A 1NPZA 2R9OA 5EF4A 1M6DA 2PREA 5K16A 2DCAA 4YYQA 4M0WA 1TLOA 2DCCA 3U8EA 3N4CA 3O1GA 4DMXA 3OISA 2E02A 4P6GA 4P6EA 1NB5A 1MEMA 3S3RA 4R3DA 2R9NA 2E00A 3E1ZB 3PT2A 2FTDA 1VJVA 1UKFA 4PADA 3IEJA 4W5CA 3QT4A 3PNRA 3PDFA 2HD5A 1HUCB 2Y5BA 3BPMA 1YVBA 1X9YA 2R9MA 4QRGA 5CVNB 3OQCA 1K3BB 3BY4A 1DEUA 1U9XA 1MEGA 3C9EA 4KLBA 1ME4A 3KWZA 3CH3X 3KFQA 2JQFR 1PPNA 3HD3A 1STFE 3IHPA 1IWDA 2NQAA 1FH0A 3OVZA 1CVZA 2DZZA 4Q8GA 3MTNA 2DOSA 3OVXA 2HHNA 1DKIA 1CPJA 5JH3A 4BS5A 1F2CA 2ACTA 2FT2A 4OW0A 4BQVA 3P5XA 5A24A 3IUTA 2XU4A 3ERVA 3MHHA 5JA7A 2DCBA 1ITOA 3CBKA 1SP4B 4D8BA 3K9MA 1BP4A 2XU5A 1U9WA 1AU0A 4P16A 2UZJA 4X6JA 2BTWB 4IP3A 2J7QC 1TL9A 3PBHA 2FRQA 1F2BA 5CVOB 2NQIA 3RVWA 2PBHA 4G54A 4N8WA 2WBFX 3QJ3A 4X6IA 1GECE 4YVAA 4PT5A 4W4UA 4BOPA 4QH6A 1AYVA 1NL6A 1PADA 4YYUA 3E9SA 4N79A 2XU3A 5EZSA 1TU6A 4YV8A 1PPDA 1AYUA 1PVJA 3F5VA 2AVWA 4BOQA 4OVZA 4CDCB 2DCDA 1EWOA 1CS8A 1NB3A 1U5IA 1ZCMA 3ZNHA 2DC9A 2AUZA 2ATOA 3BBAA 3MP2A 2PADA 4BSQA 4QRXA 2F7DA 4AXLA 3PW3A 3LXSA 1BQIA 4QRVA 3IFUA 1MHWA 3RVXA 1AU4A 1AECA 1CQDA 2C0YA 3KKUA 2J7QA 3MJ5A 2O6XA 2YJ8A 4MM3B 1AU3A 2E01A 1PXVA 3BCNA 4I04A 3H8BA 2AUXA 1KFXL 4N4ZA 4D8IA 3OF9A 3C0RA 3PSEA 5EZQA
chains in the Genus database with same CATH topology
5J94A 1QXPA 3IMAA 2P86A 4FJCA 2FRAA 3HWNA 4W5BA 8PCHA 2R9CA 1AIMA 3MHSA 1Q6KA 1CJLA 1POPA 1U9QX 3P5UA 4OELA 2AIMA 1GCBA 3OF8A 2HH5A 3CH2X 5CHVA 1BY8A 1QDQA 1ZIVA 2F1GA 1JQPA 4BGFA 2R9FA 2DJGB 4CZWA 2AS8A 4Q8HA 2VFBA 1ICFA 1YALA 2BDLA 4CDEB 1SNKA 3V6CA 4GUZA 3D9WA 1Y4HA 1Y08A 1MS6A 2FO5A 2P0RA 4MZOA 2FQ9A 1PPOA 1KHPA 3B79A 2AYNA 4OEMA 1NLJA 2GFOA 2CB5A 1ATKA 4WA6A 4K7CA 4HWYA 1W5RA 5FPWA 3S3QA 4YYRA 4AXMA 2DC7A 2AU1A 3K8UA 3AI8A 4I05A 2XU1A 1AU2A 4MSXA 2DZYA 1AYWA 3H89A 2G8EA 3IV2A 4PP1A 1GX3A 1QOLA 3P5WA 1CTEA 3RVVA 1PE6A 2G7YA 3WXEA 4YYWA 4I07A 2FYEA 4C5PA 4YYSA 2NQDB 5CVMA 3MORA 3H7DA 1KXRA 3I3TA 4YYVA 2VHFA 5EGWA 2DC8A 4CDDB 2GHUA 1S4VA 2B1MA 3HHIA 3D6SA 3P5VA 3GCBA 2YJ9A 3F75A 1THEA 3TNXA 1CV8A 3LFYA 1CSBB 3QSDA 2JQGR 1EWPA 2IPPB 4BS6A 3USVA 1VSNA 3H8CA 1CB5A 1F29A 4RY2A 4NV7A 3H6SA 2G6DA 3I06A 2DC6A 1NQCA 1W4TA 2YJCA 3BOWA 4PI3A 6PADA 7PCKA 2YJBA 4FIPA 2ARYA 2FUDA 3LTWA 3HHAA 2B1NA 1GMYA 1XKGA 3CBJA 2YJ2A 3KSEA 4X6HA 3WXGA 3BC3A 2NQGA 2OP3A 1YT7A 4XR7A 1QMYA 2DJFB 1PBHA 2P7UA 1BGOA 2OZ2A 1PIPA 3KWBX 1A6RA 3V6EA 2IBIA 3O0UA 2R6NA 4NV8A 9PAPA 4QBBA 3N3KA 4MZSA 2HXZA 5PADA 1PCIA 2VHSA 1U9VA 2AYOA 3ZUAA 2G8JA 3IOQA 3WXFA 1EF7A 3KX1A 1MDWA 1O0EA 4BPVA 3BWKA 2BDZA 1YK8A 3KW9A 1F2AA 3K24A 2VFCA 1EWMA 1ME3A 1KHQA 4CDFB 2PNSA 3N3GA 4FK5A 3NHEA 3BPFA 4ZUXU 3M99A 3DF0A 4DMYA 1MIRA 1GLOA 2H7JA 1DF0A 2Y6EA 2E03A 4B55A 1EWLA 5CHTA 5F02A 2CIOA 2OULA 1KFUL 4PP2E 4XUIA 1YK7A 1PPPA 1NPZA 2R9OA 5EF4A 1M6DA 2PREA 5K16A 2DCAA 4YYQA 1TLOA 2DCCA 3U8EA 2BSZA 3N4CA 3O1GA 4DMXA 3OISA 2E02A 4P6GA 4P6EA 1NB5A 1MEMA 3S3RA 2R9NA 2E00A 3E1ZB 2FTDA 1VJVA 4PADA 3IEJA 4W5CA 3QT4A 3PNRA 3PDFA 2HD5A 1HUCB 2Y5BA 3BPMA 1YVBA 4QRGA 5CVNB 1X9YA 2R9MA 1K3BB 1DEUA 1U9XA 1MEGA 3C9EA 4KLBA 1ME4A 3KWZA 3CH3X 3KFQA 2JQFR 1PPNA 3HD3A 1STFE 3IHPA 1IWDA 2NQAA 1FH0A 3OVZA 1CVZA 2DZZA 4Q8GA 3MTNA 3OVXA 2HHNA 1CPJA 5JH3A 4BS5A 1F2CA 2ACTA 2FT2A 4BQVA 3P5XA 5A24A 3IUTA 2XU4A 3ERVA 3MHHA 5JA7A 2DCBA 1ITOA 3CBKA 1SP4B 3K9MA 1BP4A 2XU5A 1U9WA 1AU0A 4X6JA 1TL9A 3PBHA 2FRQA 1F2BA 5CVOB 2NQIA 3RVWA 2PBHA 4G54A 4N8WA 2WBFX 3QJ3A 4X6IA 1GECE 4YVAA 4W4UA 4QH6A 1E2TA 1AYVA 1PADA 1NL6A 4YYUA 4N79A 2XU3A 1TU6A 4YV8A 1PPDA 1AYUA 3F5VA 2AVWA 4CDCB 2DCDA 1EWOA 1CS8A 1NB3A 1U5IA 1ZCMA 2DC9A 2AUZA 2ATOA 2PADA 4BSQA 4QRXA 2F7DA 4AXLA 3PW3A 3LXSA 1BQIA 4QRVA 1MHWA 3RVXA 1AU4A 1AECA 1CQDA 2C0YA 3KKUA 1W6FA 2O6XA 2YJ8A 1AU3A 2E01A 1PXVA 3BCNA 4I04A 3H8BA 2AUXA 1KFXL 4N4ZA 3OF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J94 A;  1QXP A;  3IMA A;  2P86 A;  4FJC A;  2FRA A;  3HWN A;  4W5B A;  8PCH A;  2R9C A;  1AIM A;  3MHS A;  1Q6K A;  1CJL A;  1POP A;  1U9Q X;  3P5U A;  4OEL A;  2AIM A;  1GCB A;  3OF8 A;  2HH5 A;  3CH2 X;  5CHV A;  1BY8 A;  1QDQ A;  1ZIV A;  2F1G A;  1JQP A;  2R9F A;  2DJG B;  4CZW A;  2AS8 A;  4Q8H A;  1ICF A;  1YAL A;  2BDL A;  4CDE B;  1SNK A;  3V6C A;  1Y4H A;  1Y08 A;  1MS6 A;  2FO5 A;  2P0R A;  4MZO A;  2FQ9 A;  1PPO A;  1KHP A;  3B79 A;  2AYN A;  4OEM A;  1NLJ A;  2GFO A;  2CB5 A;  1ATK A;  4WA6 A;  4K7C A;  4HWY A;  5FPW A;  3S3Q A;  4YYR A;  4AXM A;  2DC7 A;  2AU1 A;  3K8U A;  3AI8 A;  4I05 A;  2XU1 A;  1AU2 A;  4MSX A;  2DZY A;  1AYW A;  3H89 A;  2G8E A;  3IV2 A;  4PP1 A;  1QOL A;  3P5W A;  1CTE A;  3RVV A;  1PE6 A;  2G7Y A;  3WXE A;  4YYW A;  4I07 A;  2FYE A;  4YYS A;  2NQD B;  5CVM A;  3MOR A;  3H7D A;  1KXR A;  3I3T A;  4YYV A;  2VHF A;  5EGW A;  2DC8 A;  4CDD B;  2GHU A;  1S4V A;  2B1M A;  3HHI A;  3D6S A;  3P5V A;  3GCB A;  2YJ9 A;  3F75 A;  1THE A;  3TNX A;  1CV8 A;  3LFY A;  1CSB B;  3QSD A;  2JQG R;  1EWP A;  2IPP B;  4BS6 A;  3USV A;  1VSN A;  3H8C A;  1CB5 A;  1F29 A;  4RY2 A;  3H6S A;  2G6D A;  3I06 A;  2DC6 A;  1NQC A;  2YJC A;  3BOW A;  4PI3 A;  6PAD A;  7PCK A;  2YJB A;  4FIP A;  2ARY A;  2FUD A;  3HHA A;  2B1N A;  1GMY A;  1XKG A;  3CBJ A;  2YJ2 A;  3KSE A;  4X6H A;  3WXG A;  3BC3 A;  2NQG A;  2OP3 A;  1YT7 A;  4XR7 A;  1QMY A;  2DJF B;  1PBH A;  2P7U A;  1BGO A;  2OZ2 A;  1PIP A;  3KWB X;  1A6R A;  3V6E A;  2IBI A;  3O0U A;  2R6N A;  9PAP A;  4QBB A;  3N3K A;  4MZS A;  2HXZ A;  5PAD A;  1PCI A;  2VHS A;  1U9V A;  2AYO A;  3ZUA A;  2G8J A;  3IOQ A;  3WXF A;  1EF7 A;  3KX1 A;  1MDW A;  1O0E A;  4BPV A;  3BWK A;  2BDZ A;  1YK8 A;  3KW9 A;  1F2A A;  3K24 A;  1EWM A;  1ME3 A;  1KHQ A;  4CDF B;  2PNS A;  3N3G A;  4FK5 A;  3NHE A;  3BPF A;  4ZUX U;  3M99 A;  3DF0 A;  4DMY A;  1MIR A;  1GLO A;  2H7J A;  1DF0 A;  2Y6E A;  2E03 A;  1EWL A;  5CHT A;  5F02 A;  2CIO A;  2OUL A;  1KFU L;  4PP2 E;  4XUI A;  1YK7 A;  1PPP A;  1NPZ A;  2R9O A;  5EF4 A;  1M6D A;  2PRE A;  5K16 A;  2DCA A;  4YYQ A;  1TLO A;  2DCC A;  3U8E A;  3N4C A;  3O1G A;  4DMX A;  3OIS A;  2E02 A;  4P6G A;  4P6E A;  1NB5 A;  1MEM A;  3S3R A;  2R9N A;  2E00 A;  3E1Z B;  2FTD A;  1VJV A;  4PAD A;  3IEJ A;  4W5C A;  3QT4 A;  3PNR A;  3PDF A;  2HD5 A;  1HUC B;  2Y5B A;  3BPM A;  1YVB A;  4QRG A;  5CVN B;  1X9Y A;  2R9M A;  1K3B B;  1DEU A;  1U9X A;  1MEG A;  3C9E A;  4KLB A;  1ME4 A;  3KWZ A;  3CH3 X;  3KFQ A;  2JQF R;  1PPN A;  3HD3 A;  1STF E;  3IHP A;  1IWD A;  2NQA A;  1FH0 A;  3OVZ A;  1CVZ A;  2DZZ A;  4Q8G A;  3MTN A;  3OVX A;  2HHN A;  1CPJ A;  5JH3 A;  4BS5 A;  1F2C A;  2ACT A;  2FT2 A;  4BQV A;  3P5X A;  5A24 A;  3IUT A;  2XU4 A;  3ERV A;  3MHH A;  5JA7 A;  2DCB A;  1ITO A;  3CBK A;  1SP4 B;  3K9M A;  1BP4 A;  2XU5 A;  1U9W A;  1AU0 A;  4X6J A;  1TL9 A;  3PBH A;  2FRQ A;  1F2B A;  5CVO B;  2NQI A;  3RVW A;  2PBH A;  4G54 A;  4N8W A;  2WBF X;  3QJ3 A;  4X6I A;  1GEC E;  4YVA A;  4W4U A;  4QH6 A;  1AYV A;  1NL6 A;  1PAD A;  4YYU A;  4N79 A;  2XU3 A;  1TU6 A;  4YV8 A;  1PPD A;  1AYU A;  3F5V A;  2AVW A;  4CDC B;  2DCD A;  1EWO A;  1CS8 A;  1NB3 A;  1U5I A;  1ZCM A;  2DC9 A;  2AUZ A;  2ATO A;  2PAD A;  4BSQ A;  4QRX A;  2F7D A;  4AXL A;  3PW3 A;  3LXS A;  1BQI A;  4QRV A;  1MHW A;  3RVX A;  1AU4 A;  1AEC A;  1CQD A;  2C0Y A;  3KKU A;  2O6X A;  2YJ8 A;  1AU3 A;  2E01 A;  1PXV A;  3BCN A;  4I04 A;  3H8B A;  2AUX A;  1KFX L;  4N4Z A;  3OF9 A; 
#chains in the Genus database with same CATH topology
 4XZX A;  5J94 A;  1QXP A;  4MI7 A;  3IMA A;  2P86 A;  4FJC A;  2FRA A;  3HWN A;  4W5B A;  8PCH A;  2R9C A;  1AIM A;  3MHS A;  1Q6K A;  2FE8 A;  1CJL A;  1POP A;  1U9Q X;  3P5U A;  4IUM A;  4OEL A;  2AIM A;  3W30 A;  1GCB A;  3BB7 A;  3OF8 A;  4RF1 A;  2HH5 A;  3CH2 X;  5CHV A;  4WUR A;  1BY8 A;  1QDQ A;  1ZIV A;  2F1G A;  1JQP A;  2R9F A;  2DJG B;  4CZW A;  2AS8 A;  4Q8H A;  1ICF A;  1YAL A;  2BDL A;  4CDE B;  1SNK A;  3V6C A;  4BOZ A;  4RF0 A;  1Y4H A;  1Y08 A;  1MS6 A;  2FO5 A;  2P0R A;  4MZO A;  2FQ9 A;  1PPO A;  1KHP A;  3B79 A;  2AYN A;  3PHU A;  4OEM A;  1NLJ A;  2GFO A;  2CB5 A;  1ATK A;  4WA6 A;  4K7C A;  4HWY A;  5FPW A;  3PHX A;  3S3Q A;  4YYR A;  4AXM A;  2DC7 A;  2AU1 A;  3K8U A;  2Z84 A;  3AI8 A;  4I05 A;  2XU1 A;  1AU2 A;  4MSX A;  2DZY A;  1AYW A;  4HXD B;  3H89 A;  2G8E A;  3IV2 A;  4PP1 A;  1QOL A;  3P5W A;  4RKX A;  1CTE A;  3RVV A;  1PE6 A;  2G7Y A;  3WXE A;  4YYW A;  4I07 A;  2FYE A;  4YYS A;  2NQD B;  5E6J A;  4BOS A;  5CVM A;  3MOR A;  3H7D A;  1KXR A;  2BU3 A;  3I3T A;  4YYV A;  2VHF A;  4OVZ B;  5EGW A;  2DC8 A;  4CDD B;  2GHU A;  3PHW A;  1S4V A;  4D8E A;  2B1M A;  3HHI A;  3D6S A;  3P5V A;  3GCB A;  2YJ9 A;  3F75 A;  1THE A;  3TNX A;  1CV8 A;  3W31 A;  3LFY A;  1CSB B;  5KO3 A;  3QSD A;  2JQG R;  1EWP A;  2IPP B;  4BS6 A;  3USV A;  1VSN A;  3H8C A;  1CB5 A;  1F29 A;  4RY2 A;  3H6S A;  2G6D A;  3PRP A;  3I06 A;  2DC6 A;  3PRM A;  1NQC A;  4A5U A;  2YJC A;  3BOW A;  4PI3 A;  6PAD A;  2BTW A;  7PCK A;  2YJB A;  4FIP A;  2ARY A;  2FUD A;  3HHA A;  2B1N A;  1GMY A;  1XKG A;  3CBJ A;  2AGA A;  2YJ2 A;  3KSE A;  4X6H A;  4ZTB A;  2JTC A;  2HWK A;  3WXG A;  3BC3 A;  2NQG A;  2OP3 A;  1YT7 A;  4XR7 A;  1QMY A;  2DJF B;  1PBH A;  2P7U A;  1BGO A;  2OZ2 A;  4GUA A;  3O65 A;  1PIP A;  3KWB X;  1YZB A;  3TMP A;  2JRI A;  1A6R A;  3V6E A;  2IBI A;  4RNA A;  3O0U A;  2R6N A;  4REZ A;  9PAP A;  4QBB A;  3N3K A;  4MZS A;  2HXZ A;  5PAD A;  1PCI A;  2VHS A;  1U9V A;  2AYO A;  3ZUA A;  2G8J A;  3IOQ A;  3WXF A;  1EF7 A;  3KX1 A;  1MDW A;  1O0E A;  4BPV A;  3BWK A;  2BDZ A;  1YK8 A;  3KW9 A;  1F2A A;  3K24 A;  1EWM A;  1ME3 A;  3RNV A;  1KHQ A;  4CDF B;  2PNS A;  3MTV A;  4BOU A;  3N3G A;  4FK5 A;  3NHE A;  3BPF A;  4ZUX U;  3M99 A;  3DF0 A;  3TRK A;  4DMY A;  1MIR A;  1GLO A;  2H7J A;  1DF0 A;  2Y6E A;  2E03 A;  1EWL A;  5CHT A;  5F02 A;  2CIO A;  2OUL A;  1KFU L;  4PP2 E;  4XUI A;  1YK7 A;  5JZE A;  1PPP A;  3B21 A;  1NPZ A;  2R9O A;  5EF4 A;  1M6D A;  2PRE A;  5K16 A;  2DCA A;  4YYQ A;  4M0W A;  1TLO A;  2DCC A;  3U8E A;  3N4C A;  3O1G A;  4DMX A;  3OIS A;  2E02 A;  4P6G A;  4P6E A;  1NB5 A;  1MEM A;  3S3R A;  4R3D A;  2R9N A;  2E00 A;  3E1Z B;  3PT2 A;  2FTD A;  1VJV A;  1UKF A;  4PAD A;  3IEJ A;  4W5C A;  3QT4 A;  3PNR A;  3PDF A;  2HD5 A;  1HUC B;  2Y5B A;  3BPM A;  1YVB A;  1X9Y A;  2R9M A;  4QRG A;  5CVN B;  3OQC A;  1K3B B;  3BY4 A;  1DEU A;  1U9X A;  1MEG A;  3C9E A;  4KLB A;  1ME4 A;  3KWZ A;  3CH3 X;  3KFQ A;  2JQF R;  1PPN A;  3HD3 A;  1STF E;  3IHP A;  1IWD A;  2NQA A;  1FH0 A;  3OVZ A;  1CVZ A;  2DZZ A;  4Q8G A;  3MTN A;  2DOS A;  3OVX A;  2HHN A;  1DKI A;  1CPJ A;  5JH3 A;  4BS5 A;  1F2C A;  2ACT A;  2FT2 A;  4OW0 A;  4BQV A;  3P5X A;  5A24 A;  3IUT A;  2XU4 A;  3ERV A;  3MHH A;  5JA7 A;  2DCB A;  1ITO A;  3CBK A;  1SP4 B;  4D8B A;  3K9M A;  1BP4 A;  2XU5 A;  1U9W A;  1AU0 A;  4P16 A;  2UZJ A;  4X6J A;  2BTW B;  4IP3 A;  2J7Q C;  1TL9 A;  3PBH A;  2FRQ A;  1F2B A;  5CVO B;  2NQI A;  3RVW A;  2PBH A;  4G54 A;  4N8W A;  2WBF X;  3QJ3 A;  4X6I A;  1GEC E;  4YVA A;  4PT5 A;  4W4U A;  4BOP A;  4QH6 A;  1AYV A;  1NL6 A;  1PAD A;  4YYU A;  3E9S A;  4N79 A;  2XU3 A;  5EZS A;  1TU6 A;  4YV8 A;  1PPD A;  1AYU A;  1PVJ A;  3F5V A;  2AVW A;  4BOQ A;  4OVZ A;  4CDC B;  2DCD A;  1EWO A;  1CS8 A;  1NB3 A;  1U5I A;  1ZCM A;  3ZNH A;  2DC9 A;  2AUZ A;  2ATO A;  3BBA A;  3MP2 A;  2PAD A;  4BSQ A;  4QRX A;  2F7D A;  4AXL A;  3PW3 A;  3LXS A;  1BQI A;  4QRV A;  3IFU A;  1MHW A;  3RVX A;  1AU4 A;  1AEC A;  1CQD A;  2C0Y A;  3KKU A;  2J7Q A;  3MJ5 A;  2O6X A;  2YJ8 A;  4MM3 B;  1AU3 A;  2E01 A;  1PXV A;  3BCN A;  4I04 A;  3H8B A;  2AUX A;  1KFX L;  4N4Z A;  4D8I A;  3OF9 A;  3C0R A;  3PSE A;  5EZQ A; 
#chains in the Genus database with same CATH homology
 5J94 A;  1QXP A;  3IMA A;  2P86 A;  4FJC A;  2FRA A;  3HWN A;  4W5B A;  8PCH A;  2R9C A;  1AIM A;  3MHS A;  1Q6K A;  1CJL A;  1POP A;  1U9Q X;  3P5U A;  4OEL A;  2AIM A;  1GCB A;  3OF8 A;  2HH5 A;  3CH2 X;  5CHV A;  1BY8 A;  1QDQ A;  1ZIV A;  2F1G A;  1JQP A;  4BGF A;  2R9F A;  2DJG B;  4CZW A;  2AS8 A;  4Q8H A;  2VFB A;  1ICF A;  1YAL A;  2BDL A;  4CDE B;  1SNK A;  3V6C A;  4GUZ A;  3D9W A;  1Y4H A;  1Y08 A;  1MS6 A;  2FO5 A;  2P0R A;  4MZO A;  2FQ9 A;  1PPO A;  1KHP A;  3B79 A;  2AYN A;  4OEM A;  1NLJ A;  2GFO A;  2CB5 A;  1ATK A;  4WA6 A;  4K7C A;  4HWY A;  1W5R A;  5FPW A;  3S3Q A;  4YYR A;  4AXM A;  2DC7 A;  2AU1 A;  3K8U A;  3AI8 A;  4I05 A;  2XU1 A;  1AU2 A;  4MSX A;  2DZY A;  1AYW A;  3H89 A;  2G8E A;  3IV2 A;  4PP1 A;  1GX3 A;  1QOL A;  3P5W A;  1CTE A;  3RVV A;  1PE6 A;  2G7Y A;  3WXE A;  4YYW A;  4I07 A;  2FYE A;  4C5P A;  4YYS A;  2NQD B;  5CVM A;  3MOR A;  3H7D A;  1KXR A;  3I3T A;  4YYV A;  2VHF A;  5EGW A;  2DC8 A;  4CDD B;  2GHU A;  1S4V A;  2B1M A;  3HHI A;  3D6S A;  3P5V A;  3GCB A;  2YJ9 A;  3F75 A;  1THE A;  3TNX A;  1CV8 A;  3LFY A;  1CSB B;  3QSD A;  2JQG R;  1EWP A;  2IPP B;  4BS6 A;  3USV A;  1VSN A;  3H8C A;  1CB5 A;  1F29 A;  4RY2 A;  4NV7 A;  3H6S A;  2G6D A;  3I06 A;  2DC6 A;  1NQC A;  1W4T A;  2YJC A;  3BOW A;  4PI3 A;  6PAD A;  7PCK A;  2YJB A;  4FIP A;  2ARY A;  2FUD A;  3LTW A;  3HHA A;  2B1N A;  1GMY A;  1XKG A;  3CBJ A;  2YJ2 A;  3KSE A;  4X6H A;  3WXG A;  3BC3 A;  2NQG A;  2OP3 A;  1YT7 A;  4XR7 A;  1QMY A;  2DJF B;  1PBH A;  2P7U A;  1BGO A;  2OZ2 A;  1PIP A;  3KWB X;  1A6R A;  3V6E A;  2IBI A;  3O0U A;  2R6N A;  4NV8 A;  9PAP A;  4QBB A;  3N3K A;  4MZS A;  2HXZ A;  5PAD A;  1PCI A;  2VHS A;  1U9V A;  2AYO A;  3ZUA A;  2G8J A;  3IOQ A;  3WXF A;  1EF7 A;  3KX1 A;  1MDW A;  1O0E A;  4BPV A;  3BWK A;  2BDZ A;  1YK8 A;  3KW9 A;  1F2A A;  3K24 A;  2VFC A;  1EWM A;  1ME3 A;  1KHQ A;  4CDF B;  2PNS A;  3N3G A;  4FK5 A;  3NHE A;  3BPF A;  4ZUX U;  3M99 A;  3DF0 A;  4DMY A;  1MIR A;  1GLO A;  2H7J A;  1DF0 A;  2Y6E A;  2E03 A;  4B55 A;  1EWL A;  5CHT A;  5F02 A;  2CIO A;  2OUL A;  1KFU L;  4PP2 E;  4XUI A;  1YK7 A;  1PPP A;  1NPZ A;  2R9O A;  5EF4 A;  1M6D A;  2PRE A;  5K16 A;  2DCA A;  4YYQ A;  1TLO A;  2DCC A;  3U8E A;  2BSZ A;  3N4C A;  3O1G A;  4DMX A;  3OIS A;  2E02 A;  4P6G A;  4P6E A;  1NB5 A;  1MEM A;  3S3R A;  2R9N A;  2E00 A;  3E1Z B;  2FTD A;  1VJV A;  4PAD A;  3IEJ A;  4W5C A;  3QT4 A;  3PNR A;  3PDF A;  2HD5 A;  1HUC B;  2Y5B A;  3BPM A;  1YVB A;  4QRG A;  5CVN B;  1X9Y A;  2R9M A;  1K3B B;  1DEU A;  1U9X A;  1MEG A;  3C9E A;  4KLB A;  1ME4 A;  3KWZ A;  3CH3 X;  3KFQ A;  2JQF R;  1PPN A;  3HD3 A;  1STF E;  3IHP A;  1IWD A;  2NQA A;  1FH0 A;  3OVZ A;  1CVZ A;  2DZZ A;  4Q8G A;  3MTN A;  3OVX A;  2HHN A;  1CPJ A;  5JH3 A;  4BS5 A;  1F2C A;  2ACT A;  2FT2 A;  4BQV A;  3P5X A;  5A24 A;  3IUT A;  2XU4 A;  3ERV A;  3MHH A;  5JA7 A;  2DCB A;  1ITO A;  3CBK A;  1SP4 B;  3K9M A;  1BP4 A;  2XU5 A;  1U9W A;  1AU0 A;  4X6J A;  1TL9 A;  3PBH A;  2FRQ A;  1F2B A;  5CVO B;  2NQI A;  3RVW A;  2PBH A;  4G54 A;  4N8W A;  2WBF X;  3QJ3 A;  4X6I A;  1GEC E;  4YVA A;  4W4U A;  4QH6 A;  1E2T A;  1AYV A;  1PAD A;  1NL6 A;  4YYU A;  4N79 A;  2XU3 A;  1TU6 A;  4YV8 A;  1PPD A;  1AYU A;  3F5V A;  2AVW A;  4CDC B;  2DCD A;  1EWO A;  1CS8 A;  1NB3 A;  1U5I A;  1ZCM A;  2DC9 A;  2AUZ A;  2ATO A;  2PAD A;  4BSQ A;  4QRX A;  2F7D A;  4AXL A;  3PW3 A;  3LXS A;  1BQI A;  4QRV A;  1MHW A;  3RVX A;  1AU4 A;  1AEC A;  1CQD A;  2C0Y A;  3KKU A;  1W6F A;  2O6X A;  2YJ8 A;  1AU3 A;  2E01 A;  1PXV A;  3BCN A;  4I04 A;  3H8B A;  2AUX A;  1KFX L;  4N4Z A;  3OF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...