1AECA

Crystal structure of actinidin-e-64 complex+
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ACTINIDIN
publication title Crystal structure of an actinidin-E-64 complex.
pubmed doi rcsb
source organism Actinidia chinensis
total genus 65
structure length 218
sequence length 218
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 1992-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aecA00
4CDCB 3CH2X 3HWNA 4AXLA 1AU2A 2XU4A 3NHEA 3F5VA 2BDZA 3TNXA 2AUZA 1EWOA 1U9QX 2XU3A 4MZOA 1BY8A 1O0EA 2R9CA 2R9OA 1DEUA 1NL6A 2CB5A 3BPMA 1PIPA 3QT4A 2Y5BA 3MORA 2F7DA 2AVWA 2NQIA 1SNKA 3RVXA 1CTEA 1CVZA 3V6EA 1NQCA 4QRXA 1KFUL 3K8UA 3K9MA 3H7DA 4G54A 1U9WA 3IEJA 1U5IA 2H7JA 4FJCA 3F75A 1EWLA 1GCBA 2HHNA 9PAPA 1QOLA 3OF9A 4I04A 4X6HA 3QJ3A 1A6RA 4I07A 3PW3A 2DCCA 4N79A 4YYUA 2DCAA 1KFXL 2G8EA 1NB3A 6PADA 3KKUA 2DJGB 3PNRA 1YVBA 2ATOA 2GHUA 3IOQA 2OULA 4FIPA 3S3QA 4QBBA 4PI3A 2HXZA 2ACTA 1FH0A 4ZUXU 1F29A 3O1GA 1ATKA 1PPDA 1YT7A 1U9VA 2WBFX 3CBJA 1NPZA 2E03A 4BQVA 1X9YA 5EGWA 4YVAA 1F2BA 3M99A 4N8WA 4BS5A 1HUCB 3U8EA 4MSXA 5K16A 1ZCMA 2OP3A 1QXPA 1MDWA 1BQIA 1IWDA 2PBHA 3OVXA 1XKGA 2G8JA 3KX1A 2R9NA 2VHSA 3IHPA 8PCHA 1PPOA 1AYWA 2FQ9A 4PP2E 3N3KA 3WXGA 1VSNA 4CDDB 2CIOA 3MHHA 1VJVA 5FPWA 4Q8HA 2YJ9A 1AYVA 1MEMA 3KWZA 3N3GA 2IPPB 3I06A 1EWMA 1BGOA 4DMXA 3ERVA 2O6XA 2DJFB 2FT2A 1CS8A 2YJ2A 1THEA 4PP1A 1GECE 3D6SA 3PBHA 1CJLA 4W4UA 4FK5A 2XU1A 3GCBA 1GMYA 4W5BA 2Y6EA 2AS8A 4BS6A 5PADA 4CZWA 3KW9A 1AU0A 2P86A 1K3BB 3LXSA 4YYRA 3KFQA 7PCKA 2B1MA 1CV8A 4WA6A 5F02A 3PDFA 2FUDA 3H89A 1PBHA 1STFE 3C9EA 3USVA 5JH3A 5CVMA 3RVWA 3DF0A 4DMYA 2FTDA 2DCBA 1QDQA 1TU6A 2AYNA 3P5VA 2YJ8A 2P0RA 1F2CA 2R9FA 1QMYA 4KLBA 2GFOA 2E00A 3OF8A 1ME4A 1TL9A 3P5WA 2NQGA 1AYUA 1ICFA 2JQGR 1ME3A 3AI8A 4YYSA 4BPVA 3MHSA 2JQFR 2E01A 1SP4B 3H6SA 3BOWA 4Q8GA 3CBKA 4CDFB 4RY2A 5CVNB 2DZYA 3ZUAA 2YJCA 3P5XA 2ARYA 2XU5A 4QRGA 4K7CA 3WXFA 2DZZA 2DC7A 2R6NA 4YV8A 1PADA 2E02A 4YYQA 2R9MA 1NB5A 1TLOA 1PPPA 3HD3A 2DC9A 3V6CA 1U9XA 5CHVA 5EF4A 1M6DA 2FYEA 4PADA 3I3TA 1EWPA 4XR7A 1PCIA 1GLOA 2HH5A 2OZ2A 4XUIA 1YK8A 3CH3X 2HD5A 1ITOA 4AXMA 1PPNA 5A24A 2AIMA 2P7UA 3IV2A 2IBIA 3N4CA 1AECA 4P6EA 1S4VA 1Y4HA 2DC6A 4N4ZA 1CPJA 3B79A 1MEGA 5CHTA 4OEMA 4X6IA 5J94A 4OELA 4QRVA 4X6JA 3IMAA 3LFYA 1YK7A 4P6GA 4W5CA 1AU4A 4QH6A 3O0UA 1MIRA 1DF0A 2PNSA 1Y08A 5CVOB 1CSBB 3HHIA 2DC8A 3KWBX 1YALA 2B1NA 3S3RA 2G6DA 1BP4A 3BC3A 3K24A 2YJBA 2PADA 3OVZA 2F1GA 3E1ZB 3MTNA 3WXEA 2AUXA 2AU1A 1POPA 4BSQA 2G7YA 3P5UA 4YYWA 2FO5A 1KHPA 1EF7A 4I05A 1F2AA 3KSEA 2DCDA 1ZIVA 2PREA 1KXRA 1MHWA 3H8BA 2BDLA 2AYOA 3BWKA 1KHQA 3HHAA 3BCNA 1AU3A 2NQAA 1PXVA 1CB5A 3RVVA 4CDEB 1CQDA 1JQPA 1Q6KA 1NLJA 4YYVA 3QSDA 2FRAA 1PE6A 1AIMA 5JA7A 2FRQA 4MZSA 2VHFA 3OISA 2C0YA 4HWYA 2NQDB 3IUTA 1MS6A 3BPFA 3H8CA
chains in the Genus database with same CATH superfamily
5EZSA 4CDCB 3CH2X 3HWNA 4AXLA 4RF0A 1AU2A 2XU4A 3NHEA 4ZTBA 3F5VA 2BDZA 3PSEA 2HWKA 2AUZA 3TNXA 1EWOA 1U9QX 1UKFA 2XU3A 3TMPA 4MZOA 3TRKA 1BY8A 1O0EA 2R9CA 2R9OA 1DEUA 1NL6A 2CB5A 3BPMA 1PIPA 3QT4A 2Y5BA 3MORA 2F7DA 2AVWA 2NQIA 1SNKA 3RVXA 1CTEA 1CVZA 3V6EA 1NQCA 4QRXA 1KFUL 3K8UA 3K9MA 3H7DA 3OQCA 4G54A 1U9WA 3IEJA 1U5IA 4D8EA 2H7JA 4FJCA 3F75A 1EWLA 1GCBA 3ZNHA 3RNVA 2HHNA 9PAPA 1QOLA 3OF9A 4I04A 4X6HA 3QJ3A 1A6RA 4I07A 4BOQA 3PW3A 5E6JA 4IUMA 2DCCA 4N79A 4YYUA 3MP2A 2DCAA 1KFXL 2G8EA 1NB3A 6PADA 3KKUA 2DJGB 3PNRA 1YVBA 2ATOA 2GHUA 3IOQA 2Z84A 2OULA 4FIPA 3S3QA 4QBBA 4PI3A 2HXZA 4MM3B 2FE8A 2ACTA 1FH0A 4ZUXU 1F29A 3O1GA 1ATKA 1PPDA 1YT7A 1PVJA 1U9VA 2WBFX 3CBJA 1NPZA 3B21A 2E03A 4BQVA 1X9YA 5EGWA 4YVAA 4PT5A 1F2BA 3M99A 4N8WA 4BS5A 1HUCB 3U8EA 4MSXA 5K16A 1ZCMA 2OP3A 1QXPA 2BTWA 1MDWA 1BQIA 1IWDA 2PBHA 3OVXA 1XKGA 2G8JA 3KX1A 2R9NA 2VHSA 3IHPA 8PCHA 1PPOA 4HXDB 1AYWA 2FQ9A 4PP2E 3N3KA 3WXGA 1VSNA 4CDDB 2CIOA 3MHHA 3MJ5A 1VJVA 5FPWA 4Q8HA 2YJ9A 1AYVA 1MEMA 3KWZA 3N3GA 2IPPB 3IFUA 3I06A 2J7QC 3PHWA 1EWMA 1BGOA 4MI7A 4DMXA 3ERVA 4RKXA 2O6XA 1DKIA 2DJFB 2FT2A 1CS8A 2YJ2A 3BY4A 1THEA 4PP1A 1GECE 4R3DA 3W31A 3D6SA 3PBHA 1CJLA 4W4UA 4FK5A 4OVZA 2XU1A 3GCBA 1GMYA 4W5BA 2Y6EA 2AGAA 2AS8A 4BS6A 5PADA 4BOZA 4CZWA 3KW9A 4D8IA 4REZA 1AU0A 2P86A 3PT2A 1K3BB 3LXSA 4YYRA 3KFQA 7PCKA 2B1MA 1CV8A 3PHUA 4WA6A 5F02A 3PDFA 2FUDA 4A5UA 3H89A 1PBHA 1STFE 3C9EA 3USVA 5JH3A 5CVMA 3RVWA 3DF0A 4DMYA 4OW0A 2FTDA 2BTWB 1QDQA 1TU6A 2AYNA 2DCBA 3P5VA 2YJ8A 2P0RA 3E9SA 1F2CA 2BU3A 1QMYA 2R9FA 4KLBA 2GFOA 2E00A 3OF8A 1ME4A 1TL9A 3P5WA 2NQGA 1AYUA 3PRPA 1ICFA 2JQGR 1ME3A 3AI8A 4YYSA 4D8BA 3BBAA 5JZEA 4BPVA 3MHSA 2JQFR 2E01A 1SP4B 3H6SA 3BOWA 2DOSA 4Q8GA 3CBKA 4CDFB 4RY2A 5CVNB 2DZYA 3ZUAA 2YJCA 3P5XA 2J7QA 2ARYA 2XU5A 4QRGA 4K7CA 3WXFA 4WURA 2DZZA 2DC7A 2R6NA 4YV8A 1PADA 2E02A 4YYQA 2R9MA 1NB5A 4IP3A 1TLOA 1PPPA 3HD3A 2DC9A 3V6CA 2JTCA 1U9XA 5CHVA 5EF4A 1M6DA 2FYEA 4PADA 3I3TA 1EWPA 4RF1A 4XR7A 1PCIA 1GLOA 2HH5A 2OZ2A 4XUIA 1YK8A 3CH3X 4OVZB 3C0RA 3MTVA 2HD5A 1ITOA 4AXMA 1PPNA 4BOUA 5A24A 2AIMA 2P7UA 3IV2A 4M0WA 2IBIA 3N4CA 1AECA 4P6EA 1S4VA 4BOPA 3PRMA 1Y4HA 2DC6A 4N4ZA 1CPJA 3B79A 1MEGA 5CHTA 4OEMA 4X6IA 5J94A 4OELA 4QRVA 4XZXA 4X6JA 3IMAA 3LFYA 1YK7A 4P6GA 4W5CA 5KO3A 1AU4A 4QH6A 3O0UA 1MIRA 4RNAA 1DF0A 2PNSA 1Y08A 4P16A 1YZBA 3PHXA 5CVOB 1CSBB 3HHIA 2DC8A 3KWBX 1YALA 2B1NA 3S3RA 2JRIA 2G6DA 1BP4A 3BC3A 3K24A 3O65A 2YJBA 2PADA 3OVZA 2F1GA 3E1ZB 3MTNA 3WXEA 2AUXA 2AU1A 1POPA 4BSQA 2G7YA 3P5UA 4YYWA 2FO5A 1KHPA 1EF7A 4I05A 1F2AA 3KSEA 2DCDA 4GUAA 1ZIVA 2PREA 1KXRA 1MHWA 3H8BA 2BDLA 2AYOA 3BWKA 1KHQA 3HHAA 3BCNA 1AU3A 2NQAA 1PXVA 1CB5A 3RVVA 4CDEB 1CQDA 1JQPA 1Q6KA 1NLJA 4YYVA 3QSDA 3BB7A 2FRAA 5EZQA 3W30A 1PE6A 1AIMA 5JA7A 2FRQA 2UZJA 4MZSA 2VHFA 3OISA 2C0YA 4BOSA 4HWYA 2NQDB 3IUTA 1MS6A 3BPFA 3H8CA
chains in the Genus database with same CATH topology
4CDCB 3CH2X 3HWNA 4AXLA 1AU2A 2XU4A 3NHEA 3F5VA 2BDZA 3TNXA 2AUZA 1EWOA 1U9QX 2XU3A 4MZOA 1BY8A 1O0EA 2R9CA 2R9OA 1DEUA 1NL6A 2CB5A 3BPMA 1PIPA 3QT4A 2Y5BA 3MORA 2F7DA 2AVWA 2NQIA 1SNKA 3RVXA 1CTEA 1CVZA 3V6EA 1NQCA 4QRXA 1KFUL 3K8UA 3K9MA 3H7DA 4G54A 1U9WA 3IEJA 1U5IA 2H7JA 4FJCA 3F75A 1EWLA 1GCBA 2HHNA 9PAPA 1QOLA 3OF9A 4I04A 4X6HA 3QJ3A 1A6RA 4I07A 3PW3A 2DCCA 4N79A 4YYUA 2DCAA 1KFXL 2G8EA 1NB3A 6PADA 3KKUA 2DJGB 3PNRA 1YVBA 2ATOA 2GHUA 3IOQA 2OULA 4FIPA 3S3QA 4QBBA 4PI3A 2HXZA 2ACTA 1FH0A 4ZUXU 1F29A 3O1GA 1ATKA 1PPDA 1YT7A 1U9VA 2WBFX 3CBJA 1NPZA 2E03A 4BQVA 1X9YA 5EGWA 4YVAA 4NV7A 1F2BA 3M99A 4N8WA 4BS5A 1HUCB 3U8EA 4MSXA 5K16A 1ZCMA 4BGFA 2OP3A 1QXPA 1MDWA 1BQIA 1IWDA 2PBHA 3OVXA 1XKGA 2G8JA 3KX1A 2R9NA 2VHSA 3IHPA 8PCHA 1PPOA 1AYWA 2FQ9A 4PP2E 3N3KA 3WXGA 1VSNA 4CDDB 2CIOA 3MHHA 1VJVA 5FPWA 4Q8HA 2YJ9A 1AYVA 1MEMA 3KWZA 3N3GA 2IPPB 3I06A 1EWMA 1BGOA 4DMXA 3ERVA 2O6XA 2DJFB 2FT2A 1CS8A 2YJ2A 1THEA 4PP1A 1GECE 3D6SA 3PBHA 1CJLA 4W4UA 4FK5A 2XU1A 3GCBA 1GMYA 4W5BA 2Y6EA 2AS8A 4BS6A 5PADA 3D9WA 4CZWA 3KW9A 1AU0A 2P86A 1K3BB 3LXSA 4YYRA 3KFQA 7PCKA 2B1MA 1CV8A 4WA6A 5F02A 3PDFA 2VFBA 2FUDA 3H89A 1PBHA 4GUZA 1STFE 3C9EA 4NV8A 3USVA 5JH3A 5CVMA 3RVWA 3DF0A 4B55A 4DMYA 2FTDA 2DCBA 1QDQA 1TU6A 2AYNA 3P5VA 2YJ8A 2P0RA 1F2CA 2R9FA 1QMYA 4KLBA 2GFOA 2E00A 3OF8A 1ME4A 1TL9A 3P5WA 2NQGA 1AYUA 1ICFA 2JQGR 1ME3A 3AI8A 4YYSA 4BPVA 3MHSA 2JQFR 2E01A 1SP4B 3H6SA 3BOWA 1W5RA 4Q8GA 3CBKA 4CDFB 4RY2A 5CVNB 2DZYA 3ZUAA 2YJCA 2BSZA 3P5XA 2ARYA 2XU5A 4QRGA 4K7CA 3WXFA 2DZZA 2DC7A 2R6NA 4YV8A 1PADA 2E02A 4YYQA 2R9MA 1NB5A 1TLOA 1PPPA 3HD3A 2DC9A 3V6CA 1U9XA 5CHVA 5EF4A 1M6DA 2FYEA 4PADA 3I3TA 1EWPA 4XR7A 1PCIA 1GLOA 2HH5A 2OZ2A 4XUIA 1YK8A 3CH3X 2HD5A 1ITOA 4AXMA 1PPNA 5A24A 2AIMA 2P7UA 2VFCA 3IV2A 2IBIA 3N4CA 1AECA 4P6EA 1S4VA 1Y4HA 2DC6A 4N4ZA 1CPJA 4C5PA 3B79A 1MEGA 5CHTA 4OEMA 1GX3A 1W4TA 4X6IA 4OELA 5J94A 4QRVA 4X6JA 3IMAA 3LFYA 3LTWA 1YK7A 4P6GA 4W5CA 1AU4A 4QH6A 3O0UA 1MIRA 1DF0A 2PNSA 1Y08A 5CVOB 1CSBB 3HHIA 2DC8A 3KWBX 1YALA 2B1NA 3S3RA 2G6DA 1BP4A 3BC3A 3K24A 2YJBA 2PADA 3OVZA 2F1GA 3E1ZB 3MTNA 3WXEA 2AUXA 2AU1A 1POPA 4BSQA 2G7YA 3P5UA 4YYWA 2FO5A 1KHPA 1EF7A 4I05A 1F2AA 3KSEA 2DCDA 1ZIVA 2PREA 1KXRA 1MHWA 3H8BA 2BDLA 2AYOA 3BWKA 1KHQA 3HHAA 3BCNA 1AU3A 2NQAA 1PXVA 1CB5A 3RVVA 4CDEB 1CQDA 1JQPA 1Q6KA 1NLJA 4YYVA 3QSDA 1E2TA 2FRAA 1PE6A 1AIMA 5JA7A 2FRQA 4MZSA 2VHFA 3OISA 2C0YA 4HWYA 2NQDB 1W6FA 3IUTA 1MS6A 3BPFA 3H8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDC B;  3CH2 X;  3HWN A;  4AXL A;  1AU2 A;  2XU4 A;  3NHE A;  3F5V A;  2BDZ A;  3TNX A;  2AUZ A;  1EWO A;  1U9Q X;  2XU3 A;  4MZO A;  1BY8 A;  1O0E A;  2R9C A;  2R9O A;  1DEU A;  1NL6 A;  2CB5 A;  3BPM A;  1PIP A;  3QT4 A;  2Y5B A;  3MOR A;  2F7D A;  2AVW A;  2NQI A;  1SNK A;  3RVX A;  1CTE A;  1CVZ A;  3V6E A;  1NQC A;  4QRX A;  1KFU L;  3K8U A;  3K9M A;  3H7D A;  4G54 A;  1U9W A;  3IEJ A;  1U5I A;  2H7J A;  4FJC A;  3F75 A;  1EWL A;  1GCB A;  2HHN A;  9PAP A;  1QOL A;  3OF9 A;  4I04 A;  4X6H A;  3QJ3 A;  1A6R A;  4I07 A;  3PW3 A;  2DCC A;  4N79 A;  4YYU A;  2DCA A;  1KFX L;  2G8E A;  1NB3 A;  6PAD A;  3KKU A;  2DJG B;  3PNR A;  1YVB A;  2ATO A;  2GHU A;  3IOQ A;  2OUL A;  4FIP A;  3S3Q A;  4QBB A;  4PI3 A;  2HXZ A;  2ACT A;  1FH0 A;  4ZUX U;  1F29 A;  3O1G A;  1ATK A;  1PPD A;  1YT7 A;  1U9V A;  2WBF X;  3CBJ A;  1NPZ A;  2E03 A;  4BQV A;  1X9Y A;  5EGW A;  4YVA A;  1F2B A;  3M99 A;  4N8W A;  4BS5 A;  1HUC B;  3U8E A;  4MSX A;  5K16 A;  1ZCM A;  2OP3 A;  1QXP A;  1MDW A;  1BQI A;  1IWD A;  2PBH A;  3OVX A;  1XKG A;  2G8J A;  3KX1 A;  2R9N A;  2VHS A;  3IHP A;  8PCH A;  1PPO A;  1AYW A;  2FQ9 A;  4PP2 E;  3N3K A;  3WXG A;  1VSN A;  4CDD B;  2CIO A;  3MHH A;  1VJV A;  5FPW A;  4Q8H A;  2YJ9 A;  1AYV A;  1MEM A;  3KWZ A;  3N3G A;  2IPP B;  3I06 A;  1EWM A;  1BGO A;  4DMX A;  3ERV A;  2O6X A;  2DJF B;  2FT2 A;  1CS8 A;  2YJ2 A;  1THE A;  4PP1 A;  1GEC E;  3D6S A;  3PBH A;  1CJL A;  4W4U A;  4FK5 A;  2XU1 A;  3GCB A;  1GMY A;  4W5B A;  2Y6E A;  2AS8 A;  4BS6 A;  5PAD A;  4CZW A;  3KW9 A;  1AU0 A;  2P86 A;  1K3B B;  3LXS A;  4YYR A;  3KFQ A;  7PCK A;  2B1M A;  1CV8 A;  4WA6 A;  5F02 A;  3PDF A;  2FUD A;  3H89 A;  1PBH A;  1STF E;  3C9E A;  3USV A;  5JH3 A;  5CVM A;  3RVW A;  3DF0 A;  4DMY A;  2FTD A;  2DCB A;  1QDQ A;  1TU6 A;  2AYN A;  3P5V A;  2YJ8 A;  2P0R A;  1F2C A;  2R9F A;  1QMY A;  4KLB A;  2GFO A;  2E00 A;  3OF8 A;  1ME4 A;  1TL9 A;  3P5W A;  2NQG A;  1AYU A;  1ICF A;  2JQG R;  1ME3 A;  3AI8 A;  4YYS A;  4BPV A;  3MHS A;  2JQF R;  2E01 A;  1SP4 B;  3H6S A;  3BOW A;  4Q8G A;  3CBK A;  4CDF B;  4RY2 A;  5CVN B;  2DZY A;  3ZUA A;  2YJC A;  3P5X A;  2ARY A;  2XU5 A;  4QRG A;  4K7C A;  3WXF A;  2DZZ A;  2DC7 A;  2R6N A;  4YV8 A;  1PAD A;  2E02 A;  4YYQ A;  2R9M A;  1NB5 A;  1TLO A;  1PPP A;  3HD3 A;  2DC9 A;  3V6C A;  1U9X A;  5CHV A;  5EF4 A;  1M6D A;  2FYE A;  4PAD A;  3I3T A;  1EWP A;  4XR7 A;  1PCI A;  1GLO A;  2HH5 A;  2OZ2 A;  4XUI A;  1YK8 A;  3CH3 X;  2HD5 A;  1ITO A;  4AXM A;  1PPN A;  5A24 A;  2AIM A;  2P7U A;  3IV2 A;  2IBI A;  3N4C A;  1AEC A;  4P6E A;  1S4V A;  1Y4H A;  2DC6 A;  4N4Z A;  1CPJ A;  3B79 A;  1MEG A;  5CHT A;  4OEM A;  4X6I A;  5J94 A;  4OEL A;  4QRV A;  4X6J A;  3IMA A;  3LFY A;  1YK7 A;  4P6G A;  4W5C A;  1AU4 A;  4QH6 A;  3O0U A;  1MIR A;  1DF0 A;  2PNS A;  1Y08 A;  5CVO B;  1CSB B;  3HHI A;  2DC8 A;  3KWB X;  1YAL A;  2B1N A;  3S3R A;  2G6D A;  1BP4 A;  3BC3 A;  3K24 A;  2YJB A;  2PAD A;  3OVZ A;  2F1G A;  3E1Z B;  3MTN A;  3WXE A;  2AUX A;  2AU1 A;  1POP A;  4BSQ A;  2G7Y A;  3P5U A;  4YYW A;  2FO5 A;  1KHP A;  1EF7 A;  4I05 A;  1F2A A;  3KSE A;  2DCD A;  1ZIV A;  2PRE A;  1KXR A;  1MHW A;  3H8B A;  2BDL A;  2AYO A;  3BWK A;  1KHQ A;  3HHA A;  3BCN A;  1AU3 A;  2NQA A;  1PXV A;  1CB5 A;  3RVV A;  4CDE B;  1CQD A;  1JQP A;  1Q6K A;  1NLJ A;  4YYV A;  3QSD A;  2FRA A;  1PE6 A;  1AIM A;  5JA7 A;  2FRQ A;  4MZS A;  2VHF A;  3OIS A;  2C0Y A;  4HWY A;  2NQD B;  3IUT A;  1MS6 A;  3BPF A;  3H8C A; 
#chains in the Genus database with same CATH topology
 5EZS A;  4CDC B;  3CH2 X;  3HWN A;  4AXL A;  4RF0 A;  1AU2 A;  2XU4 A;  3NHE A;  4ZTB A;  3F5V A;  2BDZ A;  3PSE A;  2HWK A;  2AUZ A;  3TNX A;  1EWO A;  1U9Q X;  1UKF A;  2XU3 A;  3TMP A;  4MZO A;  3TRK A;  1BY8 A;  1O0E A;  2R9C A;  2R9O A;  1DEU A;  1NL6 A;  2CB5 A;  3BPM A;  1PIP A;  3QT4 A;  2Y5B A;  3MOR A;  2F7D A;  2AVW A;  2NQI A;  1SNK A;  3RVX A;  1CTE A;  1CVZ A;  3V6E A;  1NQC A;  4QRX A;  1KFU L;  3K8U A;  3K9M A;  3H7D A;  3OQC A;  4G54 A;  1U9W A;  3IEJ A;  1U5I A;  4D8E A;  2H7J A;  4FJC A;  3F75 A;  1EWL A;  1GCB A;  3ZNH A;  3RNV A;  2HHN A;  9PAP A;  1QOL A;  3OF9 A;  4I04 A;  4X6H A;  3QJ3 A;  1A6R A;  4I07 A;  4BOQ A;  3PW3 A;  5E6J A;  4IUM A;  2DCC A;  4N79 A;  4YYU A;  3MP2 A;  2DCA A;  1KFX L;  2G8E A;  1NB3 A;  6PAD A;  3KKU A;  2DJG B;  3PNR A;  1YVB A;  2ATO A;  2GHU A;  3IOQ A;  2Z84 A;  2OUL A;  4FIP A;  3S3Q A;  4QBB A;  4PI3 A;  2HXZ A;  4MM3 B;  2FE8 A;  2ACT A;  1FH0 A;  4ZUX U;  1F29 A;  3O1G A;  1ATK A;  1PPD A;  1YT7 A;  1PVJ A;  1U9V A;  2WBF X;  3CBJ A;  1NPZ A;  3B21 A;  2E03 A;  4BQV A;  1X9Y A;  5EGW A;  4YVA A;  4PT5 A;  1F2B A;  3M99 A;  4N8W A;  4BS5 A;  1HUC B;  3U8E A;  4MSX A;  5K16 A;  1ZCM A;  2OP3 A;  1QXP A;  2BTW A;  1MDW A;  1BQI A;  1IWD A;  2PBH A;  3OVX A;  1XKG A;  2G8J A;  3KX1 A;  2R9N A;  2VHS A;  3IHP A;  8PCH A;  1PPO A;  4HXD B;  1AYW A;  2FQ9 A;  4PP2 E;  3N3K A;  3WXG A;  1VSN A;  4CDD B;  2CIO A;  3MHH A;  3MJ5 A;  1VJV A;  5FPW A;  4Q8H A;  2YJ9 A;  1AYV A;  1MEM A;  3KWZ A;  3N3G A;  2IPP B;  3IFU A;  3I06 A;  2J7Q C;  3PHW A;  1EWM A;  1BGO A;  4MI7 A;  4DMX A;  3ERV A;  4RKX A;  2O6X A;  1DKI A;  2DJF B;  2FT2 A;  1CS8 A;  2YJ2 A;  3BY4 A;  1THE A;  4PP1 A;  1GEC E;  4R3D A;  3W31 A;  3D6S A;  3PBH A;  1CJL A;  4W4U A;  4FK5 A;  4OVZ A;  2XU1 A;  3GCB A;  1GMY A;  4W5B A;  2Y6E A;  2AGA A;  2AS8 A;  4BS6 A;  5PAD A;  4BOZ A;  4CZW A;  3KW9 A;  4D8I A;  4REZ A;  1AU0 A;  2P86 A;  3PT2 A;  1K3B B;  3LXS A;  4YYR A;  3KFQ A;  7PCK A;  2B1M A;  1CV8 A;  3PHU A;  4WA6 A;  5F02 A;  3PDF A;  2FUD A;  4A5U A;  3H89 A;  1PBH A;  1STF E;  3C9E A;  3USV A;  5JH3 A;  5CVM A;  3RVW A;  3DF0 A;  4DMY A;  4OW0 A;  2FTD A;  2BTW B;  1QDQ A;  1TU6 A;  2AYN A;  2DCB A;  3P5V A;  2YJ8 A;  2P0R A;  3E9S A;  1F2C A;  2BU3 A;  1QMY A;  2R9F A;  4KLB A;  2GFO A;  2E00 A;  3OF8 A;  1ME4 A;  1TL9 A;  3P5W A;  2NQG A;  1AYU A;  3PRP A;  1ICF A;  2JQG R;  1ME3 A;  3AI8 A;  4YYS A;  4D8B A;  3BBA A;  5JZE A;  4BPV A;  3MHS A;  2JQF R;  2E01 A;  1SP4 B;  3H6S A;  3BOW A;  2DOS A;  4Q8G A;  3CBK A;  4CDF B;  4RY2 A;  5CVN B;  2DZY A;  3ZUA A;  2YJC A;  3P5X A;  2J7Q A;  2ARY A;  2XU5 A;  4QRG A;  4K7C A;  3WXF A;  4WUR A;  2DZZ A;  2DC7 A;  2R6N A;  4YV8 A;  1PAD A;  2E02 A;  4YYQ A;  2R9M A;  1NB5 A;  4IP3 A;  1TLO A;  1PPP A;  3HD3 A;  2DC9 A;  3V6C A;  2JTC A;  1U9X A;  5CHV A;  5EF4 A;  1M6D A;  2FYE A;  4PAD A;  3I3T A;  1EWP A;  4RF1 A;  4XR7 A;  1PCI A;  1GLO A;  2HH5 A;  2OZ2 A;  4XUI A;  1YK8 A;  3CH3 X;  4OVZ B;  3C0R A;  3MTV A;  2HD5 A;  1ITO A;  4AXM A;  1PPN A;  4BOU A;  5A24 A;  2AIM A;  2P7U A;  3IV2 A;  4M0W A;  2IBI A;  3N4C A;  1AEC A;  4P6E A;  1S4V A;  4BOP A;  3PRM A;  1Y4H A;  2DC6 A;  4N4Z A;  1CPJ A;  3B79 A;  1MEG A;  5CHT A;  4OEM A;  4X6I A;  5J94 A;  4OEL A;  4QRV A;  4XZX A;  4X6J A;  3IMA A;  3LFY A;  1YK7 A;  4P6G A;  4W5C A;  5KO3 A;  1AU4 A;  4QH6 A;  3O0U A;  1MIR A;  4RNA A;  1DF0 A;  2PNS A;  1Y08 A;  4P16 A;  1YZB A;  3PHX A;  5CVO B;  1CSB B;  3HHI A;  2DC8 A;  3KWB X;  1YAL A;  2B1N A;  3S3R A;  2JRI A;  2G6D A;  1BP4 A;  3BC3 A;  3K24 A;  3O65 A;  2YJB A;  2PAD A;  3OVZ A;  2F1G A;  3E1Z B;  3MTN A;  3WXE A;  2AUX A;  2AU1 A;  1POP A;  4BSQ A;  2G7Y A;  3P5U A;  4YYW A;  2FO5 A;  1KHP A;  1EF7 A;  4I05 A;  1F2A A;  3KSE A;  2DCD A;  4GUA A;  1ZIV A;  2PRE A;  1KXR A;  1MHW A;  3H8B A;  2BDL A;  2AYO A;  3BWK A;  1KHQ A;  3HHA A;  3BCN A;  1AU3 A;  2NQA A;  1PXV A;  1CB5 A;  3RVV A;  4CDE B;  1CQD A;  1JQP A;  1Q6K A;  1NLJ A;  4YYV A;  3QSD A;  3BB7 A;  2FRA A;  5EZQ A;  3W30 A;  1PE6 A;  1AIM A;  5JA7 A;  2FRQ A;  2UZJ A;  4MZS A;  2VHF A;  3OIS A;  2C0Y A;  4BOS A;  4HWY A;  2NQD B;  3IUT A;  1MS6 A;  3BPF A;  3H8C A; 
#chains in the Genus database with same CATH homology
 4CDC B;  3CH2 X;  3HWN A;  4AXL A;  1AU2 A;  2XU4 A;  3NHE A;  3F5V A;  2BDZ A;  3TNX A;  2AUZ A;  1EWO A;  1U9Q X;  2XU3 A;  4MZO A;  1BY8 A;  1O0E A;  2R9C A;  2R9O A;  1DEU A;  1NL6 A;  2CB5 A;  3BPM A;  1PIP A;  3QT4 A;  2Y5B A;  3MOR A;  2F7D A;  2AVW A;  2NQI A;  1SNK A;  3RVX A;  1CTE A;  1CVZ A;  3V6E A;  1NQC A;  4QRX A;  1KFU L;  3K8U A;  3K9M A;  3H7D A;  4G54 A;  1U9W A;  3IEJ A;  1U5I A;  2H7J A;  4FJC A;  3F75 A;  1EWL A;  1GCB A;  2HHN A;  9PAP A;  1QOL A;  3OF9 A;  4I04 A;  4X6H A;  3QJ3 A;  1A6R A;  4I07 A;  3PW3 A;  2DCC A;  4N79 A;  4YYU A;  2DCA A;  1KFX L;  2G8E A;  1NB3 A;  6PAD A;  3KKU A;  2DJG B;  3PNR A;  1YVB A;  2ATO A;  2GHU A;  3IOQ A;  2OUL A;  4FIP A;  3S3Q A;  4QBB A;  4PI3 A;  2HXZ A;  2ACT A;  1FH0 A;  4ZUX U;  1F29 A;  3O1G A;  1ATK A;  1PPD A;  1YT7 A;  1U9V A;  2WBF X;  3CBJ A;  1NPZ A;  2E03 A;  4BQV A;  1X9Y A;  5EGW A;  4YVA A;  4NV7 A;  1F2B A;  3M99 A;  4N8W A;  4BS5 A;  1HUC B;  3U8E A;  4MSX A;  5K16 A;  1ZCM A;  4BGF A;  2OP3 A;  1QXP A;  1MDW A;  1BQI A;  1IWD A;  2PBH A;  3OVX A;  1XKG A;  2G8J A;  3KX1 A;  2R9N A;  2VHS A;  3IHP A;  8PCH A;  1PPO A;  1AYW A;  2FQ9 A;  4PP2 E;  3N3K A;  3WXG A;  1VSN A;  4CDD B;  2CIO A;  3MHH A;  1VJV A;  5FPW A;  4Q8H A;  2YJ9 A;  1AYV A;  1MEM A;  3KWZ A;  3N3G A;  2IPP B;  3I06 A;  1EWM A;  1BGO A;  4DMX A;  3ERV A;  2O6X A;  2DJF B;  2FT2 A;  1CS8 A;  2YJ2 A;  1THE A;  4PP1 A;  1GEC E;  3D6S A;  3PBH A;  1CJL A;  4W4U A;  4FK5 A;  2XU1 A;  3GCB A;  1GMY A;  4W5B A;  2Y6E A;  2AS8 A;  4BS6 A;  5PAD A;  3D9W A;  4CZW A;  3KW9 A;  1AU0 A;  2P86 A;  1K3B B;  3LXS A;  4YYR A;  3KFQ A;  7PCK A;  2B1M A;  1CV8 A;  4WA6 A;  5F02 A;  3PDF A;  2VFB A;  2FUD A;  3H89 A;  1PBH A;  4GUZ A;  1STF E;  3C9E A;  4NV8 A;  3USV A;  5JH3 A;  5CVM A;  3RVW A;  3DF0 A;  4B55 A;  4DMY A;  2FTD A;  2DCB A;  1QDQ A;  1TU6 A;  2AYN A;  3P5V A;  2YJ8 A;  2P0R A;  1F2C A;  2R9F A;  1QMY A;  4KLB A;  2GFO A;  2E00 A;  3OF8 A;  1ME4 A;  1TL9 A;  3P5W A;  2NQG A;  1AYU A;  1ICF A;  2JQG R;  1ME3 A;  3AI8 A;  4YYS A;  4BPV A;  3MHS A;  2JQF R;  2E01 A;  1SP4 B;  3H6S A;  3BOW A;  1W5R A;  4Q8G A;  3CBK A;  4CDF B;  4RY2 A;  5CVN B;  2DZY A;  3ZUA A;  2YJC A;  2BSZ A;  3P5X A;  2ARY A;  2XU5 A;  4QRG A;  4K7C A;  3WXF A;  2DZZ A;  2DC7 A;  2R6N A;  4YV8 A;  1PAD A;  2E02 A;  4YYQ A;  2R9M A;  1NB5 A;  1TLO A;  1PPP A;  3HD3 A;  2DC9 A;  3V6C A;  1U9X A;  5CHV A;  5EF4 A;  1M6D A;  2FYE A;  4PAD A;  3I3T A;  1EWP A;  4XR7 A;  1PCI A;  1GLO A;  2HH5 A;  2OZ2 A;  4XUI A;  1YK8 A;  3CH3 X;  2HD5 A;  1ITO A;  4AXM A;  1PPN A;  5A24 A;  2AIM A;  2P7U A;  2VFC A;  3IV2 A;  2IBI A;  3N4C A;  1AEC A;  4P6E A;  1S4V A;  1Y4H A;  2DC6 A;  4N4Z A;  1CPJ A;  4C5P A;  3B79 A;  1MEG A;  5CHT A;  4OEM A;  1GX3 A;  1W4T A;  4X6I A;  4OEL A;  5J94 A;  4QRV A;  4X6J A;  3IMA A;  3LFY A;  3LTW A;  1YK7 A;  4P6G A;  4W5C A;  1AU4 A;  4QH6 A;  3O0U A;  1MIR A;  1DF0 A;  2PNS A;  1Y08 A;  5CVO B;  1CSB B;  3HHI A;  2DC8 A;  3KWB X;  1YAL A;  2B1N A;  3S3R A;  2G6D A;  1BP4 A;  3BC3 A;  3K24 A;  2YJB A;  2PAD A;  3OVZ A;  2F1G A;  3E1Z B;  3MTN A;  3WXE A;  2AUX A;  2AU1 A;  1POP A;  4BSQ A;  2G7Y A;  3P5U A;  4YYW A;  2FO5 A;  1KHP A;  1EF7 A;  4I05 A;  1F2A A;  3KSE A;  2DCD A;  1ZIV A;  2PRE A;  1KXR A;  1MHW A;  3H8B A;  2BDL A;  2AYO A;  3BWK A;  1KHQ A;  3HHA A;  3BCN A;  1AU3 A;  2NQA A;  1PXV A;  1CB5 A;  3RVV A;  4CDE B;  1CQD A;  1JQP A;  1Q6K A;  1NLJ A;  4YYV A;  3QSD A;  1E2T A;  2FRA A;  1PE6 A;  1AIM A;  5JA7 A;  2FRQ A;  4MZS A;  2VHF A;  3OIS A;  2C0Y A;  4HWY A;  2NQD B;  1W6F A;  3IUT A;  1MS6 A;  3BPF A;  3H8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...