1AECA

Crystal structure of actinidin-e-64 complex+
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTINIDIN
publication title Crystal structure of an actinidin-E-64 complex.
pubmed doi rcsb
source organism Actinidia chinensis
molecule tags Hydrolase
total genus 65
structure length 218
sequence length 218
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 1992-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aecA00
4BSQA 2G7YA 2Y6EA 5CVMA 3WXEA 3NHEA 1EWLA 1KFUL 1F2AA 5J94A 4BPVA 3E1ZB 1VSNA 2ARYA 2PREA 2NQDB 3IMAA 1KXRA 2G8JA 1BP4A 1U9QX 4FJCA 4RY2A 1PE6A 1FH0A 9PAPA 1F2CA 1GMYA 3CH3X 1MEGA 1CJLA 2F1GA 3ZUAA 3RVXA 2NQIA 3MORA 2FRQA 4CDFB 4YYUA 4PI3A 2PNSA 3AI8A 2BDZA 4K7CA 2YJ9A 3C9EA 2B1MA 1CQDA 1MHWA 2IBIA 1PXVA 4YYRA 1QXPA 2HHNA 1QOLA 1AIMA 2R9CA 2XU4A 4OEMA 3H89A 4I04A 2H7JA 1DF0A 3IHPA 1QDQA 1SP4B 1TL9A 2P86A 3K24A 5F02A 4W5BA 1MDWA 1QMYA 4QRXA 3WXGA 1ITOA 2FT2A 3P5XA 5JA7A 2YJ8A 2R9OA 4YVAA 3QT4A 2G6DA 1ME3A 1ICFA 2IPPB 3N4CA 3PW3A 1BQIA 1NPZA 1YK8A 3HHAA 5CVNB 1EWMA 1M6DA 1U5IA 4X6IA 5A24A 3S3QA 2R6NA 2FYEA 5CVOB 1AU3A 2YJ2A 3MTNA 4I05A 3H8CA 4N4ZA 4YYQA 2HD5A 1PBHA 2DC8A 1PPNA 2P0RA 2AUXA 2VHSA 3DF0A 4G54A 2FO5A 4P6GA 3BCNA 2DC6A 2G8EA 2E03A 2E00A 2AUZA 2HH5A 4QRGA 5CHTA 1EWPA 4DMXA 5K16A 1X9YA 2XU3A 3HWNA 3S3RA 3U8EA 3QSDA 2WBFX 3CH2X 4FIPA 3OISA 3CBKA 2DC9A 1MS6A 1AYVA 3I06A 2BDLA 4N8WA 3IEJA 4OELA 4QRVA 2XU5A 3IV2A 1NLJA 3KW9A 1CVZA 1JQPA 1KHPA 1Q6KA 1U9VA 2OZ2A 3KWZA 2F7DA 4X6HA 2HXZA 4AXLA 2E01A 2DCBA 1NB5A 5PADA 2FQ9A 1U9XA 3N3GA 1THEA 2DZYA 2AVWA 4WA6A 2ACTA 3F5VA 3H6SA 3M99A 3BPMA 4MZOA 1POPA 1CTEA 2R9NA 1EF7A 1PPDA 3K9MA 1ME4A 1HUCB 4CDDB 3P5VA 3KSEA 5EF4A 1NL6A 3LFYA 1YT7A 2DJGB 2CB5A 3N3KA 2AIMA 1YVBA 3KFQA 2FRAA 3K8UA 1CS8A 2OP3A 4BS6A 1VJVA 3PBHA 1TU6A 1Y4HA 5JH3A 4ZUXU 3HD3A 2DJFB 1CV8A 3KX1A 1CB5A 2DZZA 3CBJA 2YJBA 4YV8A 1DEUA 3GCBA 4Q8GA 5EGWA 4MZSA 1NB3A 4QH6A 3OVZA 3QJ3A 4BQVA 4XUIA 4YYSA 3B79A 2PADA 7PCKA 4XR7A 4P6EA 2C0YA 3F75A 3IUTA 3BC3A 3ERVA 8PCHA 3HHIA 1XKGA 2DCDA 1AU2A 4X6JA 1A6RA 2R9FA 1STFE 4BS5A 1CPJA 1EWOA 2NQGA 1K3BB 1AYWA 3OF8A 1GLOA 3I3TA 3TNXA 4YYWA 1MEMA 1AU0A 2B1NA 3D6SA 1PPPA 2XU1A 3PDFA 2FUDA 2JQFR 3V6EA 1TLOA 2YJCA 1KFXL 1KHQA 3BPFA 4W4UA 3RVWA 3O0UA 1YALA 2Y5BA 4FK5A 6PADA 1PADA 2PBHA 5CHVA 4HWYA 4N79A 1CSBB 2AS8A 1Y08A 3PNRA 4PP2E 2GFOA 3USVA 1GCBA 1BY8A 3H8BA 3H7DA 4PP1A 4MSXA 4DMYA 2FTDA 2DCCA 3RVVA 2AU1A 3OF9A 3IOQA 2DCAA 1PIPA 1PPOA 2ATOA 1NQCA 1GECE 4CZWA 1O0EA 2R9MA 2GHUA 2DC7A 1S4VA 4PADA 4AXMA 2E02A 3KWBX 1ZIVA 4QBBA 1ATKA 3OVXA 2OULA 1AYUA 3LXSA 2AYNA 2P7UA 1U9WA 4W5CA 3KKUA 1AECA 1PCIA 4I07A 1YK7A 1ZCMA 4KLBA 4Q8HA 5FPWA 3WXFA 3BWKA 1AU4A 3O1GA 2VHFA 2O6XA 2NQAA 3P5UA 3MHHA 2JQGR 3P5WA 3V6CA 2CIOA 1MIRA 4CDEB 4YYVA 1F29A 2AYOA 1IWDA 3BOWA 1BGOA 1F2BA 3MHSA 4CDCB 1SNKA
chains in the Genus database with same CATH superfamily
3BB7A 4BSQA 2G7YA 2Y6EA 5CVMA 3WXEA 3NHEA 1EWLA 1KFUL 5JZEA 1F2AA 5J94A 4BPVA 3E1ZB 1VSNA 2ARYA 2PREA 4BOUA 4OW0A 2NQDB 3IMAA 1KXRA 2G8JA 1BP4A 1U9QX 4FJCA 4RY2A 1PE6A 1FH0A 9PAPA 1F2CA 1GMYA 4REZA 3CH3X 1MEGA 1CJLA 2F1GA 3ZUAA 3RVXA 2NQIA 3MORA 2FRQA 4CDFB 4RNAA 3B21A 4YYUA 4PI3A 2PNSA 3AI8A 2BDZA 4K7CA 4HXDB 2YJ9A 3C9EA 2B1MA 1CQDA 1MHWA 4IP3A 2IBIA 1PXVA 4YYRA 1QXPA 3MP2A 2HHNA 1QOLA 1AIMA 2R9CA 2XU4A 4OEMA 3H89A 4I04A 2H7JA 1DF0A 3PSEA 3IHPA 1QDQA 1SP4B 1TL9A 2P86A 3K24A 5F02A 4M0WA 4W5BA 1MDWA 1QMYA 4QRXA 2BU3A 4BOZA 3WXGA 1ITOA 3PRMA 2FT2A 1YZBA 3P5XA 5JA7A 2YJ8A 2R9OA 4WURA 4D8EA 4YVAA 3QT4A 2G6DA 1ME3A 1ICFA 2IPPB 3N4CA 3PW3A 1BQIA 1NPZA 1YK8A 3HHAA 5CVNB 1EWMA 3RNVA 1M6DA 4IUMA 1U5IA 4BOSA 4X6IA 5A24A 3S3QA 2R6NA 2FYEA 1UKFA 2HWKA 5CVOB 1AU3A 2YJ2A 3MTNA 4I05A 3H8CA 4N4ZA 4YYQA 2HD5A 3W30A 4BOQA 1PBHA 3PRPA 2DC8A 1PPNA 2P0RA 2AUXA 2VHSA 3DF0A 4G54A 2FO5A 4P6GA 3ZNHA 3BCNA 2DC6A 2G8EA 2E03A 2E00A 4XZXA 2AUZA 2HH5A 4QRGA 5CHTA 1EWPA 4DMXA 5K16A 1X9YA 2XU3A 3HWNA 3S3RA 3U8EA 3QSDA 2WBFX 3CH2X 4FIPA 3OISA 3PHXA 3CBKA 2DC9A 1MS6A 1AYVA 3I06A 2AGAA 2BDLA 4N8WA 3IEJA 4OELA 4QRVA 2XU5A 3IV2A 1NLJA 3C0RA 3KW9A 1CVZA 1JQPA 1KHPA 1Q6KA 1U9VA 2OZ2A 3KWZA 2F7DA 4X6HA 2Z84A 4RF0A 2HXZA 3TMPA 4AXLA 2E01A 2DCBA 1NB5A 2J7QA 5PADA 2FQ9A 1U9XA 3N3GA 1THEA 2DZYA 2AVWA 4WA6A 2ACTA 3F5VA 3H6SA 4PT5A 3M99A 3BPMA 4MZOA 1POPA 4ZTBA 1CTEA 2DOSA 1DKIA 2R9NA 1EF7A 4RKXA 4A5UA 1PPDA 3K9MA 1ME4A 1HUCB 2JTCA 4CDDB 3P5VA 3KSEA 3O65A 5EF4A 1NL6A 3LFYA 1YT7A 2DJGB 2CB5A 5EZQA 3N3KA 2AIMA 1YVBA 3PHWA 3KFQA 2FRAA 3K8UA 1CS8A 2OP3A 5E6JA 3TRKA 4BS6A 1VJVA 3PBHA 1TU6A 1Y4HA 5JH3A 4ZUXU 3HD3A 2DJFB 1CV8A 3KX1A 1CB5A 2DZZA 3W31A 3CBJA 2YJBA 4YV8A 1DEUA 3GCBA 4Q8GA 5EGWA 4MZSA 1NB3A 4QH6A 3OVZA 3QJ3A 3E9SA 3MJ5A 4BQVA 4XUIA 2FE8A 4YYSA 3B79A 2PADA 7PCKA 4XR7A 4P6EA 2C0YA 3F75A 3IUTA 3BC3A 3ERVA 8PCHA 3HHIA 1XKGA 2DCDA 1AU2A 5EZSA 4X6JA 1A6RA 2R9FA 1STFE 4BS5A 3BY4A 1CPJA 1EWOA 2NQGA 1K3BB 1AYWA 4D8BA 3PT2A 3OF8A 1GLOA 3I3TA 3TNXA 4YYWA 4D8IA 1MEMA 1AU0A 2B1NA 3D6SA 1PPPA 2XU1A 3PDFA 2FUDA 2JQFR 2JRIA 3V6EA 1TLOA 3MTVA 2YJCA 1KFXL 1KHQA 3BPFA 4W4UA 3RVWA 1PVJA 1YALA 3O0UA 2Y5BA 4FK5A 6PADA 1PADA 2UZJA 2PBHA 5CHVA 4R3DA 4HWYA 4N79A 2J7QC 1CSBB 2AS8A 1Y08A 3OQCA 4P16A 3PNRA 4PP2E 2GFOA 3USVA 1GCBA 1BY8A 3H8BA 3H7DA 4PP1A 4MSXA 4DMYA 2FTDA 2DCCA 3RVVA 2AU1A 3OF9A 3IOQA 2DCAA 1PIPA 1PPOA 2ATOA 1NQCA 1GECE 4CZWA 1O0EA 2R9MA 2GHUA 2DC7A 1S4VA 4PADA 4OVZA 4AXMA 2E02A 3KWBX 1ZIVA 4QBBA 3BBAA 1ATKA 3OVXA 4OVZB 2OULA 2BTWA 1AYUA 3LXSA 2AYNA 2P7UA 1U9WA 4W5CA 3KKUA 1AECA 1PCIA 2BTWB 3PHUA 4I07A 1YK7A 1ZCMA 4KLBA 4MI7A 4Q8HA 5FPWA 3WXFA 3BWKA 1AU4A 4RF1A 3O1GA 2VHFA 2O6XA 2NQAA 3P5UA 4BOPA 3MHHA 2JQGR 3P5WA 4GUAA 3V6CA 4MM3B 2CIOA 5KO3A 1MIRA 4CDEB 3IFUA 4YYVA 1F29A 2AYOA 1IWDA 3BOWA 1BGOA 1F2BA 3MHSA 4CDCB 1SNKA
chains in the Genus database with same CATH topology
4BSQA 2G7YA 2Y6EA 5CVMA 3WXEA 3NHEA 1EWLA 1KFUL 1F2AA 5J94A 4BPVA 3E1ZB 1VSNA 2ARYA 2PREA 3D9WA 2VFCA 2NQDB 3IMAA 1KXRA 2G8JA 1W5RA 1BP4A 1U9QX 4FJCA 4RY2A 1PE6A 1FH0A 9PAPA 1F2CA 1GMYA 3CH3X 1MEGA 1CJLA 2F1GA 3ZUAA 3RVXA 2NQIA 3MORA 2FRQA 4CDFB 4YYUA 4PI3A 2PNSA 3AI8A 2BDZA 4K7CA 2YJ9A 3C9EA 2B1MA 1CQDA 1MHWA 2IBIA 1PXVA 4YYRA 1QXPA 2HHNA 1QOLA 1AIMA 2R9CA 2XU4A 4OEMA 3H89A 4I04A 2H7JA 1DF0A 3IHPA 1QDQA 1SP4B 1TL9A 2P86A 3K24A 4BGFA 5F02A 4W5BA 1MDWA 1QMYA 4QRXA 3WXGA 1ITOA 2FT2A 3P5XA 5JA7A 2YJ8A 2R9OA 4YVAA 3QT4A 2G6DA 1ME3A 1ICFA 2IPPB 3N4CA 3PW3A 1BQIA 1NPZA 1YK8A 3HHAA 5CVNB 1EWMA 4C5PA 1M6DA 1U5IA 4X6IA 5A24A 3S3QA 2R6NA 2FYEA 5CVOB 1AU3A 2YJ2A 3MTNA 3LTWA 4I05A 3H8CA 4N4ZA 4YYQA 2HD5A 1PBHA 2DC8A 1PPNA 2P0RA 2AUXA 2VHSA 3DF0A 4G54A 2FO5A 4P6GA 3BCNA 2DC6A 2G8EA 2E03A 2E00A 2AUZA 2HH5A 4QRGA 5CHTA 1EWPA 4DMXA 5K16A 1X9YA 2XU3A 3HWNA 3S3RA 3U8EA 3QSDA 2WBFX 3CH2X 4FIPA 3OISA 3CBKA 2DC9A 1MS6A 1AYVA 3I06A 2BDLA 4N8WA 3IEJA 4OELA 4QRVA 2XU5A 2VFBA 3IV2A 1NLJA 3KW9A 1CVZA 1JQPA 1KHPA 1Q6KA 1U9VA 2OZ2A 3KWZA 2F7DA 4X6HA 2HXZA 4AXLA 2E01A 2DCBA 1NB5A 5PADA 2FQ9A 1U9XA 3N3GA 1THEA 2DZYA 4B55A 2AVWA 4WA6A 2ACTA 3F5VA 3H6SA 3M99A 3BPMA 4MZOA 1POPA 1CTEA 2R9NA 1EF7A 1PPDA 3K9MA 1ME4A 1HUCB 4CDDB 3P5VA 3KSEA 5EF4A 1NL6A 3LFYA 1YT7A 2DJGB 2CB5A 3N3KA 4NV7A 2AIMA 1YVBA 3KFQA 2FRAA 3K8UA 1CS8A 2OP3A 1W6FA 4BS6A 1VJVA 3PBHA 1TU6A 1Y4HA 5JH3A 4ZUXU 3HD3A 2DJFB 1CV8A 3KX1A 1CB5A 2DZZA 3CBJA 2YJBA 4YV8A 1DEUA 3GCBA 4Q8GA 5EGWA 4MZSA 1NB3A 4QH6A 3OVZA 3QJ3A 4BQVA 4XUIA 4YYSA 3B79A 2PADA 7PCKA 4XR7A 4P6EA 2C0YA 3F75A 3IUTA 3BC3A 3ERVA 8PCHA 3HHIA 1XKGA 2DCDA 1AU2A 4X6JA 1A6RA 2R9FA 1STFE 4BS5A 1CPJA 1EWOA 2NQGA 1K3BB 1AYWA 3OF8A 1GLOA 3I3TA 3TNXA 4YYWA 1MEMA 1AU0A 2B1NA 3D6SA 1PPPA 2XU1A 3PDFA 2FUDA 2JQFR 3V6EA 1TLOA 2YJCA 1KFXL 1KHQA 3BPFA 4W4UA 3RVWA 3O0UA 1YALA 2Y5BA 4FK5A 6PADA 1PADA 2PBHA 5CHVA 4HWYA 4N79A 4GUZA 1CSBB 2AS8A 1Y08A 1GX3A 3PNRA 4PP2E 2GFOA 3USVA 1GCBA 1BY8A 3H8BA 3H7DA 4PP1A 4MSXA 4DMYA 2FTDA 2DCCA 3RVVA 2AU1A 3OF9A 3IOQA 2DCAA 1PIPA 1PPOA 2ATOA 1NQCA 1GECE 4CZWA 1O0EA 2R9MA 2GHUA 1E2TA 2DC7A 1S4VA 4PADA 4AXMA 2E02A 3KWBX 1ZIVA 4QBBA 1ATKA 3OVXA 2OULA 1AYUA 3LXSA 2AYNA 2P7UA 1U9WA 4W5CA 3KKUA 1AECA 1PCIA 4I07A 1YK7A 1ZCMA 4KLBA 4Q8HA 5FPWA 3WXFA 3BWKA 1AU4A 3O1GA 2VHFA 2O6XA 1W4TA 2BSZA 2NQAA 3P5UA 3MHHA 2JQGR 3P5WA 3V6CA 2CIOA 1MIRA 4CDEB 4YYVA 1F29A 2AYOA 1IWDA 3BOWA 4NV8A 1BGOA 1F2BA 3MHSA 4CDCB 1SNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSQ A;  2G7Y A;  2Y6E A;  5CVM A;  3WXE A;  3NHE A;  1EWL A;  1KFU L;  1F2A A;  5J94 A;  4BPV A;  3E1Z B;  1VSN A;  2ARY A;  2PRE A;  2NQD B;  3IMA A;  1KXR A;  2G8J A;  1BP4 A;  1U9Q X;  4FJC A;  4RY2 A;  1PE6 A;  1FH0 A;  9PAP A;  1F2C A;  1GMY A;  3CH3 X;  1MEG A;  1CJL A;  2F1G A;  3ZUA A;  3RVX A;  2NQI A;  3MOR A;  2FRQ A;  4CDF B;  4YYU A;  4PI3 A;  2PNS A;  3AI8 A;  2BDZ A;  4K7C A;  2YJ9 A;  3C9E A;  2B1M A;  1CQD A;  1MHW A;  2IBI A;  1PXV A;  4YYR A;  1QXP A;  2HHN A;  1QOL A;  1AIM A;  2R9C A;  2XU4 A;  4OEM A;  3H89 A;  4I04 A;  2H7J A;  1DF0 A;  3IHP A;  1QDQ A;  1SP4 B;  1TL9 A;  2P86 A;  3K24 A;  5F02 A;  4W5B A;  1MDW A;  1QMY A;  4QRX A;  3WXG A;  1ITO A;  2FT2 A;  3P5X A;  5JA7 A;  2YJ8 A;  2R9O A;  4YVA A;  3QT4 A;  2G6D A;  1ME3 A;  1ICF A;  2IPP B;  3N4C A;  3PW3 A;  1BQI A;  1NPZ A;  1YK8 A;  3HHA A;  5CVN B;  1EWM A;  1M6D A;  1U5I A;  4X6I A;  5A24 A;  3S3Q A;  2R6N A;  2FYE A;  5CVO B;  1AU3 A;  2YJ2 A;  3MTN A;  4I05 A;  3H8C A;  4N4Z A;  4YYQ A;  2HD5 A;  1PBH A;  2DC8 A;  1PPN A;  2P0R A;  2AUX A;  2VHS A;  3DF0 A;  4G54 A;  2FO5 A;  4P6G A;  3BCN A;  2DC6 A;  2G8E A;  2E03 A;  2E00 A;  2AUZ A;  2HH5 A;  4QRG A;  5CHT A;  1EWP A;  4DMX A;  5K16 A;  1X9Y A;  2XU3 A;  3HWN A;  3S3R A;  3U8E A;  3QSD A;  2WBF X;  3CH2 X;  4FIP A;  3OIS A;  3CBK A;  2DC9 A;  1MS6 A;  1AYV A;  3I06 A;  2BDL A;  4N8W A;  3IEJ A;  4OEL A;  4QRV A;  2XU5 A;  3IV2 A;  1NLJ A;  3KW9 A;  1CVZ A;  1JQP A;  1KHP A;  1Q6K A;  1U9V A;  2OZ2 A;  3KWZ A;  2F7D A;  4X6H A;  2HXZ A;  4AXL A;  2E01 A;  2DCB A;  1NB5 A;  5PAD A;  2FQ9 A;  1U9X A;  3N3G A;  1THE A;  2DZY A;  2AVW A;  4WA6 A;  2ACT A;  3F5V A;  3H6S A;  3M99 A;  3BPM A;  4MZO A;  1POP A;  1CTE A;  2R9N A;  1EF7 A;  1PPD A;  3K9M A;  1ME4 A;  1HUC B;  4CDD B;  3P5V A;  3KSE A;  5EF4 A;  1NL6 A;  3LFY A;  1YT7 A;  2DJG B;  2CB5 A;  3N3K A;  2AIM A;  1YVB A;  3KFQ A;  2FRA A;  3K8U A;  1CS8 A;  2OP3 A;  4BS6 A;  1VJV A;  3PBH A;  1TU6 A;  1Y4H A;  5JH3 A;  4ZUX U;  3HD3 A;  2DJF B;  1CV8 A;  3KX1 A;  1CB5 A;  2DZZ A;  3CBJ A;  2YJB A;  4YV8 A;  1DEU A;  3GCB A;  4Q8G A;  5EGW A;  4MZS A;  1NB3 A;  4QH6 A;  3OVZ A;  3QJ3 A;  4BQV A;  4XUI A;  4YYS A;  3B79 A;  2PAD A;  7PCK A;  4XR7 A;  4P6E A;  2C0Y A;  3F75 A;  3IUT A;  3BC3 A;  3ERV A;  8PCH A;  3HHI A;  1XKG A;  2DCD A;  1AU2 A;  4X6J A;  1A6R A;  2R9F A;  1STF E;  4BS5 A;  1CPJ A;  1EWO A;  2NQG A;  1K3B B;  1AYW A;  3OF8 A;  1GLO A;  3I3T A;  3TNX A;  4YYW A;  1MEM A;  1AU0 A;  2B1N A;  3D6S A;  1PPP A;  2XU1 A;  3PDF A;  2FUD A;  2JQF R;  3V6E A;  1TLO A;  2YJC A;  1KFX L;  1KHQ A;  3BPF A;  4W4U A;  3RVW A;  3O0U A;  1YAL A;  2Y5B A;  4FK5 A;  6PAD A;  1PAD A;  2PBH A;  5CHV A;  4HWY A;  4N79 A;  1CSB B;  2AS8 A;  1Y08 A;  3PNR A;  4PP2 E;  2GFO A;  3USV A;  1GCB A;  1BY8 A;  3H8B A;  3H7D A;  4PP1 A;  4MSX A;  4DMY A;  2FTD A;  2DCC A;  3RVV A;  2AU1 A;  3OF9 A;  3IOQ A;  2DCA A;  1PIP A;  1PPO A;  2ATO A;  1NQC A;  1GEC E;  4CZW A;  1O0E A;  2R9M A;  2GHU A;  2DC7 A;  1S4V A;  4PAD A;  4AXM A;  2E02 A;  3KWB X;  1ZIV A;  4QBB A;  1ATK A;  3OVX A;  2OUL A;  1AYU A;  3LXS A;  2AYN A;  2P7U A;  1U9W A;  4W5C A;  3KKU A;  1AEC A;  1PCI A;  4I07 A;  1YK7 A;  1ZCM A;  4KLB A;  4Q8H A;  5FPW A;  3WXF A;  3BWK A;  1AU4 A;  3O1G A;  2VHF A;  2O6X A;  2NQA A;  3P5U A;  3MHH A;  2JQG R;  3P5W A;  3V6C A;  2CIO A;  1MIR A;  4CDE B;  4YYV A;  1F29 A;  2AYO A;  1IWD A;  3BOW A;  1BGO A;  1F2B A;  3MHS A;  4CDC B;  1SNK A; 
#chains in the Genus database with same CATH topology
 3BB7 A;  4BSQ A;  2G7Y A;  2Y6E A;  5CVM A;  3WXE A;  3NHE A;  1EWL A;  1KFU L;  5JZE A;  1F2A A;  5J94 A;  4BPV A;  3E1Z B;  1VSN A;  2ARY A;  2PRE A;  4BOU A;  4OW0 A;  2NQD B;  3IMA A;  1KXR A;  2G8J A;  1BP4 A;  1U9Q X;  4FJC A;  4RY2 A;  1PE6 A;  1FH0 A;  9PAP A;  1F2C A;  1GMY A;  4REZ A;  3CH3 X;  1MEG A;  1CJL A;  2F1G A;  3ZUA A;  3RVX A;  2NQI A;  3MOR A;  2FRQ A;  4CDF B;  4RNA A;  3B21 A;  4YYU A;  4PI3 A;  2PNS A;  3AI8 A;  2BDZ A;  4K7C A;  4HXD B;  2YJ9 A;  3C9E A;  2B1M A;  1CQD A;  1MHW A;  4IP3 A;  2IBI A;  1PXV A;  4YYR A;  1QXP A;  3MP2 A;  2HHN A;  1QOL A;  1AIM A;  2R9C A;  2XU4 A;  4OEM A;  3H89 A;  4I04 A;  2H7J A;  1DF0 A;  3PSE A;  3IHP A;  1QDQ A;  1SP4 B;  1TL9 A;  2P86 A;  3K24 A;  5F02 A;  4M0W A;  4W5B A;  1MDW A;  1QMY A;  4QRX A;  2BU3 A;  4BOZ A;  3WXG A;  1ITO A;  3PRM A;  2FT2 A;  1YZB A;  3P5X A;  5JA7 A;  2YJ8 A;  2R9O A;  4WUR A;  4D8E A;  4YVA A;  3QT4 A;  2G6D A;  1ME3 A;  1ICF A;  2IPP B;  3N4C A;  3PW3 A;  1BQI A;  1NPZ A;  1YK8 A;  3HHA A;  5CVN B;  1EWM A;  3RNV A;  1M6D A;  4IUM A;  1U5I A;  4BOS A;  4X6I A;  5A24 A;  3S3Q A;  2R6N A;  2FYE A;  1UKF A;  2HWK A;  5CVO B;  1AU3 A;  2YJ2 A;  3MTN A;  4I05 A;  3H8C A;  4N4Z A;  4YYQ A;  2HD5 A;  3W30 A;  4BOQ A;  1PBH A;  3PRP A;  2DC8 A;  1PPN A;  2P0R A;  2AUX A;  2VHS A;  3DF0 A;  4G54 A;  2FO5 A;  4P6G A;  3ZNH A;  3BCN A;  2DC6 A;  2G8E A;  2E03 A;  2E00 A;  4XZX A;  2AUZ A;  2HH5 A;  4QRG A;  5CHT A;  1EWP A;  4DMX A;  5K16 A;  1X9Y A;  2XU3 A;  3HWN A;  3S3R A;  3U8E A;  3QSD A;  2WBF X;  3CH2 X;  4FIP A;  3OIS A;  3PHX A;  3CBK A;  2DC9 A;  1MS6 A;  1AYV A;  3I06 A;  2AGA A;  2BDL A;  4N8W A;  3IEJ A;  4OEL A;  4QRV A;  2XU5 A;  3IV2 A;  1NLJ A;  3C0R A;  3KW9 A;  1CVZ A;  1JQP A;  1KHP A;  1Q6K A;  1U9V A;  2OZ2 A;  3KWZ A;  2F7D A;  4X6H A;  2Z84 A;  4RF0 A;  2HXZ A;  3TMP A;  4AXL A;  2E01 A;  2DCB A;  1NB5 A;  2J7Q A;  5PAD A;  2FQ9 A;  1U9X A;  3N3G A;  1THE A;  2DZY A;  2AVW A;  4WA6 A;  2ACT A;  3F5V A;  3H6S A;  4PT5 A;  3M99 A;  3BPM A;  4MZO A;  1POP A;  4ZTB A;  1CTE A;  2DOS A;  1DKI A;  2R9N A;  1EF7 A;  4RKX A;  4A5U A;  1PPD A;  3K9M A;  1ME4 A;  1HUC B;  2JTC A;  4CDD B;  3P5V A;  3KSE A;  3O65 A;  5EF4 A;  1NL6 A;  3LFY A;  1YT7 A;  2DJG B;  2CB5 A;  5EZQ A;  3N3K A;  2AIM A;  1YVB A;  3PHW A;  3KFQ A;  2FRA A;  3K8U A;  1CS8 A;  2OP3 A;  5E6J A;  3TRK A;  4BS6 A;  1VJV A;  3PBH A;  1TU6 A;  1Y4H A;  5JH3 A;  4ZUX U;  3HD3 A;  2DJF B;  1CV8 A;  3KX1 A;  1CB5 A;  2DZZ A;  3W31 A;  3CBJ A;  2YJB A;  4YV8 A;  1DEU A;  3GCB A;  4Q8G A;  5EGW A;  4MZS A;  1NB3 A;  4QH6 A;  3OVZ A;  3QJ3 A;  3E9S A;  3MJ5 A;  4BQV A;  4XUI A;  2FE8 A;  4YYS A;  3B79 A;  2PAD A;  7PCK A;  4XR7 A;  4P6E A;  2C0Y A;  3F75 A;  3IUT A;  3BC3 A;  3ERV A;  8PCH A;  3HHI A;  1XKG A;  2DCD A;  1AU2 A;  5EZS A;  4X6J A;  1A6R A;  2R9F A;  1STF E;  4BS5 A;  3BY4 A;  1CPJ A;  1EWO A;  2NQG A;  1K3B B;  1AYW A;  4D8B A;  3PT2 A;  3OF8 A;  1GLO A;  3I3T A;  3TNX A;  4YYW A;  4D8I A;  1MEM A;  1AU0 A;  2B1N A;  3D6S A;  1PPP A;  2XU1 A;  3PDF A;  2FUD A;  2JQF R;  2JRI A;  3V6E A;  1TLO A;  3MTV A;  2YJC A;  1KFX L;  1KHQ A;  3BPF A;  4W4U A;  3RVW A;  1PVJ A;  1YAL A;  3O0U A;  2Y5B A;  4FK5 A;  6PAD A;  1PAD A;  2UZJ A;  2PBH A;  5CHV A;  4R3D A;  4HWY A;  4N79 A;  2J7Q C;  1CSB B;  2AS8 A;  1Y08 A;  3OQC A;  4P16 A;  3PNR A;  4PP2 E;  2GFO A;  3USV A;  1GCB A;  1BY8 A;  3H8B A;  3H7D A;  4PP1 A;  4MSX A;  4DMY A;  2FTD A;  2DCC A;  3RVV A;  2AU1 A;  3OF9 A;  3IOQ A;  2DCA A;  1PIP A;  1PPO A;  2ATO A;  1NQC A;  1GEC E;  4CZW A;  1O0E A;  2R9M A;  2GHU A;  2DC7 A;  1S4V A;  4PAD A;  4OVZ A;  4AXM A;  2E02 A;  3KWB X;  1ZIV A;  4QBB A;  3BBA A;  1ATK A;  3OVX A;  4OVZ B;  2OUL A;  2BTW A;  1AYU A;  3LXS A;  2AYN A;  2P7U A;  1U9W A;  4W5C A;  3KKU A;  1AEC A;  1PCI A;  2BTW B;  3PHU A;  4I07 A;  1YK7 A;  1ZCM A;  4KLB A;  4MI7 A;  4Q8H A;  5FPW A;  3WXF A;  3BWK A;  1AU4 A;  4RF1 A;  3O1G A;  2VHF A;  2O6X A;  2NQA A;  3P5U A;  4BOP A;  3MHH A;  2JQG R;  3P5W A;  4GUA A;  3V6C A;  4MM3 B;  2CIO A;  5KO3 A;  1MIR A;  4CDE B;  3IFU A;  4YYV A;  1F29 A;  2AYO A;  1IWD A;  3BOW A;  1BGO A;  1F2B A;  3MHS A;  4CDC B;  1SNK A; 
#chains in the Genus database with same CATH homology
 4BSQ A;  2G7Y A;  2Y6E A;  5CVM A;  3WXE A;  3NHE A;  1EWL A;  1KFU L;  1F2A A;  5J94 A;  4BPV A;  3E1Z B;  1VSN A;  2ARY A;  2PRE A;  3D9W A;  2VFC A;  2NQD B;  3IMA A;  1KXR A;  2G8J A;  1W5R A;  1BP4 A;  1U9Q X;  4FJC A;  4RY2 A;  1PE6 A;  1FH0 A;  9PAP A;  1F2C A;  1GMY A;  3CH3 X;  1MEG A;  1CJL A;  2F1G A;  3ZUA A;  3RVX A;  2NQI A;  3MOR A;  2FRQ A;  4CDF B;  4YYU A;  4PI3 A;  2PNS A;  3AI8 A;  2BDZ A;  4K7C A;  2YJ9 A;  3C9E A;  2B1M A;  1CQD A;  1MHW A;  2IBI A;  1PXV A;  4YYR A;  1QXP A;  2HHN A;  1QOL A;  1AIM A;  2R9C A;  2XU4 A;  4OEM A;  3H89 A;  4I04 A;  2H7J A;  1DF0 A;  3IHP A;  1QDQ A;  1SP4 B;  1TL9 A;  2P86 A;  3K24 A;  4BGF A;  5F02 A;  4W5B A;  1MDW A;  1QMY A;  4QRX A;  3WXG A;  1ITO A;  2FT2 A;  3P5X A;  5JA7 A;  2YJ8 A;  2R9O A;  4YVA A;  3QT4 A;  2G6D A;  1ME3 A;  1ICF A;  2IPP B;  3N4C A;  3PW3 A;  1BQI A;  1NPZ A;  1YK8 A;  3HHA A;  5CVN B;  1EWM A;  4C5P A;  1M6D A;  1U5I A;  4X6I A;  5A24 A;  3S3Q A;  2R6N A;  2FYE A;  5CVO B;  1AU3 A;  2YJ2 A;  3MTN A;  3LTW A;  4I05 A;  3H8C A;  4N4Z A;  4YYQ A;  2HD5 A;  1PBH A;  2DC8 A;  1PPN A;  2P0R A;  2AUX A;  2VHS A;  3DF0 A;  4G54 A;  2FO5 A;  4P6G A;  3BCN A;  2DC6 A;  2G8E A;  2E03 A;  2E00 A;  2AUZ A;  2HH5 A;  4QRG A;  5CHT A;  1EWP A;  4DMX A;  5K16 A;  1X9Y A;  2XU3 A;  3HWN A;  3S3R A;  3U8E A;  3QSD A;  2WBF X;  3CH2 X;  4FIP A;  3OIS A;  3CBK A;  2DC9 A;  1MS6 A;  1AYV A;  3I06 A;  2BDL A;  4N8W A;  3IEJ A;  4OEL A;  4QRV A;  2XU5 A;  2VFB A;  3IV2 A;  1NLJ A;  3KW9 A;  1CVZ A;  1JQP A;  1KHP A;  1Q6K A;  1U9V A;  2OZ2 A;  3KWZ A;  2F7D A;  4X6H A;  2HXZ A;  4AXL A;  2E01 A;  2DCB A;  1NB5 A;  5PAD A;  2FQ9 A;  1U9X A;  3N3G A;  1THE A;  2DZY A;  4B55 A;  2AVW A;  4WA6 A;  2ACT A;  3F5V A;  3H6S A;  3M99 A;  3BPM A;  4MZO A;  1POP A;  1CTE A;  2R9N A;  1EF7 A;  1PPD A;  3K9M A;  1ME4 A;  1HUC B;  4CDD B;  3P5V A;  3KSE A;  5EF4 A;  1NL6 A;  3LFY A;  1YT7 A;  2DJG B;  2CB5 A;  3N3K A;  4NV7 A;  2AIM A;  1YVB A;  3KFQ A;  2FRA A;  3K8U A;  1CS8 A;  2OP3 A;  1W6F A;  4BS6 A;  1VJV A;  3PBH A;  1TU6 A;  1Y4H A;  5JH3 A;  4ZUX U;  3HD3 A;  2DJF B;  1CV8 A;  3KX1 A;  1CB5 A;  2DZZ A;  3CBJ A;  2YJB A;  4YV8 A;  1DEU A;  3GCB A;  4Q8G A;  5EGW A;  4MZS A;  1NB3 A;  4QH6 A;  3OVZ A;  3QJ3 A;  4BQV A;  4XUI A;  4YYS A;  3B79 A;  2PAD A;  7PCK A;  4XR7 A;  4P6E A;  2C0Y A;  3F75 A;  3IUT A;  3BC3 A;  3ERV A;  8PCH A;  3HHI A;  1XKG A;  2DCD A;  1AU2 A;  4X6J A;  1A6R A;  2R9F A;  1STF E;  4BS5 A;  1CPJ A;  1EWO A;  2NQG A;  1K3B B;  1AYW A;  3OF8 A;  1GLO A;  3I3T A;  3TNX A;  4YYW A;  1MEM A;  1AU0 A;  2B1N A;  3D6S A;  1PPP A;  2XU1 A;  3PDF A;  2FUD A;  2JQF R;  3V6E A;  1TLO A;  2YJC A;  1KFX L;  1KHQ A;  3BPF A;  4W4U A;  3RVW A;  3O0U A;  1YAL A;  2Y5B A;  4FK5 A;  6PAD A;  1PAD A;  2PBH A;  5CHV A;  4HWY A;  4N79 A;  4GUZ A;  1CSB B;  2AS8 A;  1Y08 A;  1GX3 A;  3PNR A;  4PP2 E;  2GFO A;  3USV A;  1GCB A;  1BY8 A;  3H8B A;  3H7D A;  4PP1 A;  4MSX A;  4DMY A;  2FTD A;  2DCC A;  3RVV A;  2AU1 A;  3OF9 A;  3IOQ A;  2DCA A;  1PIP A;  1PPO A;  2ATO A;  1NQC A;  1GEC E;  4CZW A;  1O0E A;  2R9M A;  2GHU A;  1E2T A;  2DC7 A;  1S4V A;  4PAD A;  4AXM A;  2E02 A;  3KWB X;  1ZIV A;  4QBB A;  1ATK A;  3OVX A;  2OUL A;  1AYU A;  3LXS A;  2AYN A;  2P7U A;  1U9W A;  4W5C A;  3KKU A;  1AEC A;  1PCI A;  4I07 A;  1YK7 A;  1ZCM A;  4KLB A;  4Q8H A;  5FPW A;  3WXF A;  3BWK A;  1AU4 A;  3O1G A;  2VHF A;  2O6X A;  1W4T A;  2BSZ A;  2NQA A;  3P5U A;  3MHH A;  2JQG R;  3P5W A;  3V6C A;  2CIO A;  1MIR A;  4CDE B;  4YYV A;  1F29 A;  2AYO A;  1IWD A;  3BOW A;  4NV8 A;  1BGO A;  1F2B A;  3MHS A;  4CDC B;  1SNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...