1AECA

Crystal structure of actinidin-e-64 complex+
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
b'LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTINIDIN
publication title Crystal structure of an actinidin-E-64 complex.
pubmed doi rcsb
source organism Actinidia chinensis
molecule tags Hydrolase
total genus 65
structure length 218
sequence length 218
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 1992-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aecA00
1POPA 3E1ZB 1STFE 3MHSA 1U5IA 3HHIA 2PREA 1NB3A 1KFUL 1PCIA 2DCCA 3PW3A 1HUCB 1KHPA 3ERVA 3CBJA 3IUTA 3H6SA 1KFXL 2FQ9A 4PP2E 4MZOA 1THEA 2FO5A 1BQIA 1PXVA 1O0EA 3IV2A 3MTNA 1ATKA 1PE6A 3WXGA 2XU4A 1U9XA 2CB5A 3K8UA 4QRVA 1M6DA 3IEJA 1PIPA 1SNKA 1FH0A 4P6GA 4BQVA 3MORA 7PCKA 4Q8GA 2OZ2A 2DC6A 3OVXA 4N8WA 3KSEA 3F5VA 4PP1A 3WXEA 2G7YA 2YJ9A 2AVWA 1ZIVA 1JQPA 3KKUA 1Y4HA 3QT4A 1CVZA 4YYRA 4PADA 5PADA 3QSDA 2R6NA 2BDZA 2G6DA 3O0UA 1F29A 3H8BA 4XR7A 1NL6A 3KX1A 1YK7A 5EF4A 1QDQA 3P5WA 3U8EA 1AU2A 3O1GA 3RVXA 3OF9A 1TL9A 1KHQA 1GCBA 1CSBB 3OVZA 2AS8A 2GHUA 2NQGA 1BP4A 2YJ2A 3BWKA 3S3QA 2P86A 1ITOA 1PPNA 3BPMA 2AIMA 4X6IA 3M99A 1EWPA 1U9VA 3HD3A 2OULA 5CHTA 1AU4A 2WBFX 3QJ3A 1YT7A 1BGOA 2DZYA 4K7CA 3LXSA 2FTDA 4N79A 1PPPA 2E02A 3CH2X 1EWLA 4YYQA 3IOQA 3K9MA 1MHWA 1NQCA 3CH3X 1GECE 9PAPA 1PADA 2R9CA 4YV8A 4BPVA 1CJLA 1CB5A 1MEMA 2DJGB 2DC7A 4BS6A 4G54A 6PADA 2FYEA 1MS6A 1DF0A 2DCDA 1KXRA 2DCAA 5J94A 1CQDA 3P5XA 1EF7A 4DMXA 4FIPA 3TNXA 1CPJA 2E03A 2YJCA 4QBBA 2VHSA 2IBIA 3V6CA 3IMAA 2DZZA 2HD5A 3H8CA 3S3RA 1SP4B 2PBHA 2FRAA 2G8EA 3NHEA 3N3GA 4W5CA 4Q8HA 4MZSA 1Y08A 4YYUA 3I3TA 4P6EA 1VSNA 1GMYA 4CDEB 1F2BA 2XU3A 4X6JA 3PBHA 1AECA 2IPPB 3CBKA 3C9EA 4HWYA 4W5BA 1U9WA 4CDCB 2BDLA 1BY8A 3N4CA 2F1GA 2NQAA 4FK5A 5K16A 2H7JA 1PPDA 1PBHA 4QRGA 2YJ8A 1PPOA 5A24A 3PDFA 4YYSA 2GFOA 3DF0A 1VJVA 3AI8A 4YYVA 4X6HA 2DCBA 2FRQA 3KWZA 3F75A 1X9YA 3H89A 3I06A 1YALA 5CVOB 1F2CA 1AIMA 1DEUA 1YVBA 1S4VA 5F02A 4RY2A 5CVMA 4BSQA 4YVAA 4W4UA 1ZCMA 2DC8A 1GLOA 2DJFB 2G8JA 2C0YA 3KWBX 3OF8A 1U9QX 2AYOA 2O6XA 4PI3A 2B1MA 3H7DA 4OELA 4YYWA 4BS5A 2YJBA 4CDFB 4CZWA 1ME3A 2VHFA 2NQDB 2F7DA 2OP3A 2AYNA 4N4ZA 3N3KA 2NQIA 1EWOA 2E01A 2AUXA 2ACTA 1AU3A 2ATOA 5FPWA 3BPFA 2Y6EA 4QH6A 5JH3A 4ZUXU 1CS8A 2CIOA 2JQFR 4WA6A 1A6RA 1K3BB 3RVWA 1MEGA 3BCNA 2PADA 1AYVA 4QRXA 4CDDB 1QMYA 3ZUAA 1NPZA 1CTEA 3GCBA 5JA7A 1EWMA 2XU5A 3LFYA 2JQGR 2PNSA 2R9OA 1F2AA 2AU1A 2P7UA 1QXPA 1AU0A 2HHNA 2FT2A 3KFQA 1IWDA 3HWNA 2ARYA 3IHPA 1AYUA 2P0RA 8PCHA 3KW9A 2R9NA 1CV8A 1YK8A 3HHAA 2E00A 3P5UA 4AXMA 2R9FA 3BC3A 1NLJA 2HXZA 2FUDA 3MHHA 1NB5A 4XUIA 3K24A 3USVA 1ME4A 3BOWA 1TLOA 5EGWA 5CHVA 3D6SA 4I07A 1MDWA 1QOLA 3OISA 4OEMA 1TU6A 3B79A 3PNRA 1XKGA 4I04A 1MIRA 4DMYA 3P5VA 4MSXA 2DC9A 4KLBA 3RVVA 5CVNB 3WXFA 3V6EA 2B1NA 2Y5BA 4I05A 2HH5A 4AXLA 1AYWA 2XU1A 1ICFA 4FJCA 2AUZA 2R9MA 1Q6KA
chains in the Genus database with same CATH superfamily
1POPA 3E1ZB 1STFE 3MHSA 1U5IA 1PVJA 3HHIA 2J7QC 2PREA 1NB3A 1KFUL 1PCIA 2DCCA 3PW3A 1HUCB 1KHPA 3ERVA 4IP3A 5JZEA 5EZQA 3CBJA 3IUTA 3H6SA 4HXDB 1KFXL 2FQ9A 4PP2E 4MZOA 1THEA 4RNAA 4REZA 2FO5A 1BQIA 1PXVA 3O65A 1O0EA 3IV2A 3MTNA 4RKXA 1ATKA 1PE6A 3WXGA 2XU4A 1U9XA 2CB5A 3K8UA 4QRVA 1M6DA 3IEJA 1PIPA 1SNKA 1FH0A 4P6GA 3BY4A 3MORA 4BQVA 3MTVA 7PCKA 3W31A 4Q8GA 4P16A 2OZ2A 2DC6A 3OVXA 4N8WA 3KSEA 3F5VA 4PP1A 3WXEA 2G7YA 2YJ9A 2AVWA 1ZIVA 1JQPA 3KKUA 1Y4HA 3QT4A 1CVZA 4YYRA 4PADA 5PADA 3QSDA 2R6NA 2BDZA 2G6DA 3C0RA 3O0UA 1F29A 4GUAA 3H8BA 4XR7A 1NL6A 3KX1A 3PHXA 1YK7A 5EF4A 1QDQA 3P5WA 3U8EA 1AU2A 3O1GA 2BU3A 3RVXA 3OF9A 4OVZB 1TL9A 1KHQA 1GCBA 1CSBB 3OVZA 2AS8A 2GHUA 2NQGA 3TRKA 3B21A 1BP4A 2UZJA 2YJ2A 3BWKA 3S3QA 2P86A 1ITOA 4BOQA 1PPNA 3OQCA 3BPMA 4RF1A 3PRPA 2AIMA 4X6IA 3M99A 1EWPA 1U9VA 3HD3A 2OULA 5CHTA 1AU4A 2WBFX 3QJ3A 1YT7A 1BGOA 2DZYA 4K7CA 3LXSA 2FTDA 4N79A 3TMPA 1PPPA 2E02A 3CH2X 1EWLA 4YYQA 3IOQA 2FE8A 3K9MA 1MHWA 1NQCA 3CH3X 1GECE 9PAPA 1PADA 2R9CA 4IUMA 4YV8A 2BTWA 4MI7A 4BPVA 1CJLA 1CB5A 5E6JA 1MEMA 2DJGB 3BB7A 3W30A 2DC7A 2JTCA 4BS6A 4G54A 6PADA 2FYEA 1MS6A 1DF0A 2DCDA 1KXRA 2DCAA 5J94A 1CQDA 3P5XA 1EF7A 4DMXA 4FIPA 3TNXA 1CPJA 2E03A 2YJCA 4QBBA 2VHSA 2IBIA 3V6CA 3IMAA 2DZZA 1DKIA 2HD5A 3H8CA 4ZTBA 3S3RA 4D8EA 2DOSA 1SP4B 2PBHA 2FRAA 2G8EA 3NHEA 3N3GA 4W5CA 4Q8HA 4WURA 4MM3B 4MZSA 4PT5A 1Y08A 3PT2A 4YYUA 3I3TA 4P6EA 1VSNA 1GMYA 4CDEB 1F2BA 2XU3A 4X6JA 3PBHA 1AECA 2IPPB 3CBKA 2Z84A 3C9EA 4HWYA 4W5BA 2JRIA 1U9WA 4CDCB 2BDLA 1BY8A 3N4CA 2AGAA 2F1GA 2NQAA 4FK5A 5K16A 2H7JA 1PPDA 1PBHA 4QRGA 2YJ8A 1PPOA 5A24A 3RNVA 3PDFA 4YYSA 2GFOA 4A5UA 3BBAA 3PHUA 5KO3A 3DF0A 1VJVA 3AI8A 4YYVA 4X6HA 2DCBA 2FRQA 3KWZA 3F75A 1X9YA 3H89A 3I06A 1YALA 4D8IA 5CVOB 1F2CA 1AIMA 1DEUA 1YVBA 1S4VA 5F02A 4RY2A 5CVMA 4BSQA 4YVAA 2HWKA 4OVZA 4W4UA 1ZCMA 2DC8A 1GLOA 2DJFB 2G8JA 2C0YA 3KWBX 3OF8A 1U9QX 2AYOA 2O6XA 4PI3A 2B1MA 3H7DA 4OELA 4YYWA 4BS5A 2YJBA 4CDFB 4CZWA 1ME3A 2VHFA 2NQDB 2F7DA 2OP3A 2AYNA 4N4ZA 3N3KA 3MJ5A 2NQIA 1EWOA 2E01A 2AUXA 2ACTA 1AU3A 2ATOA 5FPWA 4D8BA 3BPFA 2Y6EA 4QH6A 5JH3A 3IFUA 1CS8A 4ZUXU 2CIOA 2JQFR 4WA6A 1A6RA 1K3BB 3PHWA 3RVWA 1MEGA 3BCNA 2PADA 1AYVA 4BOSA 4QRXA 4CDDB 1QMYA 4BOUA 4XZXA 3ZUAA 1NPZA 1CTEA 3GCBA 2J7QA 5JA7A 1EWMA 2XU5A 3LFYA 2JQGR 2PNSA 2R9OA 1F2AA 2AU1A 2P7UA 4RF0A 1QXPA 1AU0A 2HHNA 2FT2A 3KFQA 1IWDA 3HWNA 2ARYA 4R3DA 4M0WA 3IHPA 1AYUA 2P0RA 8PCHA 3KW9A 2R9NA 1CV8A 1YK8A 3HHAA 2E00A 3P5UA 4AXMA 2R9FA 3BC3A 1NLJA 2HXZA 2FUDA 3MHHA 1NB5A 4XUIA 2BTWB 3K24A 3USVA 1ME4A 3BOWA 1TLOA 5EGWA 5CHVA 3D6SA 4I07A 1MDWA 1QOLA 3OISA 3PSEA 4OEMA 1TU6A 3ZNHA 3B79A 3PRMA 3E9SA 3PNRA 1XKGA 4BOZA 4I04A 1MIRA 4BOPA 4DMYA 3P5VA 4MSXA 2DC9A 4KLBA 3RVVA 5CVNB 3WXFA 3V6EA 2B1NA 2Y5BA 4I05A 5EZSA 2HH5A 4AXLA 3MP2A 1AYWA 1YZBA 2XU1A 1ICFA 4FJCA 2AUZA 4OW0A 1UKFA 2R9MA 1Q6KA
chains in the Genus database with same CATH topology
1POPA 3E1ZB 1STFE 3MHSA 1U5IA 3HHIA 2PREA 1NB3A 1KFUL 1PCIA 2DCCA 3PW3A 1HUCB 1KHPA 3ERVA 3CBJA 3IUTA 3H6SA 1KFXL 2FQ9A 4PP2E 4MZOA 1THEA 2FO5A 1BQIA 1PXVA 1O0EA 3IV2A 3MTNA 1ATKA 1PE6A 3WXGA 2XU4A 1U9XA 2CB5A 3K8UA 2BSZA 4QRVA 1M6DA 3IEJA 1PIPA 1SNKA 1FH0A 4P6GA 4BQVA 3MORA 7PCKA 4Q8GA 2OZ2A 2DC6A 3OVXA 4N8WA 3KSEA 3F5VA 4PP1A 3WXEA 2G7YA 2YJ9A 2AVWA 1ZIVA 1JQPA 3KKUA 1Y4HA 3QT4A 3LTWA 1CVZA 4YYRA 4PADA 5PADA 3QSDA 2VFBA 2R6NA 2BDZA 2G6DA 1GX3A 3O0UA 1F29A 3H8BA 4XR7A 1NL6A 3KX1A 1YK7A 5EF4A 1QDQA 3P5WA 3U8EA 1AU2A 3O1GA 3RVXA 3OF9A 1TL9A 1KHQA 1GCBA 1CSBB 3OVZA 2AS8A 1E2TA 2GHUA 2NQGA 2VFCA 1BP4A 2YJ2A 3BWKA 3S3QA 2P86A 1ITOA 1PPNA 3BPMA 2AIMA 4X6IA 3M99A 1EWPA 1U9VA 3HD3A 2OULA 5CHTA 1AU4A 2WBFX 3QJ3A 1YT7A 1BGOA 2DZYA 4K7CA 3LXSA 2FTDA 4N79A 1PPPA 2E02A 3CH2X 1EWLA 4YYQA 3IOQA 3K9MA 1MHWA 1NQCA 3CH3X 1GECE 9PAPA 1PADA 2R9CA 4YV8A 4BPVA 1CJLA 1CB5A 1MEMA 2DJGB 2DC7A 4BS6A 4G54A 6PADA 2FYEA 1MS6A 1DF0A 2DCDA 1KXRA 2DCAA 4GUZA 5J94A 1CQDA 3P5XA 1EF7A 4DMXA 4FIPA 4B55A 3TNXA 1CPJA 2E03A 2YJCA 4QBBA 2VHSA 2IBIA 3V6CA 1W4TA 3IMAA 2DZZA 2HD5A 3H8CA 1W6FA 3S3RA 1SP4B 2PBHA 2FRAA 2G8EA 3NHEA 3N3GA 4W5CA 4Q8HA 4MZSA 1Y08A 4YYUA 3I3TA 1W5RA 4P6EA 1VSNA 1GMYA 4CDEB 1F2BA 2XU3A 4X6JA 3PBHA 1AECA 2IPPB 3CBKA 3C9EA 4HWYA 4W5BA 1U9WA 4CDCB 2BDLA 1BY8A 3N4CA 2F1GA 2NQAA 4FK5A 5K16A 2H7JA 1PPDA 1PBHA 4QRGA 2YJ8A 1PPOA 5A24A 3PDFA 4YYSA 2GFOA 3DF0A 1VJVA 3AI8A 4YYVA 4X6HA 2DCBA 2FRQA 3KWZA 3F75A 1X9YA 3H89A 3I06A 1YALA 5CVOB 1F2CA 1AIMA 1DEUA 1YVBA 1S4VA 5F02A 4RY2A 5CVMA 4BSQA 4YVAA 4W4UA 1ZCMA 2DC8A 4BGFA 1GLOA 2DJFB 2G8JA 2C0YA 3KWBX 3OF8A 1U9QX 2AYOA 2O6XA 4PI3A 2B1MA 3H7DA 4OELA 4YYWA 4BS5A 2YJBA 4CDFB 4CZWA 1ME3A 2VHFA 2NQDB 2F7DA 2OP3A 4NV8A 2AYNA 4N4ZA 3N3KA 2NQIA 1EWOA 2E01A 2AUXA 2ACTA 1AU3A 2ATOA 5FPWA 3BPFA 2Y6EA 4QH6A 5JH3A 4ZUXU 1CS8A 2CIOA 2JQFR 4WA6A 1A6RA 1K3BB 3RVWA 1MEGA 3BCNA 2PADA 1AYVA 4QRXA 4C5PA 4CDDB 1QMYA 4NV7A 3ZUAA 1NPZA 1CTEA 3GCBA 5JA7A 1EWMA 2XU5A 3LFYA 2JQGR 2PNSA 2R9OA 1F2AA 2AU1A 2P7UA 1QXPA 1AU0A 2HHNA 2FT2A 3KFQA 1IWDA 3HWNA 2ARYA 3IHPA 1AYUA 2P0RA 8PCHA 3KW9A 2R9NA 1CV8A 3D9WA 1YK8A 3HHAA 2E00A 3P5UA 4AXMA 2R9FA 3BC3A 1NLJA 2HXZA 2FUDA 3MHHA 1NB5A 4XUIA 3K24A 3USVA 1ME4A 3BOWA 1TLOA 5EGWA 5CHVA 3D6SA 4I07A 1MDWA 1QOLA 3OISA 4OEMA 1TU6A 3B79A 3PNRA 1XKGA 4I04A 1MIRA 4DMYA 3P5VA 4MSXA 2DC9A 4KLBA 3RVVA 5CVNB 3WXFA 3V6EA 2B1NA 2Y5BA 4I05A 2HH5A 4AXLA 1AYWA 2XU1A 1ICFA 4FJCA 2AUZA 2R9MA 1Q6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POP A;  3E1Z B;  1STF E;  3MHS A;  1U5I A;  3HHI A;  2PRE A;  1NB3 A;  1KFU L;  1PCI A;  2DCC A;  3PW3 A;  1HUC B;  1KHP A;  3ERV A;  3CBJ A;  3IUT A;  3H6S A;  1KFX L;  2FQ9 A;  4PP2 E;  4MZO A;  1THE A;  2FO5 A;  1BQI A;  1PXV A;  1O0E A;  3IV2 A;  3MTN A;  1ATK A;  1PE6 A;  3WXG A;  2XU4 A;  1U9X A;  2CB5 A;  3K8U A;  4QRV A;  1M6D A;  3IEJ A;  1PIP A;  1SNK A;  1FH0 A;  4P6G A;  4BQV A;  3MOR A;  7PCK A;  4Q8G A;  2OZ2 A;  2DC6 A;  3OVX A;  4N8W A;  3KSE A;  3F5V A;  4PP1 A;  3WXE A;  2G7Y A;  2YJ9 A;  2AVW A;  1ZIV A;  1JQP A;  3KKU A;  1Y4H A;  3QT4 A;  1CVZ A;  4YYR A;  4PAD A;  5PAD A;  3QSD A;  2R6N A;  2BDZ A;  2G6D A;  3O0U A;  1F29 A;  3H8B A;  4XR7 A;  1NL6 A;  3KX1 A;  1YK7 A;  5EF4 A;  1QDQ A;  3P5W A;  3U8E A;  1AU2 A;  3O1G A;  3RVX A;  3OF9 A;  1TL9 A;  1KHQ A;  1GCB A;  1CSB B;  3OVZ A;  2AS8 A;  2GHU A;  2NQG A;  1BP4 A;  2YJ2 A;  3BWK A;  3S3Q A;  2P86 A;  1ITO A;  1PPN A;  3BPM A;  2AIM A;  4X6I A;  3M99 A;  1EWP A;  1U9V A;  3HD3 A;  2OUL A;  5CHT A;  1AU4 A;  2WBF X;  3QJ3 A;  1YT7 A;  1BGO A;  2DZY A;  4K7C A;  3LXS A;  2FTD A;  4N79 A;  1PPP A;  2E02 A;  3CH2 X;  1EWL A;  4YYQ A;  3IOQ A;  3K9M A;  1MHW A;  1NQC A;  3CH3 X;  1GEC E;  9PAP A;  1PAD A;  2R9C A;  4YV8 A;  4BPV A;  1CJL A;  1CB5 A;  1MEM A;  2DJG B;  2DC7 A;  4BS6 A;  4G54 A;  6PAD A;  2FYE A;  1MS6 A;  1DF0 A;  2DCD A;  1KXR A;  2DCA A;  5J94 A;  1CQD A;  3P5X A;  1EF7 A;  4DMX A;  4FIP A;  3TNX A;  1CPJ A;  2E03 A;  2YJC A;  4QBB A;  2VHS A;  2IBI A;  3V6C A;  3IMA A;  2DZZ A;  2HD5 A;  3H8C A;  3S3R A;  1SP4 B;  2PBH A;  2FRA A;  2G8E A;  3NHE A;  3N3G A;  4W5C A;  4Q8H A;  4MZS A;  1Y08 A;  4YYU A;  3I3T A;  4P6E A;  1VSN A;  1GMY A;  4CDE B;  1F2B A;  2XU3 A;  4X6J A;  3PBH A;  1AEC A;  2IPP B;  3CBK A;  3C9E A;  4HWY A;  4W5B A;  1U9W A;  4CDC B;  2BDL A;  1BY8 A;  3N4C A;  2F1G A;  2NQA A;  4FK5 A;  5K16 A;  2H7J A;  1PPD A;  1PBH A;  4QRG A;  2YJ8 A;  1PPO A;  5A24 A;  3PDF A;  4YYS A;  2GFO A;  3DF0 A;  1VJV A;  3AI8 A;  4YYV A;  4X6H A;  2DCB A;  2FRQ A;  3KWZ A;  3F75 A;  1X9Y A;  3H89 A;  3I06 A;  1YAL A;  5CVO B;  1F2C A;  1AIM A;  1DEU A;  1YVB A;  1S4V A;  5F02 A;  4RY2 A;  5CVM A;  4BSQ A;  4YVA A;  4W4U A;  1ZCM A;  2DC8 A;  1GLO A;  2DJF B;  2G8J A;  2C0Y A;  3KWB X;  3OF8 A;  1U9Q X;  2AYO A;  2O6X A;  4PI3 A;  2B1M A;  3H7D A;  4OEL A;  4YYW A;  4BS5 A;  2YJB A;  4CDF B;  4CZW A;  1ME3 A;  2VHF A;  2NQD B;  2F7D A;  2OP3 A;  2AYN A;  4N4Z A;  3N3K A;  2NQI A;  1EWO A;  2E01 A;  2AUX A;  2ACT A;  1AU3 A;  2ATO A;  5FPW A;  3BPF A;  2Y6E A;  4QH6 A;  5JH3 A;  4ZUX U;  1CS8 A;  2CIO A;  2JQF R;  4WA6 A;  1A6R A;  1K3B B;  3RVW A;  1MEG A;  3BCN A;  2PAD A;  1AYV A;  4QRX A;  4CDD B;  1QMY A;  3ZUA A;  1NPZ A;  1CTE A;  3GCB A;  5JA7 A;  1EWM A;  2XU5 A;  3LFY A;  2JQG R;  2PNS A;  2R9O A;  1F2A A;  2AU1 A;  2P7U A;  1QXP A;  1AU0 A;  2HHN A;  2FT2 A;  3KFQ A;  1IWD A;  3HWN A;  2ARY A;  3IHP A;  1AYU A;  2P0R A;  8PCH A;  3KW9 A;  2R9N A;  1CV8 A;  1YK8 A;  3HHA A;  2E00 A;  3P5U A;  4AXM A;  2R9F A;  3BC3 A;  1NLJ A;  2HXZ A;  2FUD A;  3MHH A;  1NB5 A;  4XUI A;  3K24 A;  3USV A;  1ME4 A;  3BOW A;  1TLO A;  5EGW A;  5CHV A;  3D6S A;  4I07 A;  1MDW A;  1QOL A;  3OIS A;  4OEM A;  1TU6 A;  3B79 A;  3PNR A;  1XKG A;  4I04 A;  1MIR A;  4DMY A;  3P5V A;  4MSX A;  2DC9 A;  4KLB A;  3RVV A;  5CVN B;  3WXF A;  3V6E A;  2B1N A;  2Y5B A;  4I05 A;  2HH5 A;  4AXL A;  1AYW A;  2XU1 A;  1ICF A;  4FJC A;  2AUZ A;  2R9M A;  1Q6K A; 
#chains in the Genus database with same CATH topology
 1POP A;  3E1Z B;  1STF E;  3MHS A;  1U5I A;  1PVJ A;  3HHI A;  2J7Q C;  2PRE A;  1NB3 A;  1KFU L;  1PCI A;  2DCC A;  3PW3 A;  1HUC B;  1KHP A;  3ERV A;  4IP3 A;  5JZE A;  5EZQ A;  3CBJ A;  3IUT A;  3H6S A;  4HXD B;  1KFX L;  2FQ9 A;  4PP2 E;  4MZO A;  1THE A;  4RNA A;  4REZ A;  2FO5 A;  1BQI A;  1PXV A;  3O65 A;  1O0E A;  3IV2 A;  3MTN A;  4RKX A;  1ATK A;  1PE6 A;  3WXG A;  2XU4 A;  1U9X A;  2CB5 A;  3K8U A;  4QRV A;  1M6D A;  3IEJ A;  1PIP A;  1SNK A;  1FH0 A;  4P6G A;  3BY4 A;  3MOR A;  4BQV A;  3MTV A;  7PCK A;  3W31 A;  4Q8G A;  4P16 A;  2OZ2 A;  2DC6 A;  3OVX A;  4N8W A;  3KSE A;  3F5V A;  4PP1 A;  3WXE A;  2G7Y A;  2YJ9 A;  2AVW A;  1ZIV A;  1JQP A;  3KKU A;  1Y4H A;  3QT4 A;  1CVZ A;  4YYR A;  4PAD A;  5PAD A;  3QSD A;  2R6N A;  2BDZ A;  2G6D A;  3C0R A;  3O0U A;  1F29 A;  4GUA A;  3H8B A;  4XR7 A;  1NL6 A;  3KX1 A;  3PHX A;  1YK7 A;  5EF4 A;  1QDQ A;  3P5W A;  3U8E A;  1AU2 A;  3O1G A;  2BU3 A;  3RVX A;  3OF9 A;  4OVZ B;  1TL9 A;  1KHQ A;  1GCB A;  1CSB B;  3OVZ A;  2AS8 A;  2GHU A;  2NQG A;  3TRK A;  3B21 A;  1BP4 A;  2UZJ A;  2YJ2 A;  3BWK A;  3S3Q A;  2P86 A;  1ITO A;  4BOQ A;  1PPN A;  3OQC A;  3BPM A;  4RF1 A;  3PRP A;  2AIM A;  4X6I A;  3M99 A;  1EWP A;  1U9V A;  3HD3 A;  2OUL A;  5CHT A;  1AU4 A;  2WBF X;  3QJ3 A;  1YT7 A;  1BGO A;  2DZY A;  4K7C A;  3LXS A;  2FTD A;  4N79 A;  3TMP A;  1PPP A;  2E02 A;  3CH2 X;  1EWL A;  4YYQ A;  3IOQ A;  2FE8 A;  3K9M A;  1MHW A;  1NQC A;  3CH3 X;  1GEC E;  9PAP A;  1PAD A;  2R9C A;  4IUM A;  4YV8 A;  2BTW A;  4MI7 A;  4BPV A;  1CJL A;  1CB5 A;  5E6J A;  1MEM A;  2DJG B;  3BB7 A;  3W30 A;  2DC7 A;  2JTC A;  4BS6 A;  4G54 A;  6PAD A;  2FYE A;  1MS6 A;  1DF0 A;  2DCD A;  1KXR A;  2DCA A;  5J94 A;  1CQD A;  3P5X A;  1EF7 A;  4DMX A;  4FIP A;  3TNX A;  1CPJ A;  2E03 A;  2YJC A;  4QBB A;  2VHS A;  2IBI A;  3V6C A;  3IMA A;  2DZZ A;  1DKI A;  2HD5 A;  3H8C A;  4ZTB A;  3S3R A;  4D8E A;  2DOS A;  1SP4 B;  2PBH A;  2FRA A;  2G8E A;  3NHE A;  3N3G A;  4W5C A;  4Q8H A;  4WUR A;  4MM3 B;  4MZS A;  4PT5 A;  1Y08 A;  3PT2 A;  4YYU A;  3I3T A;  4P6E A;  1VSN A;  1GMY A;  4CDE B;  1F2B A;  2XU3 A;  4X6J A;  3PBH A;  1AEC A;  2IPP B;  3CBK A;  2Z84 A;  3C9E A;  4HWY A;  4W5B A;  2JRI A;  1U9W A;  4CDC B;  2BDL A;  1BY8 A;  3N4C A;  2AGA A;  2F1G A;  2NQA A;  4FK5 A;  5K16 A;  2H7J A;  1PPD A;  1PBH A;  4QRG A;  2YJ8 A;  1PPO A;  5A24 A;  3RNV A;  3PDF A;  4YYS A;  2GFO A;  4A5U A;  3BBA A;  3PHU A;  5KO3 A;  3DF0 A;  1VJV A;  3AI8 A;  4YYV A;  4X6H A;  2DCB A;  2FRQ A;  3KWZ A;  3F75 A;  1X9Y A;  3H89 A;  3I06 A;  1YAL A;  4D8I A;  5CVO B;  1F2C A;  1AIM A;  1DEU A;  1YVB A;  1S4V A;  5F02 A;  4RY2 A;  5CVM A;  4BSQ A;  4YVA A;  2HWK A;  4OVZ A;  4W4U A;  1ZCM A;  2DC8 A;  1GLO A;  2DJF B;  2G8J A;  2C0Y A;  3KWB X;  3OF8 A;  1U9Q X;  2AYO A;  2O6X A;  4PI3 A;  2B1M A;  3H7D A;  4OEL A;  4YYW A;  4BS5 A;  2YJB A;  4CDF B;  4CZW A;  1ME3 A;  2VHF A;  2NQD B;  2F7D A;  2OP3 A;  2AYN A;  4N4Z A;  3N3K A;  3MJ5 A;  2NQI A;  1EWO A;  2E01 A;  2AUX A;  2ACT A;  1AU3 A;  2ATO A;  5FPW A;  4D8B A;  3BPF A;  2Y6E A;  4QH6 A;  5JH3 A;  3IFU A;  1CS8 A;  4ZUX U;  2CIO A;  2JQF R;  4WA6 A;  1A6R A;  1K3B B;  3PHW A;  3RVW A;  1MEG A;  3BCN A;  2PAD A;  1AYV A;  4BOS A;  4QRX A;  4CDD B;  1QMY A;  4BOU A;  4XZX A;  3ZUA A;  1NPZ A;  1CTE A;  3GCB A;  2J7Q A;  5JA7 A;  1EWM A;  2XU5 A;  3LFY A;  2JQG R;  2PNS A;  2R9O A;  1F2A A;  2AU1 A;  2P7U A;  4RF0 A;  1QXP A;  1AU0 A;  2HHN A;  2FT2 A;  3KFQ A;  1IWD A;  3HWN A;  2ARY A;  4R3D A;  4M0W A;  3IHP A;  1AYU A;  2P0R A;  8PCH A;  3KW9 A;  2R9N A;  1CV8 A;  1YK8 A;  3HHA A;  2E00 A;  3P5U A;  4AXM A;  2R9F A;  3BC3 A;  1NLJ A;  2HXZ A;  2FUD A;  3MHH A;  1NB5 A;  4XUI A;  2BTW B;  3K24 A;  3USV A;  1ME4 A;  3BOW A;  1TLO A;  5EGW A;  5CHV A;  3D6S A;  4I07 A;  1MDW A;  1QOL A;  3OIS A;  3PSE A;  4OEM A;  1TU6 A;  3ZNH A;  3B79 A;  3PRM A;  3E9S A;  3PNR A;  1XKG A;  4BOZ A;  4I04 A;  1MIR A;  4BOP A;  4DMY A;  3P5V A;  4MSX A;  2DC9 A;  4KLB A;  3RVV A;  5CVN B;  3WXF A;  3V6E A;  2B1N A;  2Y5B A;  4I05 A;  5EZS A;  2HH5 A;  4AXL A;  3MP2 A;  1AYW A;  1YZB A;  2XU1 A;  1ICF A;  4FJC A;  2AUZ A;  4OW0 A;  1UKF A;  2R9M A;  1Q6K A; 
#chains in the Genus database with same CATH homology
 1POP A;  3E1Z B;  1STF E;  3MHS A;  1U5I A;  3HHI A;  2PRE A;  1NB3 A;  1KFU L;  1PCI A;  2DCC A;  3PW3 A;  1HUC B;  1KHP A;  3ERV A;  3CBJ A;  3IUT A;  3H6S A;  1KFX L;  2FQ9 A;  4PP2 E;  4MZO A;  1THE A;  2FO5 A;  1BQI A;  1PXV A;  1O0E A;  3IV2 A;  3MTN A;  1ATK A;  1PE6 A;  3WXG A;  2XU4 A;  1U9X A;  2CB5 A;  3K8U A;  2BSZ A;  4QRV A;  1M6D A;  3IEJ A;  1PIP A;  1SNK A;  1FH0 A;  4P6G A;  4BQV A;  3MOR A;  7PCK A;  4Q8G A;  2OZ2 A;  2DC6 A;  3OVX A;  4N8W A;  3KSE A;  3F5V A;  4PP1 A;  3WXE A;  2G7Y A;  2YJ9 A;  2AVW A;  1ZIV A;  1JQP A;  3KKU A;  1Y4H A;  3QT4 A;  3LTW A;  1CVZ A;  4YYR A;  4PAD A;  5PAD A;  3QSD A;  2VFB A;  2R6N A;  2BDZ A;  2G6D A;  1GX3 A;  3O0U A;  1F29 A;  3H8B A;  4XR7 A;  1NL6 A;  3KX1 A;  1YK7 A;  5EF4 A;  1QDQ A;  3P5W A;  3U8E A;  1AU2 A;  3O1G A;  3RVX A;  3OF9 A;  1TL9 A;  1KHQ A;  1GCB A;  1CSB B;  3OVZ A;  2AS8 A;  1E2T A;  2GHU A;  2NQG A;  2VFC A;  1BP4 A;  2YJ2 A;  3BWK A;  3S3Q A;  2P86 A;  1ITO A;  1PPN A;  3BPM A;  2AIM A;  4X6I A;  3M99 A;  1EWP A;  1U9V A;  3HD3 A;  2OUL A;  5CHT A;  1AU4 A;  2WBF X;  3QJ3 A;  1YT7 A;  1BGO A;  2DZY A;  4K7C A;  3LXS A;  2FTD A;  4N79 A;  1PPP A;  2E02 A;  3CH2 X;  1EWL A;  4YYQ A;  3IOQ A;  3K9M A;  1MHW A;  1NQC A;  3CH3 X;  1GEC E;  9PAP A;  1PAD A;  2R9C A;  4YV8 A;  4BPV A;  1CJL A;  1CB5 A;  1MEM A;  2DJG B;  2DC7 A;  4BS6 A;  4G54 A;  6PAD A;  2FYE A;  1MS6 A;  1DF0 A;  2DCD A;  1KXR A;  2DCA A;  4GUZ A;  5J94 A;  1CQD A;  3P5X A;  1EF7 A;  4DMX A;  4FIP A;  4B55 A;  3TNX A;  1CPJ A;  2E03 A;  2YJC A;  4QBB A;  2VHS A;  2IBI A;  3V6C A;  1W4T A;  3IMA A;  2DZZ A;  2HD5 A;  3H8C A;  1W6F A;  3S3R A;  1SP4 B;  2PBH A;  2FRA A;  2G8E A;  3NHE A;  3N3G A;  4W5C A;  4Q8H A;  4MZS A;  1Y08 A;  4YYU A;  3I3T A;  1W5R A;  4P6E A;  1VSN A;  1GMY A;  4CDE B;  1F2B A;  2XU3 A;  4X6J A;  3PBH A;  1AEC A;  2IPP B;  3CBK A;  3C9E A;  4HWY A;  4W5B A;  1U9W A;  4CDC B;  2BDL A;  1BY8 A;  3N4C A;  2F1G A;  2NQA A;  4FK5 A;  5K16 A;  2H7J A;  1PPD A;  1PBH A;  4QRG A;  2YJ8 A;  1PPO A;  5A24 A;  3PDF A;  4YYS A;  2GFO A;  3DF0 A;  1VJV A;  3AI8 A;  4YYV A;  4X6H A;  2DCB A;  2FRQ A;  3KWZ A;  3F75 A;  1X9Y A;  3H89 A;  3I06 A;  1YAL A;  5CVO B;  1F2C A;  1AIM A;  1DEU A;  1YVB A;  1S4V A;  5F02 A;  4RY2 A;  5CVM A;  4BSQ A;  4YVA A;  4W4U A;  1ZCM A;  2DC8 A;  4BGF A;  1GLO A;  2DJF B;  2G8J A;  2C0Y A;  3KWB X;  3OF8 A;  1U9Q X;  2AYO A;  2O6X A;  4PI3 A;  2B1M A;  3H7D A;  4OEL A;  4YYW A;  4BS5 A;  2YJB A;  4CDF B;  4CZW A;  1ME3 A;  2VHF A;  2NQD B;  2F7D A;  2OP3 A;  4NV8 A;  2AYN A;  4N4Z A;  3N3K A;  2NQI A;  1EWO A;  2E01 A;  2AUX A;  2ACT A;  1AU3 A;  2ATO A;  5FPW A;  3BPF A;  2Y6E A;  4QH6 A;  5JH3 A;  4ZUX U;  1CS8 A;  2CIO A;  2JQF R;  4WA6 A;  1A6R A;  1K3B B;  3RVW A;  1MEG A;  3BCN A;  2PAD A;  1AYV A;  4QRX A;  4C5P A;  4CDD B;  1QMY A;  4NV7 A;  3ZUA A;  1NPZ A;  1CTE A;  3GCB A;  5JA7 A;  1EWM A;  2XU5 A;  3LFY A;  2JQG R;  2PNS A;  2R9O A;  1F2A A;  2AU1 A;  2P7U A;  1QXP A;  1AU0 A;  2HHN A;  2FT2 A;  3KFQ A;  1IWD A;  3HWN A;  2ARY A;  3IHP A;  1AYU A;  2P0R A;  8PCH A;  3KW9 A;  2R9N A;  1CV8 A;  3D9W A;  1YK8 A;  3HHA A;  2E00 A;  3P5U A;  4AXM A;  2R9F A;  3BC3 A;  1NLJ A;  2HXZ A;  2FUD A;  3MHH A;  1NB5 A;  4XUI A;  3K24 A;  3USV A;  1ME4 A;  3BOW A;  1TLO A;  5EGW A;  5CHV A;  3D6S A;  4I07 A;  1MDW A;  1QOL A;  3OIS A;  4OEM A;  1TU6 A;  3B79 A;  3PNR A;  1XKG A;  4I04 A;  1MIR A;  4DMY A;  3P5V A;  4MSX A;  2DC9 A;  4KLB A;  3RVV A;  5CVN B;  3WXF A;  3V6E A;  2B1N A;  2Y5B A;  4I05 A;  2HH5 A;  4AXL A;  1AYW A;  2XU1 A;  1ICF A;  4FJC A;  2AUZ A;  2R9M A;  1Q6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...