1IWDA

Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
b'LPSFVDWRSKGAVNSIKNQKQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLRVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERVATAMIN B
publication title Proposed amino acid sequence and the 1.63 A X-ray crystal structure of a plant cysteine protease, ervatamin B: Some insights into the structural basis of its stability and substrate specificity
pubmed doi rcsb
molecule tags Hydrolase
total genus 67
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1iwdA00
1CQDA 5PADA 3H8CA 3H6SA 5JH3A 1AYUA 4QRXA 2P7UA 4KLBA 3IHPA 3C9EA 2XU3A 3KFQA 8PCHA 3PW3A 5CHVA 1VJVA 4PADA 3HD3A 4QBBA 3CH3X 1U5IA 3DF0A 3BCNA 2F1GA 3CBJA 2PREA 1YK7A 3V6CA 4YYRA 4Q8HA 2B1NA 2FTDA 4RY2A 4YYWA 1VSNA 3HHIA 3PDFA 2G8EA 5EGWA 5FPWA 1NB3A 1BP4A 2HD5A 1PPNA 2AVWA 4BSQA 2H7JA 2AUXA 2ARYA 1AU2A 1MEMA 2AS8A 1BGOA 2ACTA 2NQAA 3USVA 3BPFA 1AYVA 1PBHA 3RVXA 2DCBA 2FQ9A 3PBHA 4BS5A 1ICFA 1CVZA 5CHTA 1CJLA 3BWKA 1ITOA 3O0UA 3V6EA 4I05A 4AXLA 1KXRA 2DCAA 4CDCB 1NLJA 2AUZA 5JA7A 1FH0A 2DC9A 4XR7A 1TU6A 1K3BB 2DJFB 1QOLA 1TLOA 2IBIA 3MHSA 1CS8A 1EWOA 4CDEB 3MORA 3I3TA 4YYVA 2CB5A 1CV8A 1GMYA 4P6GA 3GCBA 2JQFR 2AIMA 2HHNA 3QT4A 3N3KA 3HHAA 3S3QA 1EWLA 3WXFA 1THEA 3OF9A 4DMYA 3OF8A 3TNXA 4HWYA 4YV8A 1MHWA 2G6DA 3D6SA 1STFE 3WXEA 4OEMA 2JQGR 1X9YA 1S4VA 3CBKA 1A6RA 4OELA 4MZOA 2XU4A 3AI8A 4CZWA 1POPA 2O6XA 2E00A 1U9VA 2IPPB 1KHQA 1KHPA 1ATKA 2OZ2A 4BPVA 4W5CA 1YALA 4PI3A 5K16A 3RVWA 3P5VA 2CIOA 1MIRA 2P86A 4FK5A 1U9XA 5A24A 2YJCA 1QMYA 4QH6A 1U9QX 1EWMA 1YK8A 4N79A 1XKGA 2YJ9A 1NQCA 1GECE 4WA6A 3LXSA 4YYQA 5CVMA 1ME3A 1MDWA 4BQVA 1TL9A 1PPOA 3IUTA 2R9FA 3BC3A 4CDDB 1EF7A 1QXPA 1CPJA 3M99A 2Y6EA 3O1GA 2OULA 3WXGA 1CTEA 2FRQA 2FYEA 2DC6A 1ZIVA 2PNSA 3P5WA 2HH5A 2G8JA 1PXVA 1PCIA 3I06A 1CSBB 2DC8A 3N3GA 1ME4A 4YYUA 4ZUXU 1KFXL 2AU1A 1DF0A 1MS6A 2DCCA 2VHSA 2P0RA 3K8UA 2E02A 4X6HA 1M6DA 1PADA 1IWDA 2YJ2A 1DEUA 2XU5A 1F29A 2BDLA 2FUDA 1F2BA 2WBFX 4BS6A 4MSXA 1ZCMA 1BQIA 3IMAA 9PAPA 2AYOA 2DZYA 2NQDB 4X6JA 5CVOB 3H89A 4I04A 3HWNA 4FIPA 4CDFB 2AYNA 3KX1A 3F5VA 1PIPA 3F75A 3OVZA 2Y5BA 4YVAA 2PADA 1SNKA 4W5BA 2DJGB 4K7CA 3QJ3A 3IEJA 1NPZA 4G54A 3MHHA 1Y4HA 1GLOA 2PBHA 3IV2A 1NB5A 1AYWA 1YVBA 3QSDA 2C0YA 2VHFA 2YJ8A 1AIMA 1YT7A 4PP1A 1SP4B 3ZUAA 3MTNA 2FO5A 2DZZA 2OP3A 2E03A 4YYSA 3IOQA 4MZSA 3U8EA 2BDZA 1JQPA 2R9CA 3K9MA 1HUCB 3KSEA 4Q8GA 3PNRA 3K24A 1BY8A 1O0EA 1AU4A 1PPDA 4N4ZA 5EF4A 2FT2A 1AU3A 2R9OA 1U9WA 2R9MA 4W4UA 4PP2E 3S3RA 3BOWA 4N8WA 2DC7A 2YJBA 3LFYA 2R6NA 5J94A 4DMXA 3OISA 2GHUA 3KKUA 3N4CA 5CVNB 1MEGA 2NQGA 1GCBA 1AU0A 1CB5A 1EWPA 2G7YA 1PPPA 2HXZA 1QDQA 2B1MA 3P5XA 4I07A 2DCDA 2E01A 4X6IA 1F2CA 3NHEA 5F02A 2NQIA 2XU1A 4QRVA 3ERVA 3OVXA 1PE6A 3KWBX 2FRAA 4P6EA 7PCKA 3B79A 2ATOA 4AXMA 1Q6KA 3H7DA 3CH2X 4XUIA 1NL6A 2F7DA 3P5UA 1Y08A 2GFOA 3BPMA 3RVVA 2R9NA 6PADA 4QRGA 3KWZA 1AECA 1F2AA 1KFUL 3E1ZB 4FJCA 3KW9A 3H8BA
chains in the Genus database with same CATH superfamily
1CQDA 3PT2A 5PADA 3H8CA 3C0RA 3H6SA 5JH3A 2UZJA 1AYUA 4QRXA 2P7UA 4KLBA 3IHPA 3C9EA 2XU3A 3KFQA 8PCHA 3PW3A 5CHVA 1VJVA 4PADA 3HD3A 4QBBA 3CH3X 1U5IA 3DF0A 3BCNA 2F1GA 3CBJA 2PREA 1YK7A 3V6CA 4YYRA 4Q8HA 2B1NA 2FTDA 4RY2A 4YYWA 1VSNA 3HHIA 4ZTBA 3PDFA 2G8EA 4BOPA 5EGWA 5FPWA 1NB3A 3RNVA 3MP2A 1BP4A 2HD5A 1PPNA 5KO3A 2AVWA 4BSQA 2H7JA 2AUXA 2ARYA 1AU2A 1MEMA 2AS8A 1BGOA 2ACTA 2NQAA 3USVA 3BPFA 1AYVA 1PBHA 3RVXA 1DKIA 4A5UA 2DCBA 2FQ9A 3PBHA 4BS5A 1ICFA 1CVZA 4RF0A 5CHTA 4IUMA 2JTCA 1CJLA 3BWKA 1YZBA 1ITOA 3O0UA 3V6EA 4I05A 4AXLA 1KXRA 3PHXA 2DCAA 4OVZA 4CDCB 1NLJA 2AUZA 5JA7A 2J7QC 1FH0A 2DC9A 3TMPA 4XR7A 1TU6A 1K3BB 4D8EA 2DJFB 1QOLA 1TLOA 5JZEA 2IBIA 3MHSA 1CS8A 1EWOA 4CDEB 3MORA 4OVZB 3I3TA 4YYVA 2CB5A 3MJ5A 1CV8A 4MI7A 1GMYA 4P6GA 3GCBA 2JQFR 2AIMA 2HHNA 3QT4A 3N3KA 3HHAA 3S3QA 1EWLA 3WXFA 1THEA 3OF9A 4DMYA 3OF8A 3TNXA 4HWYA 4BOUA 4YV8A 1MHWA 2G6DA 3D6SA 4XZXA 1STFE 3WXEA 4OEMA 2JQGR 1X9YA 1S4VA 3CBKA 1A6RA 2J7QA 4MZOA 4OELA 2XU4A 3AI8A 4CZWA 1POPA 2O6XA 2E00A 1U9VA 2IPPB 1KHQA 1KHPA 1ATKA 2OZ2A 4BPVA 4W5CA 1YALA 4PI3A 5K16A 3RVWA 3P5VA 2CIOA 1MIRA 2P86A 1U9XA 4FK5A 5A24A 2YJCA 2FE8A 1QMYA 1U9QX 4QH6A 1EWMA 1YK8A 4N79A 1XKGA 2YJ9A 1NQCA 1GECE 4WA6A 3LXSA 4YYQA 5CVMA 1ME3A 1MDWA 4BQVA 1TL9A 1PPOA 3IUTA 2R9FA 3BC3A 4CDDB 1EF7A 1QXPA 1CPJA 3M99A 2Y6EA 3O1GA 2OULA 3WXGA 1CTEA 2FRQA 2FYEA 2DC6A 1ZIVA 2PNSA 3P5WA 4BOQA 2HH5A 2G8JA 4BOZA 1PXVA 1PCIA 3I06A 1CSBB 2DC8A 3N3GA 1ME4A 4YYUA 4ZUXU 1KFXL 2AU1A 4IP3A 1DF0A 1MS6A 2DCCA 2VHSA 2P0RA 3BB7A 3K8UA 2E02A 4X6HA 1M6DA 1PADA 1IWDA 2YJ2A 1DEUA 2XU5A 1F29A 2BDLA 2FUDA 1F2BA 2WBFX 3BY4A 4BS6A 4MSXA 1ZCMA 1BQIA 3IMAA 9PAPA 2AYOA 2DZYA 2NQDB 4HXDB 4X6JA 5CVOB 3H89A 4I04A 3HWNA 3IFUA 2HWKA 4FIPA 4CDFB 2AYNA 3KX1A 3F5VA 1PIPA 1PVJA 3F75A 3OVZA 2Y5BA 4YVAA 3PHWA 2PADA 1SNKA 4R3DA 4W5BA 2DJGB 4K7CA 2DOSA 3QJ3A 3IEJA 1UKFA 1NPZA 4G54A 3MHHA 1Y4HA 1GLOA 2PBHA 3IV2A 1NB5A 4OW0A 1AYWA 1YVBA 3QSDA 2C0YA 3PHUA 2VHFA 2YJ8A 1AIMA 1YT7A 4PP1A 1SP4B 5EZQA 3ZUAA 3MTNA 2FO5A 4MM3B 4P16A 2DZZA 2AGAA 2OP3A 2E03A 4YYSA 3IOQA 4MZSA 2Z84A 3U8EA 2BDZA 1JQPA 2R9CA 3TRKA 3K9MA 1HUCB 3KSEA 4Q8GA 3PNRA 3K24A 4D8BA 1BY8A 1O0EA 1AU4A 1PPDA 4N4ZA 5EF4A 2FT2A 1AU3A 4M0WA 2R9OA 1U9WA 2R9MA 4W4UA 4PP2E 3S3RA 5EZSA 4BOSA 3BOWA 3ZNHA 4N8WA 2DC7A 2YJBA 3LFYA 4RF1A 5E6JA 2R6NA 5J94A 4DMXA 3OISA 4GUAA 2GHUA 3KKUA 3N4CA 5CVNB 1MEGA 3PRMA 3W30A 3MTVA 2NQGA 1GCBA 1AU0A 1CB5A 1EWPA 2G7YA 1PPPA 4RNAA 2HXZA 3E9SA 1QDQA 2B1MA 4PT5A 3P5XA 4I07A 3PSEA 4REZA 2DCDA 2BTWA 2E01A 3OQCA 4X6IA 2BU3A 1F2CA 2JRIA 3NHEA 5F02A 3B21A 2NQIA 2XU1A 4QRVA 3ERVA 3OVXA 1PE6A 3KWBX 3W31A 2FRAA 4P6EA 7PCKA 3O65A 3BBAA 3B79A 2ATOA 4AXMA 3PRPA 2BTWB 1Q6KA 4D8IA 3H7DA 4RKXA 3CH2X 4XUIA 1NL6A 3P5UA 2F7DA 1Y08A 2GFOA 3BPMA 3RVVA 2R9NA 6PADA 4QRGA 3KWZA 1AECA 1F2AA 1KFUL 3E1ZB 4FJCA 4WURA 3KW9A 3H8BA
chains in the Genus database with same CATH topology
1CQDA 5PADA 3H8CA 3H6SA 5JH3A 1AYUA 4QRXA 2P7UA 4KLBA 3IHPA 3C9EA 2XU3A 3KFQA 8PCHA 3PW3A 5CHVA 1VJVA 4PADA 3HD3A 4QBBA 3CH3X 1U5IA 3DF0A 3BCNA 2F1GA 3CBJA 2PREA 1YK7A 3V6CA 4YYRA 4Q8HA 2B1NA 2FTDA 4RY2A 4YYWA 1VSNA 3HHIA 3PDFA 2G8EA 5EGWA 5FPWA 1NB3A 1BP4A 2VFCA 2VFBA 2HD5A 1PPNA 2AVWA 4BSQA 2H7JA 2AUXA 2ARYA 1AU2A 1MEMA 2AS8A 1BGOA 2ACTA 2NQAA 3USVA 3BPFA 1AYVA 1PBHA 3RVXA 2DCBA 2FQ9A 3PBHA 4BS5A 1ICFA 1CVZA 5CHTA 1CJLA 3BWKA 1ITOA 3O0UA 3V6EA 4I05A 4AXLA 1KXRA 2DCAA 4CDCB 1NLJA 2AUZA 5JA7A 1FH0A 2DC9A 4XR7A 1GX3A 1TU6A 1K3BB 2DJFB 1QOLA 1TLOA 2IBIA 3MHSA 1CS8A 1EWOA 4CDEB 3MORA 3I3TA 4YYVA 2CB5A 1CV8A 1GMYA 4P6GA 3GCBA 2JQFR 2AIMA 2HHNA 3QT4A 3N3KA 3HHAA 3S3QA 1EWLA 3WXFA 1THEA 3OF9A 4DMYA 3OF8A 3TNXA 4HWYA 4YV8A 1MHWA 2G6DA 3D6SA 1STFE 3WXEA 4OEMA 2JQGR 1X9YA 1S4VA 3CBKA 1A6RA 4OELA 4MZOA 2XU4A 3AI8A 4CZWA 1POPA 2O6XA 2E00A 1U9VA 2IPPB 1KHQA 1KHPA 1ATKA 2OZ2A 4BPVA 4W5CA 1YALA 4PI3A 5K16A 3RVWA 3P5VA 2CIOA 1MIRA 2P86A 4FK5A 1U9XA 5A24A 2YJCA 1QMYA 1U9QX 4QH6A 1EWMA 1YK8A 4N79A 1XKGA 2YJ9A 1NQCA 1GECE 4WA6A 3LXSA 4YYQA 5CVMA 4BGFA 1ME3A 1MDWA 4BQVA 1TL9A 1PPOA 3IUTA 2R9FA 3BC3A 4CDDB 1EF7A 1QXPA 1CPJA 3M99A 2Y6EA 3O1GA 2OULA 3WXGA 1CTEA 2FRQA 2FYEA 2DC6A 1ZIVA 2PNSA 3P5WA 2HH5A 2G8JA 1PXVA 1PCIA 3I06A 1CSBB 2DC8A 3N3GA 1ME4A 4NV8A 4YYUA 4ZUXU 1KFXL 2AU1A 1DF0A 1MS6A 2DCCA 2VHSA 2P0RA 3LTWA 3K8UA 2E02A 4X6HA 1M6DA 1PADA 1IWDA 2YJ2A 1DEUA 2XU5A 1F29A 2BDLA 2FUDA 1F2BA 2WBFX 4BS6A 4MSXA 1ZCMA 1BQIA 3IMAA 9PAPA 2AYOA 2DZYA 2NQDB 4X6JA 5CVOB 3H89A 4I04A 3HWNA 4FIPA 4CDFB 2AYNA 3KX1A 3F5VA 1PIPA 3F75A 3OVZA 2Y5BA 4YVAA 2PADA 1SNKA 4W5BA 4C5PA 2DJGB 4K7CA 3QJ3A 3IEJA 1NPZA 4G54A 3MHHA 1Y4HA 1GLOA 2PBHA 3IV2A 1NB5A 1AYWA 1YVBA 3QSDA 2C0YA 2VHFA 2YJ8A 1AIMA 1YT7A 4PP1A 1SP4B 3ZUAA 3MTNA 2FO5A 4B55A 2DZZA 2OP3A 2E03A 4YYSA 3IOQA 4MZSA 3U8EA 2BDZA 1JQPA 2R9CA 3K9MA 1HUCB 3KSEA 4Q8GA 3PNRA 3D9WA 3K24A 1BY8A 1O0EA 1AU4A 1PPDA 4N4ZA 5EF4A 2FT2A 1AU3A 2R9OA 1W6FA 1U9WA 2R9MA 4W4UA 4PP2E 3S3RA 1E2TA 3BOWA 4N8WA 2DC7A 2YJBA 3LFYA 2R6NA 1W5RA 5J94A 4DMXA 3OISA 2GHUA 3KKUA 3N4CA 5CVNB 1MEGA 2NQGA 4GUZA 1GCBA 1AU0A 1CB5A 1EWPA 2G7YA 1PPPA 2HXZA 1W4TA 1QDQA 2B1MA 3P5XA 4I07A 2DCDA 2E01A 4X6IA 1F2CA 3NHEA 5F02A 2NQIA 2XU1A 4QRVA 3ERVA 3OVXA 1PE6A 3KWBX 2FRAA 4P6EA 7PCKA 3B79A 2ATOA 4AXMA 1Q6KA 2BSZA 3H7DA 3CH2X 4XUIA 1NL6A 2F7DA 3P5UA 1Y08A 2GFOA 3BPMA 3RVVA 2R9NA 6PADA 4QRGA 3KWZA 4NV7A 1AECA 1F2AA 1KFUL 3E1ZB 4FJCA 3KW9A 3H8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQD A;  5PAD A;  3H8C A;  3H6S A;  5JH3 A;  1AYU A;  4QRX A;  2P7U A;  4KLB A;  3IHP A;  3C9E A;  2XU3 A;  3KFQ A;  8PCH A;  3PW3 A;  5CHV A;  1VJV A;  4PAD A;  3HD3 A;  4QBB A;  3CH3 X;  1U5I A;  3DF0 A;  3BCN A;  2F1G A;  3CBJ A;  2PRE A;  1YK7 A;  3V6C A;  4YYR A;  4Q8H A;  2B1N A;  2FTD A;  4RY2 A;  4YYW A;  1VSN A;  3HHI A;  3PDF A;  2G8E A;  5EGW A;  5FPW A;  1NB3 A;  1BP4 A;  2HD5 A;  1PPN A;  2AVW A;  4BSQ A;  2H7J A;  2AUX A;  2ARY A;  1AU2 A;  1MEM A;  2AS8 A;  1BGO A;  2ACT A;  2NQA A;  3USV A;  3BPF A;  1AYV A;  1PBH A;  3RVX A;  2DCB A;  2FQ9 A;  3PBH A;  4BS5 A;  1ICF A;  1CVZ A;  5CHT A;  1CJL A;  3BWK A;  1ITO A;  3O0U A;  3V6E A;  4I05 A;  4AXL A;  1KXR A;  2DCA A;  4CDC B;  1NLJ A;  2AUZ A;  5JA7 A;  1FH0 A;  2DC9 A;  4XR7 A;  1TU6 A;  1K3B B;  2DJF B;  1QOL A;  1TLO A;  2IBI A;  3MHS A;  1CS8 A;  1EWO A;  4CDE B;  3MOR A;  3I3T A;  4YYV A;  2CB5 A;  1CV8 A;  1GMY A;  4P6G A;  3GCB A;  2JQF R;  2AIM A;  2HHN A;  3QT4 A;  3N3K A;  3HHA A;  3S3Q A;  1EWL A;  3WXF A;  1THE A;  3OF9 A;  4DMY A;  3OF8 A;  3TNX A;  4HWY A;  4YV8 A;  1MHW A;  2G6D A;  3D6S A;  1STF E;  3WXE A;  4OEM A;  2JQG R;  1X9Y A;  1S4V A;  3CBK A;  1A6R A;  4OEL A;  4MZO A;  2XU4 A;  3AI8 A;  4CZW A;  1POP A;  2O6X A;  2E00 A;  1U9V A;  2IPP B;  1KHQ A;  1KHP A;  1ATK A;  2OZ2 A;  4BPV A;  4W5C A;  1YAL A;  4PI3 A;  5K16 A;  3RVW A;  3P5V A;  2CIO A;  1MIR A;  2P86 A;  4FK5 A;  1U9X A;  5A24 A;  2YJC A;  1QMY A;  4QH6 A;  1U9Q X;  1EWM A;  1YK8 A;  4N79 A;  1XKG A;  2YJ9 A;  1NQC A;  1GEC E;  4WA6 A;  3LXS A;  4YYQ A;  5CVM A;  1ME3 A;  1MDW A;  4BQV A;  1TL9 A;  1PPO A;  3IUT A;  2R9F A;  3BC3 A;  4CDD B;  1EF7 A;  1QXP A;  1CPJ A;  3M99 A;  2Y6E A;  3O1G A;  2OUL A;  3WXG A;  1CTE A;  2FRQ A;  2FYE A;  2DC6 A;  1ZIV A;  2PNS A;  3P5W A;  2HH5 A;  2G8J A;  1PXV A;  1PCI A;  3I06 A;  1CSB B;  2DC8 A;  3N3G A;  1ME4 A;  4YYU A;  4ZUX U;  1KFX L;  2AU1 A;  1DF0 A;  1MS6 A;  2DCC A;  2VHS A;  2P0R A;  3K8U A;  2E02 A;  4X6H A;  1M6D A;  1PAD A;  1IWD A;  2YJ2 A;  1DEU A;  2XU5 A;  1F29 A;  2BDL A;  2FUD A;  1F2B A;  2WBF X;  4BS6 A;  4MSX A;  1ZCM A;  1BQI A;  3IMA A;  9PAP A;  2AYO A;  2DZY A;  2NQD B;  4X6J A;  5CVO B;  3H89 A;  4I04 A;  3HWN A;  4FIP A;  4CDF B;  2AYN A;  3KX1 A;  3F5V A;  1PIP A;  3F75 A;  3OVZ A;  2Y5B A;  4YVA A;  2PAD A;  1SNK A;  4W5B A;  2DJG B;  4K7C A;  3QJ3 A;  3IEJ A;  1NPZ A;  4G54 A;  3MHH A;  1Y4H A;  1GLO A;  2PBH A;  3IV2 A;  1NB5 A;  1AYW A;  1YVB A;  3QSD A;  2C0Y A;  2VHF A;  2YJ8 A;  1AIM A;  1YT7 A;  4PP1 A;  1SP4 B;  3ZUA A;  3MTN A;  2FO5 A;  2DZZ A;  2OP3 A;  2E03 A;  4YYS A;  3IOQ A;  4MZS A;  3U8E A;  2BDZ A;  1JQP A;  2R9C A;  3K9M A;  1HUC B;  3KSE A;  4Q8G A;  3PNR A;  3K24 A;  1BY8 A;  1O0E A;  1AU4 A;  1PPD A;  4N4Z A;  5EF4 A;  2FT2 A;  1AU3 A;  2R9O A;  1U9W A;  2R9M A;  4W4U A;  4PP2 E;  3S3R A;  3BOW A;  4N8W A;  2DC7 A;  2YJB A;  3LFY A;  2R6N A;  5J94 A;  4DMX A;  3OIS A;  2GHU A;  3KKU A;  3N4C A;  5CVN B;  1MEG A;  2NQG A;  1GCB A;  1AU0 A;  1CB5 A;  1EWP A;  2G7Y A;  1PPP A;  2HXZ A;  1QDQ A;  2B1M A;  3P5X A;  4I07 A;  2DCD A;  2E01 A;  4X6I A;  1F2C A;  3NHE A;  5F02 A;  2NQI A;  2XU1 A;  4QRV A;  3ERV A;  3OVX A;  1PE6 A;  3KWB X;  2FRA A;  4P6E A;  7PCK A;  3B79 A;  2ATO A;  4AXM A;  1Q6K A;  3H7D A;  3CH2 X;  4XUI A;  1NL6 A;  2F7D A;  3P5U A;  1Y08 A;  2GFO A;  3BPM A;  3RVV A;  2R9N A;  6PAD A;  4QRG A;  3KWZ A;  1AEC A;  1F2A A;  1KFU L;  3E1Z B;  4FJC A;  3KW9 A;  3H8B A; 
#chains in the Genus database with same CATH topology
 1CQD A;  3PT2 A;  5PAD A;  3H8C A;  3C0R A;  3H6S A;  5JH3 A;  2UZJ A;  1AYU A;  4QRX A;  2P7U A;  4KLB A;  3IHP A;  3C9E A;  2XU3 A;  3KFQ A;  8PCH A;  3PW3 A;  5CHV A;  1VJV A;  4PAD A;  3HD3 A;  4QBB A;  3CH3 X;  1U5I A;  3DF0 A;  3BCN A;  2F1G A;  3CBJ A;  2PRE A;  1YK7 A;  3V6C A;  4YYR A;  4Q8H A;  2B1N A;  2FTD A;  4RY2 A;  4YYW A;  1VSN A;  3HHI A;  4ZTB A;  3PDF A;  2G8E A;  4BOP A;  5EGW A;  5FPW A;  1NB3 A;  3RNV A;  3MP2 A;  1BP4 A;  2HD5 A;  1PPN A;  5KO3 A;  2AVW A;  4BSQ A;  2H7J A;  2AUX A;  2ARY A;  1AU2 A;  1MEM A;  2AS8 A;  1BGO A;  2ACT A;  2NQA A;  3USV A;  3BPF A;  1AYV A;  1PBH A;  3RVX A;  1DKI A;  4A5U A;  2DCB A;  2FQ9 A;  3PBH A;  4BS5 A;  1ICF A;  1CVZ A;  4RF0 A;  5CHT A;  4IUM A;  2JTC A;  1CJL A;  3BWK A;  1YZB A;  1ITO A;  3O0U A;  3V6E A;  4I05 A;  4AXL A;  1KXR A;  3PHX A;  2DCA A;  4OVZ A;  4CDC B;  1NLJ A;  2AUZ A;  5JA7 A;  2J7Q C;  1FH0 A;  2DC9 A;  3TMP A;  4XR7 A;  1TU6 A;  1K3B B;  4D8E A;  2DJF B;  1QOL A;  1TLO A;  5JZE A;  2IBI A;  3MHS A;  1CS8 A;  1EWO A;  4CDE B;  3MOR A;  4OVZ B;  3I3T A;  4YYV A;  2CB5 A;  3MJ5 A;  1CV8 A;  4MI7 A;  1GMY A;  4P6G A;  3GCB A;  2JQF R;  2AIM A;  2HHN A;  3QT4 A;  3N3K A;  3HHA A;  3S3Q A;  1EWL A;  3WXF A;  1THE A;  3OF9 A;  4DMY A;  3OF8 A;  3TNX A;  4HWY A;  4BOU A;  4YV8 A;  1MHW A;  2G6D A;  3D6S A;  4XZX A;  1STF E;  3WXE A;  4OEM A;  2JQG R;  1X9Y A;  1S4V A;  3CBK A;  1A6R A;  2J7Q A;  4MZO A;  4OEL A;  2XU4 A;  3AI8 A;  4CZW A;  1POP A;  2O6X A;  2E00 A;  1U9V A;  2IPP B;  1KHQ A;  1KHP A;  1ATK A;  2OZ2 A;  4BPV A;  4W5C A;  1YAL A;  4PI3 A;  5K16 A;  3RVW A;  3P5V A;  2CIO A;  1MIR A;  2P86 A;  1U9X A;  4FK5 A;  5A24 A;  2YJC A;  2FE8 A;  1QMY A;  1U9Q X;  4QH6 A;  1EWM A;  1YK8 A;  4N79 A;  1XKG A;  2YJ9 A;  1NQC A;  1GEC E;  4WA6 A;  3LXS A;  4YYQ A;  5CVM A;  1ME3 A;  1MDW A;  4BQV A;  1TL9 A;  1PPO A;  3IUT A;  2R9F A;  3BC3 A;  4CDD B;  1EF7 A;  1QXP A;  1CPJ A;  3M99 A;  2Y6E A;  3O1G A;  2OUL A;  3WXG A;  1CTE A;  2FRQ A;  2FYE A;  2DC6 A;  1ZIV A;  2PNS A;  3P5W A;  4BOQ A;  2HH5 A;  2G8J A;  4BOZ A;  1PXV A;  1PCI A;  3I06 A;  1CSB B;  2DC8 A;  3N3G A;  1ME4 A;  4YYU A;  4ZUX U;  1KFX L;  2AU1 A;  4IP3 A;  1DF0 A;  1MS6 A;  2DCC A;  2VHS A;  2P0R A;  3BB7 A;  3K8U A;  2E02 A;  4X6H A;  1M6D A;  1PAD A;  1IWD A;  2YJ2 A;  1DEU A;  2XU5 A;  1F29 A;  2BDL A;  2FUD A;  1F2B A;  2WBF X;  3BY4 A;  4BS6 A;  4MSX A;  1ZCM A;  1BQI A;  3IMA A;  9PAP A;  2AYO A;  2DZY A;  2NQD B;  4HXD B;  4X6J A;  5CVO B;  3H89 A;  4I04 A;  3HWN A;  3IFU A;  2HWK A;  4FIP A;  4CDF B;  2AYN A;  3KX1 A;  3F5V A;  1PIP A;  1PVJ A;  3F75 A;  3OVZ A;  2Y5B A;  4YVA A;  3PHW A;  2PAD A;  1SNK A;  4R3D A;  4W5B A;  2DJG B;  4K7C A;  2DOS A;  3QJ3 A;  3IEJ A;  1UKF A;  1NPZ A;  4G54 A;  3MHH A;  1Y4H A;  1GLO A;  2PBH A;  3IV2 A;  1NB5 A;  4OW0 A;  1AYW A;  1YVB A;  3QSD A;  2C0Y A;  3PHU A;  2VHF A;  2YJ8 A;  1AIM A;  1YT7 A;  4PP1 A;  1SP4 B;  5EZQ A;  3ZUA A;  3MTN A;  2FO5 A;  4MM3 B;  4P16 A;  2DZZ A;  2AGA A;  2OP3 A;  2E03 A;  4YYS A;  3IOQ A;  4MZS A;  2Z84 A;  3U8E A;  2BDZ A;  1JQP A;  2R9C A;  3TRK A;  3K9M A;  1HUC B;  3KSE A;  4Q8G A;  3PNR A;  3K24 A;  4D8B A;  1BY8 A;  1O0E A;  1AU4 A;  1PPD A;  4N4Z A;  5EF4 A;  2FT2 A;  1AU3 A;  4M0W A;  2R9O A;  1U9W A;  2R9M A;  4W4U A;  4PP2 E;  3S3R A;  5EZS A;  4BOS A;  3BOW A;  3ZNH A;  4N8W A;  2DC7 A;  2YJB A;  3LFY A;  4RF1 A;  5E6J A;  2R6N A;  5J94 A;  4DMX A;  3OIS A;  4GUA A;  2GHU A;  3KKU A;  3N4C A;  5CVN B;  1MEG A;  3PRM A;  3W30 A;  3MTV A;  2NQG A;  1GCB A;  1AU0 A;  1CB5 A;  1EWP A;  2G7Y A;  1PPP A;  4RNA A;  2HXZ A;  3E9S A;  1QDQ A;  2B1M A;  4PT5 A;  3P5X A;  4I07 A;  3PSE A;  4REZ A;  2DCD A;  2BTW A;  2E01 A;  3OQC A;  4X6I A;  2BU3 A;  1F2C A;  2JRI A;  3NHE A;  5F02 A;  3B21 A;  2NQI A;  2XU1 A;  4QRV A;  3ERV A;  3OVX A;  1PE6 A;  3KWB X;  3W31 A;  2FRA A;  4P6E A;  7PCK A;  3O65 A;  3BBA A;  3B79 A;  2ATO A;  4AXM A;  3PRP A;  2BTW B;  1Q6K A;  4D8I A;  3H7D A;  4RKX A;  3CH2 X;  4XUI A;  1NL6 A;  3P5U A;  2F7D A;  1Y08 A;  2GFO A;  3BPM A;  3RVV A;  2R9N A;  6PAD A;  4QRG A;  3KWZ A;  1AEC A;  1F2A A;  1KFU L;  3E1Z B;  4FJC A;  4WUR A;  3KW9 A;  3H8B A; 
#chains in the Genus database with same CATH homology
 1CQD A;  5PAD A;  3H8C A;  3H6S A;  5JH3 A;  1AYU A;  4QRX A;  2P7U A;  4KLB A;  3IHP A;  3C9E A;  2XU3 A;  3KFQ A;  8PCH A;  3PW3 A;  5CHV A;  1VJV A;  4PAD A;  3HD3 A;  4QBB A;  3CH3 X;  1U5I A;  3DF0 A;  3BCN A;  2F1G A;  3CBJ A;  2PRE A;  1YK7 A;  3V6C A;  4YYR A;  4Q8H A;  2B1N A;  2FTD A;  4RY2 A;  4YYW A;  1VSN A;  3HHI A;  3PDF A;  2G8E A;  5EGW A;  5FPW A;  1NB3 A;  1BP4 A;  2VFC A;  2VFB A;  2HD5 A;  1PPN A;  2AVW A;  4BSQ A;  2H7J A;  2AUX A;  2ARY A;  1AU2 A;  1MEM A;  2AS8 A;  1BGO A;  2ACT A;  2NQA A;  3USV A;  3BPF A;  1AYV A;  1PBH A;  3RVX A;  2DCB A;  2FQ9 A;  3PBH A;  4BS5 A;  1ICF A;  1CVZ A;  5CHT A;  1CJL A;  3BWK A;  1ITO A;  3O0U A;  3V6E A;  4I05 A;  4AXL A;  1KXR A;  2DCA A;  4CDC B;  1NLJ A;  2AUZ A;  5JA7 A;  1FH0 A;  2DC9 A;  4XR7 A;  1GX3 A;  1TU6 A;  1K3B B;  2DJF B;  1QOL A;  1TLO A;  2IBI A;  3MHS A;  1CS8 A;  1EWO A;  4CDE B;  3MOR A;  3I3T A;  4YYV A;  2CB5 A;  1CV8 A;  1GMY A;  4P6G A;  3GCB A;  2JQF R;  2AIM A;  2HHN A;  3QT4 A;  3N3K A;  3HHA A;  3S3Q A;  1EWL A;  3WXF A;  1THE A;  3OF9 A;  4DMY A;  3OF8 A;  3TNX A;  4HWY A;  4YV8 A;  1MHW A;  2G6D A;  3D6S A;  1STF E;  3WXE A;  4OEM A;  2JQG R;  1X9Y A;  1S4V A;  3CBK A;  1A6R A;  4OEL A;  4MZO A;  2XU4 A;  3AI8 A;  4CZW A;  1POP A;  2O6X A;  2E00 A;  1U9V A;  2IPP B;  1KHQ A;  1KHP A;  1ATK A;  2OZ2 A;  4BPV A;  4W5C A;  1YAL A;  4PI3 A;  5K16 A;  3RVW A;  3P5V A;  2CIO A;  1MIR A;  2P86 A;  4FK5 A;  1U9X A;  5A24 A;  2YJC A;  1QMY A;  1U9Q X;  4QH6 A;  1EWM A;  1YK8 A;  4N79 A;  1XKG A;  2YJ9 A;  1NQC A;  1GEC E;  4WA6 A;  3LXS A;  4YYQ A;  5CVM A;  4BGF A;  1ME3 A;  1MDW A;  4BQV A;  1TL9 A;  1PPO A;  3IUT A;  2R9F A;  3BC3 A;  4CDD B;  1EF7 A;  1QXP A;  1CPJ A;  3M99 A;  2Y6E A;  3O1G A;  2OUL A;  3WXG A;  1CTE A;  2FRQ A;  2FYE A;  2DC6 A;  1ZIV A;  2PNS A;  3P5W A;  2HH5 A;  2G8J A;  1PXV A;  1PCI A;  3I06 A;  1CSB B;  2DC8 A;  3N3G A;  1ME4 A;  4NV8 A;  4YYU A;  4ZUX U;  1KFX L;  2AU1 A;  1DF0 A;  1MS6 A;  2DCC A;  2VHS A;  2P0R A;  3LTW A;  3K8U A;  2E02 A;  4X6H A;  1M6D A;  1PAD A;  1IWD A;  2YJ2 A;  1DEU A;  2XU5 A;  1F29 A;  2BDL A;  2FUD A;  1F2B A;  2WBF X;  4BS6 A;  4MSX A;  1ZCM A;  1BQI A;  3IMA A;  9PAP A;  2AYO A;  2DZY A;  2NQD B;  4X6J A;  5CVO B;  3H89 A;  4I04 A;  3HWN A;  4FIP A;  4CDF B;  2AYN A;  3KX1 A;  3F5V A;  1PIP A;  3F75 A;  3OVZ A;  2Y5B A;  4YVA A;  2PAD A;  1SNK A;  4W5B A;  4C5P A;  2DJG B;  4K7C A;  3QJ3 A;  3IEJ A;  1NPZ A;  4G54 A;  3MHH A;  1Y4H A;  1GLO A;  2PBH A;  3IV2 A;  1NB5 A;  1AYW A;  1YVB A;  3QSD A;  2C0Y A;  2VHF A;  2YJ8 A;  1AIM A;  1YT7 A;  4PP1 A;  1SP4 B;  3ZUA A;  3MTN A;  2FO5 A;  4B55 A;  2DZZ A;  2OP3 A;  2E03 A;  4YYS A;  3IOQ A;  4MZS A;  3U8E A;  2BDZ A;  1JQP A;  2R9C A;  3K9M A;  1HUC B;  3KSE A;  4Q8G A;  3PNR A;  3D9W A;  3K24 A;  1BY8 A;  1O0E A;  1AU4 A;  1PPD A;  4N4Z A;  5EF4 A;  2FT2 A;  1AU3 A;  2R9O A;  1W6F A;  1U9W A;  2R9M A;  4W4U A;  4PP2 E;  3S3R A;  1E2T A;  3BOW A;  4N8W A;  2DC7 A;  2YJB A;  3LFY A;  2R6N A;  1W5R A;  5J94 A;  4DMX A;  3OIS A;  2GHU A;  3KKU A;  3N4C A;  5CVN B;  1MEG A;  2NQG A;  4GUZ A;  1GCB A;  1AU0 A;  1CB5 A;  1EWP A;  2G7Y A;  1PPP A;  2HXZ A;  1W4T A;  1QDQ A;  2B1M A;  3P5X A;  4I07 A;  2DCD A;  2E01 A;  4X6I A;  1F2C A;  3NHE A;  5F02 A;  2NQI A;  2XU1 A;  4QRV A;  3ERV A;  3OVX A;  1PE6 A;  3KWB X;  2FRA A;  4P6E A;  7PCK A;  3B79 A;  2ATO A;  4AXM A;  1Q6K A;  2BSZ A;  3H7D A;  3CH2 X;  4XUI A;  1NL6 A;  2F7D A;  3P5U A;  1Y08 A;  2GFO A;  3BPM A;  3RVV A;  2R9N A;  6PAD A;  4QRG A;  3KWZ A;  4NV7 A;  1AEC A;  1F2A A;  1KFU L;  3E1Z B;  4FJC A;  3KW9 A;  3H8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...