3O1GA

Cathepsin k covalently bound to a 2-cyano pyrimidine inhibitor with a benzyl p3 group.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
molecule tags Hydrolase
source organism Homo sapiens
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o1gA00
1PIPA 2PREA 1IWDA 1CVZA 2G6DA 1AU2A 4BSQA 4MZOA 1CSBB 1MS6A 1PXVA 2AYNA 5CHTA 3RVVA 1F29A 3KWZA 1YK8A 1AU0A 4BQVA 1CB5A 1KHQA 1NQCA 3O1GA 3PNRA 2NQAA 3OISA 1KHPA 3HHIA 4CDDB 2E03A 2AS8A 3USVA 1GLOA 1POPA 2ATOA 2B1MA 4YYVA 5CVOB 2HXZA 4YVAA 1X9YA 4WA6A 4AXMA 4N4ZA 4CDFB 1EWLA 2P0RA 2FQ9A 1F2CA 3RVXA 3CH2X 3QT4A 3DF0A 2OULA 3MHSA 2Y5BA 2BDZA 2XU4A 1NPZA 3TNXA 1QOLA 1ZCMA 1K3BB 1EWOA 3RVWA 3C9EA 1EWMA 4YYRA 4MZSA 3PW3A 1VSNA 3QSDA 3LFYA 2FRAA 3MTNA 1CS8A 2HH5A 1ME4A 2XU1A 3H7DA 2FTDA 1U5IA 1QDQA 3E1ZB 3H89A 1YVBA 2AIMA 2G8JA 3KWBX 5A24A 4FJCA 4DMXA 2ACTA 1YK7A 1BQIA 1PE6A 2VHSA 2YJ9A 3WXEA 2XU3A 1EWPA 3IV2A 2YJCA 4W5CA 2O6XA 4PP2E 1PBHA 1TU6A 1ITOA 3H6SA 4XR7A 1AU4A 4PADA 2DC7A 1CJLA 7PCKA 3F5VA 1PPNA 1F2BA 3HWNA 2P7UA 4CZWA 4PI3A 2CB5A 2DCAA 4FK5A 1STFE 2DCCA 3GCBA 1XKGA 3KW9A 1THEA 4DMYA 3P5WA 2YJ8A 4QBBA 1DEUA 3V6CA 1PPDA 3KSEA 2NQDB 2DZYA 4XUIA 2C0YA 3BPMA 1AYWA 5CHVA 1CPJA 1NLJA 3KFQA 4RY2A 2DCBA 2DZZA 4N8WA 1Q6KA 1MIRA 4P6GA 3H8BA 4MSXA 3S3RA 2XU5A 1AYUA 1SNKA 4BPVA 2HHNA 4K7CA 9PAPA 2R9FA 1JQPA 2FUDA 5FPWA 3ZUAA 4I05A 5EGWA 4ZUXU 4CDEB 1NB3A 3N3KA 1YALA 1U9WA 1SP4B 3F75A 1AYVA 2FO5A 2VHFA 2P86A 1M6DA 3P5VA 4QRXA 1Y4HA 1PADA 2AYOA 4W5BA 2DCDA 1BP4A 5JA7A 2PBHA 1U9XA 5CVMA 2F1GA 4AXLA 1CV8A 3IHPA 2GFOA 2IBIA 2R9CA 2AUXA 3CBJA 2B1NA 2R9NA 2OP3A 2OZ2A 2WBFX 4QRVA 1KFUL 3BPFA 4YYQA 4I04A 2DC9A 4OEMA 3MHHA 2HD5A 4I07A 1PPPA 3I3TA 3OF8A 1ATKA 2ARYA 5CVNB 3BWKA 1YT7A 3IUTA 3I06A 2AU1A 1HUCB 2JQGR 3K8UA 2AUZA 2YJBA 4QRGA 2BDLA 3M99A 2H7JA 3N3GA 4BS6A 1ICFA 4HWYA 2DC8A 3WXFA 3IOQA 5K16A 2AVWA 1MEMA 3CBKA 2JQFR 3CH3X 4X6IA 2G7YA 2CIOA 2IPPB 4G54A 1DF0A 2FRQA 5J94A 2GHUA 2YJ2A 1MHWA 3B79A 1QXPA 1KFXL 3H8CA 2E01A 8PCHA 1ZIVA 5F02A 3OVZA 1TLOA 1QMYA 3P5UA 3OVXA 2NQGA 4W4UA 5JH3A 1NL6A 3O0UA 1F2AA 1U9VA 2F7DA 1VJVA 3N4CA 3AI8A 1GCBA 5PADA 3LXSA 4YYSA 6PADA 2R9OA 4YYUA 4KLBA 4FIPA 3K9MA 3HHAA 1O0EA 1S4VA 4Q8GA 3S3QA 1NB5A 2R9MA 1Y08A 2G8EA 3BCNA 2DJGB 5EF4A 4YYWA 2NQIA 2PADA 3WXGA 1MEGA 3K24A 2FT2A 3OF9A 3U8EA 1MDWA 3D6SA 1U9QX 2FYEA 4YV8A 3P5XA 1EF7A 4OELA 4PP1A 3IMAA 4BS5A 1AECA 1ME3A 2E02A 1TL9A 1BY8A 1PPOA 3PDFA 3BOWA 1CQDA 2R6NA 3NHEA 1GMYA 2DC6A 1AU3A 3PBHA 3BC3A 2Y6EA 1A6RA 1BGOA 3KKUA 4X6HA 4CDCB 1AIMA 4P6EA 3MORA 1PCIA 1CTEA 4Q8HA 3HD3A 4QH6A 3ERVA 3KX1A 1GECE 1KXRA 3QJ3A 3IEJA 4N79A 2PNSA 4X6JA 2E00A 1FH0A 3V6EA 2DJFB
chains in the Genus database with same CATH superfamily
1PIPA 2PREA 1IWDA 1CVZA 2G6DA 1AU2A 4BSQA 4MZOA 1CSBB 3RNVA 1MS6A 1PXVA 2AYNA 5CHTA 3RVVA 1F29A 3KWZA 1YK8A 2J7QA 2BTWA 1AU0A 5EZQA 4BQVA 1CB5A 1KHQA 1NQCA 3MJ5A 3O1GA 3PNRA 2NQAA 3OISA 1KHPA 3HHIA 4CDDB 2E03A 2AS8A 3USVA 1GLOA 4REZA 1POPA 2ATOA 2B1MA 4YYVA 5CVOB 2HXZA 4YVAA 1X9YA 4WA6A 4AXMA 4N4ZA 4CDFB 3W30A 1EWLA 2P0RA 2FQ9A 1F2CA 3CH2X 3QT4A 3RVXA 3DF0A 2OULA 5KO3A 3MHSA 4M0WA 2Y5BA 2BDZA 2XU4A 1PVJA 1NPZA 3TNXA 1QOLA 1ZCMA 1K3BB 4R3DA 1EWOA 4GUAA 3RVWA 3C9EA 1EWMA 4YYRA 2J7QC 4MZSA 3PW3A 1VSNA 3QSDA 3LFYA 2FRAA 3MTNA 1CS8A 2HH5A 1ME4A 2XU1A 3PHUA 3H7DA 2FE8A 2FTDA 1U5IA 1QDQA 3E1ZB 3PRMA 3H89A 1YVBA 2AIMA 2G8JA 3KWBX 5A24A 4FJCA 4DMXA 2ACTA 1YK7A 1BQIA 1PE6A 2VHSA 2YJ9A 3WXEA 4BOQA 4XZXA 2XU3A 1EWPA 3IV2A 2YJCA 4W5CA 2O6XA 4PP2E 3PHXA 1PBHA 1TU6A 1ITOA 3H6SA 4XR7A 1AU4A 4PADA 2DC7A 1CJLA 7PCKA 3F5VA 1PPNA 1F2BA 3HWNA 2P7UA 3IFUA 4CZWA 3MTVA 4PI3A 2CB5A 2DCAA 4FK5A 1STFE 2DCCA 3GCBA 3W31A 4A5UA 1XKGA 3KW9A 1THEA 4DMYA 3P5WA 2YJ8A 4QBBA 1DEUA 2JTCA 3V6CA 1PPDA 3KSEA 2NQDB 2DZYA 4XUIA 2C0YA 3BPMA 3OQCA 1AYWA 5CHVA 1CPJA 1NLJA 4OVZB 4RF1A 3KFQA 5JZEA 4RY2A 2DCBA 2DZZA 4N8WA 1Q6KA 3BY4A 1MIRA 4P6GA 1UKFA 3H8BA 4MSXA 3S3RA 2XU5A 1DKIA 4RKXA 1AYUA 1SNKA 4BPVA 2HHNA 4K7CA 9PAPA 2R9FA 1JQPA 2FUDA 5FPWA 3ZUAA 4D8IA 4I05A 1YZBA 5EGWA 4ZUXU 4CDEB 1NB3A 3N3KA 1YALA 3TRKA 1U9WA 1SP4B 3F75A 1AYVA 2FO5A 2VHFA 4IP3A 2P86A 1M6DA 3P5VA 4QRXA 1Y4HA 1PADA 2AYOA 4W5BA 2DCDA 1BP4A 5JA7A 2PBHA 1U9XA 5CVMA 2F1GA 4AXLA 1CV8A 3IHPA 2GFOA 2IBIA 2R9CA 2AUXA 3BBAA 3CBJA 3PT2A 2B1NA 2R9NA 2OP3A 3MP2A 2OZ2A 2WBFX 4QRVA 1KFUL 3BPFA 4ZTBA 4YYQA 4I04A 2DC9A 4OVZA 4OEMA 3MHHA 4HXDB 2HD5A 4I07A 1PPPA 4BOZA 3I3TA 3OF8A 1ATKA 3PRPA 2ARYA 5CVNB 3BWKA 1YT7A 3IUTA 3I06A 2AU1A 1HUCB 2JQGR 3PSEA 3K8UA 2BTWB 4D8BA 2AUZA 2YJBA 4QRGA 2BDLA 3M99A 2H7JA 3N3GA 4BS6A 4PT5A 2AGAA 1ICFA 4HWYA 2DC8A 3WXFA 3IOQA 5K16A 4D8EA 2AVWA 1MEMA 3CBKA 5EZSA 2JQFR 3CH3X 4IUMA 4X6IA 2G7YA 2CIOA 2UZJA 2IPPB 4G54A 1DF0A 2FRQA 5J94A 2JRIA 2GHUA 2YJ2A 1MHWA 3B79A 1QXPA 4RF0A 1KFXL 3H8CA 2E01A 8PCHA 3C0RA 1ZIVA 5F02A 3OVZA 1TLOA 1QMYA 4BOPA 4MI7A 3P5UA 3OVXA 4BOUA 2NQGA 4W4UA 5JH3A 5E6JA 1NL6A 3O0UA 1F2AA 1U9VA 2F7DA 1VJVA 3N4CA 3AI8A 1GCBA 5PADA 2DOSA 3LXSA 4YYSA 6PADA 2R9OA 4YYUA 4KLBA 4OW0A 4FIPA 3K9MA 3HHAA 1O0EA 1S4VA 2HWKA 4Q8GA 3S3QA 1NB5A 2R9MA 1Y08A 2G8EA 3BCNA 2DJGB 5EF4A 4YYWA 2NQIA 2PADA 3ZNHA 4WURA 1MEGA 3K24A 3WXGA 4BOSA 2FT2A 2Z84A 3OF9A 3U8EA 1MDWA 3D6SA 1U9QX 2FYEA 4YV8A 3P5XA 1EF7A 4OELA 4PP1A 3O65A 3IMAA 4BS5A 1AECA 1ME3A 2E02A 1TL9A 1BY8A 1PPOA 3PDFA 3BOWA 4P16A 1CQDA 2R6NA 3NHEA 3PHWA 1GMYA 2DC6A 3E9SA 1AU3A 4MM3B 3PBHA 3BC3A 2Y6EA 1A6RA 3B21A 2BU3A 1BGOA 3KKUA 4X6HA 4CDCB 1AIMA 4P6EA 3MORA 1PCIA 1CTEA 4Q8HA 3TMPA 3HD3A 4QH6A 3ERVA 3KX1A 3BB7A 1GECE 4RNAA 1KXRA 3QJ3A 3IEJA 4N79A 2PNSA 4X6JA 2E00A 1FH0A 3V6EA 2DJFB
chains in the Genus database with same CATH topology
1PIPA 2PREA 1IWDA 1CVZA 2G6DA 1AU2A 4BSQA 4MZOA 1CSBB 1MS6A 1PXVA 2AYNA 5CHTA 3RVVA 1F29A 3KWZA 1YK8A 1AU0A 4BQVA 1CB5A 1KHQA 1NQCA 3O1GA 3PNRA 2NQAA 3OISA 1KHPA 3HHIA 4CDDB 2E03A 2AS8A 3USVA 1GLOA 1E2TA 1POPA 2ATOA 2B1MA 4YYVA 5CVOB 2HXZA 4YVAA 1X9YA 4WA6A 4AXMA 4N4ZA 4CDFB 1EWLA 2P0RA 2FQ9A 1F2CA 3CH2X 3QT4A 3RVXA 3DF0A 2OULA 3MHSA 2Y5BA 2BDZA 2XU4A 1NPZA 3TNXA 1QOLA 1ZCMA 1K3BB 1EWOA 3RVWA 3C9EA 1EWMA 4YYRA 4MZSA 3PW3A 1VSNA 3QSDA 3LFYA 2FRAA 3MTNA 1CS8A 2HH5A 1ME4A 2XU1A 3H7DA 2FTDA 1U5IA 1QDQA 3E1ZB 3H89A 1YVBA 2AIMA 2G8JA 3KWBX 5A24A 4FJCA 4DMXA 2ACTA 1YK7A 1BQIA 1PE6A 2VHSA 2YJ9A 3WXEA 2XU3A 1EWPA 3IV2A 2YJCA 4W5CA 2O6XA 4PP2E 1PBHA 1TU6A 1ITOA 3H6SA 4XR7A 1AU4A 4PADA 2DC7A 1CJLA 7PCKA 3F5VA 1PPNA 1F2BA 3HWNA 2P7UA 4CZWA 4PI3A 2CB5A 2DCAA 4FK5A 1STFE 2DCCA 3GCBA 1XKGA 3KW9A 1THEA 4DMYA 3P5WA 2YJ8A 4QBBA 1DEUA 3V6CA 1PPDA 1W4TA 3KSEA 2NQDB 2DZYA 4XUIA 2C0YA 3BPMA 1AYWA 5CHVA 1CPJA 1NLJA 3KFQA 4RY2A 3LTWA 2DCBA 2DZZA 4N8WA 1Q6KA 1MIRA 4P6GA 3H8BA 4MSXA 3S3RA 4BGFA 2XU5A 1AYUA 1SNKA 4BPVA 2HHNA 4K7CA 9PAPA 2R9FA 1JQPA 2FUDA 5FPWA 3ZUAA 4I05A 5EGWA 4ZUXU 4CDEB 1NB3A 2VFBA 3N3KA 1YALA 1U9WA 1SP4B 3F75A 1AYVA 2FO5A 2VHFA 2P86A 1M6DA 3P5VA 4QRXA 1Y4HA 1PADA 2AYOA 4W5BA 2DCDA 1BP4A 5JA7A 2PBHA 1U9XA 5CVMA 2F1GA 4AXLA 1CV8A 3IHPA 2GFOA 2IBIA 2R9CA 2AUXA 3CBJA 2B1NA 2R9NA 2OP3A 2OZ2A 2WBFX 4QRVA 1KFUL 3BPFA 4YYQA 4I04A 2DC9A 4OEMA 3MHHA 2HD5A 4I07A 1PPPA 3I3TA 3OF8A 1ATKA 2ARYA 5CVNB 3BWKA 1YT7A 3IUTA 3I06A 2AU1A 1HUCB 2JQGR 3K8UA 3D9WA 2AUZA 2YJBA 4QRGA 2BDLA 3M99A 2H7JA 3N3GA 4BS6A 1ICFA 4HWYA 2DC8A 3WXFA 2BSZA 3IOQA 5K16A 2AVWA 1MEMA 3CBKA 1W6FA 2JQFR 3CH3X 4X6IA 2G7YA 2CIOA 2IPPB 4G54A 4B55A 1DF0A 2FRQA 5J94A 2GHUA 2YJ2A 1MHWA 4NV7A 3B79A 1QXPA 1KFXL 3H8CA 2E01A 8PCHA 1ZIVA 1W5RA 5F02A 3OVZA 1TLOA 1QMYA 3P5UA 3OVXA 2NQGA 4W4UA 5JH3A 1NL6A 3O0UA 1F2AA 1U9VA 2F7DA 1VJVA 3N4CA 3AI8A 1GCBA 5PADA 3LXSA 4YYSA 6PADA 1GX3A 2R9OA 4YYUA 4KLBA 4FIPA 3K9MA 3HHAA 1O0EA 1S4VA 4Q8GA 3S3QA 1NB5A 2R9MA 1Y08A 2G8EA 3BCNA 4NV8A 2DJGB 5EF4A 4YYWA 2NQIA 2PADA 3WXGA 1MEGA 3K24A 2FT2A 3OF9A 3U8EA 1MDWA 3D6SA 4C5PA 1U9QX 2FYEA 4GUZA 3P5XA 1EF7A 4YV8A 4OELA 4PP1A 3IMAA 4BS5A 1AECA 1ME3A 2E02A 1TL9A 1BY8A 1PPOA 3PDFA 3BOWA 1CQDA 2R6NA 3NHEA 1GMYA 2DC6A 1AU3A 3PBHA 3BC3A 2Y6EA 1A6RA 1BGOA 3KKUA 4X6HA 4CDCB 1AIMA 4P6EA 3MORA 1PCIA 1CTEA 2VFCA 4Q8HA 3HD3A 4QH6A 3ERVA 3KX1A 1GECE 1KXRA 3QJ3A 3IEJA 4N79A 2PNSA 4X6JA 2E00A 1FH0A 3V6EA 2DJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIP A;  2PRE A;  1IWD A;  1CVZ A;  2G6D A;  1AU2 A;  4BSQ A;  4MZO A;  1CSB B;  1MS6 A;  1PXV A;  2AYN A;  5CHT A;  3RVV A;  1F29 A;  3KWZ A;  1YK8 A;  1AU0 A;  4BQV A;  1CB5 A;  1KHQ A;  1NQC A;  3O1G A;  3PNR A;  2NQA A;  3OIS A;  1KHP A;  3HHI A;  4CDD B;  2E03 A;  2AS8 A;  3USV A;  1GLO A;  1POP A;  2ATO A;  2B1M A;  4YYV A;  5CVO B;  2HXZ A;  4YVA A;  1X9Y A;  4WA6 A;  4AXM A;  4N4Z A;  4CDF B;  1EWL A;  2P0R A;  2FQ9 A;  1F2C A;  3RVX A;  3CH2 X;  3QT4 A;  3DF0 A;  2OUL A;  3MHS A;  2Y5B A;  2BDZ A;  2XU4 A;  1NPZ A;  3TNX A;  1QOL A;  1ZCM A;  1K3B B;  1EWO A;  3RVW A;  3C9E A;  1EWM A;  4YYR A;  4MZS A;  3PW3 A;  1VSN A;  3QSD A;  3LFY A;  2FRA A;  3MTN A;  1CS8 A;  2HH5 A;  1ME4 A;  2XU1 A;  3H7D A;  2FTD A;  1U5I A;  1QDQ A;  3E1Z B;  3H89 A;  1YVB A;  2AIM A;  2G8J A;  3KWB X;  5A24 A;  4FJC A;  4DMX A;  2ACT A;  1YK7 A;  1BQI A;  1PE6 A;  2VHS A;  2YJ9 A;  3WXE A;  2XU3 A;  1EWP A;  3IV2 A;  2YJC A;  4W5C A;  2O6X A;  4PP2 E;  1PBH A;  1TU6 A;  1ITO A;  3H6S A;  4XR7 A;  1AU4 A;  4PAD A;  2DC7 A;  1CJL A;  7PCK A;  3F5V A;  1PPN A;  1F2B A;  3HWN A;  2P7U A;  4CZW A;  4PI3 A;  2CB5 A;  2DCA A;  4FK5 A;  1STF E;  2DCC A;  3GCB A;  1XKG A;  3KW9 A;  1THE A;  4DMY A;  3P5W A;  2YJ8 A;  4QBB A;  1DEU A;  3V6C A;  1PPD A;  3KSE A;  2NQD B;  2DZY A;  4XUI A;  2C0Y A;  3BPM A;  1AYW A;  5CHV A;  1CPJ A;  1NLJ A;  3KFQ A;  4RY2 A;  2DCB A;  2DZZ A;  4N8W A;  1Q6K A;  1MIR A;  4P6G A;  3H8B A;  4MSX A;  3S3R A;  2XU5 A;  1AYU A;  1SNK A;  4BPV A;  2HHN A;  4K7C A;  9PAP A;  2R9F A;  1JQP A;  2FUD A;  5FPW A;  3ZUA A;  4I05 A;  5EGW A;  4ZUX U;  4CDE B;  1NB3 A;  3N3K A;  1YAL A;  1U9W A;  1SP4 B;  3F75 A;  1AYV A;  2FO5 A;  2VHF A;  2P86 A;  1M6D A;  3P5V A;  4QRX A;  1Y4H A;  1PAD A;  2AYO A;  4W5B A;  2DCD A;  1BP4 A;  5JA7 A;  2PBH A;  1U9X A;  5CVM A;  2F1G A;  4AXL A;  1CV8 A;  3IHP A;  2GFO A;  2IBI A;  2R9C A;  2AUX A;  3CBJ A;  2B1N A;  2R9N A;  2OP3 A;  2OZ2 A;  2WBF X;  4QRV A;  1KFU L;  3BPF A;  4YYQ A;  4I04 A;  2DC9 A;  4OEM A;  3MHH A;  2HD5 A;  4I07 A;  1PPP A;  3I3T A;  3OF8 A;  1ATK A;  2ARY A;  5CVN B;  3BWK A;  1YT7 A;  3IUT A;  3I06 A;  2AU1 A;  1HUC B;  2JQG R;  3K8U A;  2AUZ A;  2YJB A;  4QRG A;  2BDL A;  3M99 A;  2H7J A;  3N3G A;  4BS6 A;  1ICF A;  4HWY A;  2DC8 A;  3WXF A;  3IOQ A;  5K16 A;  2AVW A;  1MEM A;  3CBK A;  2JQF R;  3CH3 X;  4X6I A;  2G7Y A;  2CIO A;  2IPP B;  4G54 A;  1DF0 A;  2FRQ A;  5J94 A;  2GHU A;  2YJ2 A;  1MHW A;  3B79 A;  1QXP A;  1KFX L;  3H8C A;  2E01 A;  8PCH A;  1ZIV A;  5F02 A;  3OVZ A;  1TLO A;  1QMY A;  3P5U A;  3OVX A;  2NQG A;  4W4U A;  5JH3 A;  1NL6 A;  3O0U A;  1F2A A;  1U9V A;  2F7D A;  1VJV A;  3N4C A;  3AI8 A;  1GCB A;  5PAD A;  3LXS A;  4YYS A;  6PAD A;  2R9O A;  4YYU A;  4KLB A;  4FIP A;  3K9M A;  3HHA A;  1O0E A;  1S4V A;  4Q8G A;  3S3Q A;  1NB5 A;  2R9M A;  1Y08 A;  2G8E A;  3BCN A;  2DJG B;  5EF4 A;  4YYW A;  2NQI A;  2PAD A;  3WXG A;  1MEG A;  3K24 A;  2FT2 A;  3OF9 A;  3U8E A;  1MDW A;  3D6S A;  1U9Q X;  2FYE A;  4YV8 A;  3P5X A;  1EF7 A;  4OEL A;  4PP1 A;  3IMA A;  4BS5 A;  1AEC A;  1ME3 A;  2E02 A;  1TL9 A;  1BY8 A;  1PPO A;  3PDF A;  3BOW A;  1CQD A;  2R6N A;  3NHE A;  1GMY A;  2DC6 A;  1AU3 A;  3PBH A;  3BC3 A;  2Y6E A;  1A6R A;  1BGO A;  3KKU A;  4X6H A;  4CDC B;  1AIM A;  4P6E A;  3MOR A;  1PCI A;  1CTE A;  4Q8H A;  3HD3 A;  4QH6 A;  3ERV A;  3KX1 A;  1GEC E;  1KXR A;  3QJ3 A;  3IEJ A;  4N79 A;  2PNS A;  4X6J A;  2E00 A;  1FH0 A;  3V6E A;  2DJF B; 
#chains in the Genus database with same CATH topology
 1PIP A;  2PRE A;  1IWD A;  1CVZ A;  2G6D A;  1AU2 A;  4BSQ A;  4MZO A;  1CSB B;  3RNV A;  1MS6 A;  1PXV A;  2AYN A;  5CHT A;  3RVV A;  1F29 A;  3KWZ A;  1YK8 A;  2J7Q A;  2BTW A;  1AU0 A;  5EZQ A;  4BQV A;  1CB5 A;  1KHQ A;  1NQC A;  3MJ5 A;  3O1G A;  3PNR A;  2NQA A;  3OIS A;  1KHP A;  3HHI A;  4CDD B;  2E03 A;  2AS8 A;  3USV A;  1GLO A;  4REZ A;  1POP A;  2ATO A;  2B1M A;  4YYV A;  5CVO B;  2HXZ A;  4YVA A;  1X9Y A;  4WA6 A;  4AXM A;  4N4Z A;  4CDF B;  3W30 A;  1EWL A;  2P0R A;  2FQ9 A;  1F2C A;  3CH2 X;  3QT4 A;  3RVX A;  3DF0 A;  2OUL A;  5KO3 A;  3MHS A;  4M0W A;  2Y5B A;  2BDZ A;  2XU4 A;  1PVJ A;  1NPZ A;  3TNX A;  1QOL A;  1ZCM A;  1K3B B;  4R3D A;  1EWO A;  4GUA A;  3RVW A;  3C9E A;  1EWM A;  4YYR A;  2J7Q C;  4MZS A;  3PW3 A;  1VSN A;  3QSD A;  3LFY A;  2FRA A;  3MTN A;  1CS8 A;  2HH5 A;  1ME4 A;  2XU1 A;  3PHU A;  3H7D A;  2FE8 A;  2FTD A;  1U5I A;  1QDQ A;  3E1Z B;  3PRM A;  3H89 A;  1YVB A;  2AIM A;  2G8J A;  3KWB X;  5A24 A;  4FJC A;  4DMX A;  2ACT A;  1YK7 A;  1BQI A;  1PE6 A;  2VHS A;  2YJ9 A;  3WXE A;  4BOQ A;  4XZX A;  2XU3 A;  1EWP A;  3IV2 A;  2YJC A;  4W5C A;  2O6X A;  4PP2 E;  3PHX A;  1PBH A;  1TU6 A;  1ITO A;  3H6S A;  4XR7 A;  1AU4 A;  4PAD A;  2DC7 A;  1CJL A;  7PCK A;  3F5V A;  1PPN A;  1F2B A;  3HWN A;  2P7U A;  3IFU A;  4CZW A;  3MTV A;  4PI3 A;  2CB5 A;  2DCA A;  4FK5 A;  1STF E;  2DCC A;  3GCB A;  3W31 A;  4A5U A;  1XKG A;  3KW9 A;  1THE A;  4DMY A;  3P5W A;  2YJ8 A;  4QBB A;  1DEU A;  2JTC A;  3V6C A;  1PPD A;  3KSE A;  2NQD B;  2DZY A;  4XUI A;  2C0Y A;  3BPM A;  3OQC A;  1AYW A;  5CHV A;  1CPJ A;  1NLJ A;  4OVZ B;  4RF1 A;  3KFQ A;  5JZE A;  4RY2 A;  2DCB A;  2DZZ A;  4N8W A;  1Q6K A;  3BY4 A;  1MIR A;  4P6G A;  1UKF A;  3H8B A;  4MSX A;  3S3R A;  2XU5 A;  1DKI A;  4RKX A;  1AYU A;  1SNK A;  4BPV A;  2HHN A;  4K7C A;  9PAP A;  2R9F A;  1JQP A;  2FUD A;  5FPW A;  3ZUA A;  4D8I A;  4I05 A;  1YZB A;  5EGW A;  4ZUX U;  4CDE B;  1NB3 A;  3N3K A;  1YAL A;  3TRK A;  1U9W A;  1SP4 B;  3F75 A;  1AYV A;  2FO5 A;  2VHF A;  4IP3 A;  2P86 A;  1M6D A;  3P5V A;  4QRX A;  1Y4H A;  1PAD A;  2AYO A;  4W5B A;  2DCD A;  1BP4 A;  5JA7 A;  2PBH A;  1U9X A;  5CVM A;  2F1G A;  4AXL A;  1CV8 A;  3IHP A;  2GFO A;  2IBI A;  2R9C A;  2AUX A;  3BBA A;  3CBJ A;  3PT2 A;  2B1N A;  2R9N A;  2OP3 A;  3MP2 A;  2OZ2 A;  2WBF X;  4QRV A;  1KFU L;  3BPF A;  4ZTB A;  4YYQ A;  4I04 A;  2DC9 A;  4OVZ A;  4OEM A;  3MHH A;  4HXD B;  2HD5 A;  4I07 A;  1PPP A;  4BOZ A;  3I3T A;  3OF8 A;  1ATK A;  3PRP A;  2ARY A;  5CVN B;  3BWK A;  1YT7 A;  3IUT A;  3I06 A;  2AU1 A;  1HUC B;  2JQG R;  3PSE A;  3K8U A;  2BTW B;  4D8B A;  2AUZ A;  2YJB A;  4QRG A;  2BDL A;  3M99 A;  2H7J A;  3N3G A;  4BS6 A;  4PT5 A;  2AGA A;  1ICF A;  4HWY A;  2DC8 A;  3WXF A;  3IOQ A;  5K16 A;  4D8E A;  2AVW A;  1MEM A;  3CBK A;  5EZS A;  2JQF R;  3CH3 X;  4IUM A;  4X6I A;  2G7Y A;  2CIO A;  2UZJ A;  2IPP B;  4G54 A;  1DF0 A;  2FRQ A;  5J94 A;  2JRI A;  2GHU A;  2YJ2 A;  1MHW A;  3B79 A;  1QXP A;  4RF0 A;  1KFX L;  3H8C A;  2E01 A;  8PCH A;  3C0R A;  1ZIV A;  5F02 A;  3OVZ A;  1TLO A;  1QMY A;  4BOP A;  4MI7 A;  3P5U A;  3OVX A;  4BOU A;  2NQG A;  4W4U A;  5JH3 A;  5E6J A;  1NL6 A;  3O0U A;  1F2A A;  1U9V A;  2F7D A;  1VJV A;  3N4C A;  3AI8 A;  1GCB A;  5PAD A;  2DOS A;  3LXS A;  4YYS A;  6PAD A;  2R9O A;  4YYU A;  4KLB A;  4OW0 A;  4FIP A;  3K9M A;  3HHA A;  1O0E A;  1S4V A;  2HWK A;  4Q8G A;  3S3Q A;  1NB5 A;  2R9M A;  1Y08 A;  2G8E A;  3BCN A;  2DJG B;  5EF4 A;  4YYW A;  2NQI A;  2PAD A;  3ZNH A;  4WUR A;  1MEG A;  3K24 A;  3WXG A;  4BOS A;  2FT2 A;  2Z84 A;  3OF9 A;  3U8E A;  1MDW A;  3D6S A;  1U9Q X;  2FYE A;  4YV8 A;  3P5X A;  1EF7 A;  4OEL A;  4PP1 A;  3O65 A;  3IMA A;  4BS5 A;  1AEC A;  1ME3 A;  2E02 A;  1TL9 A;  1BY8 A;  1PPO A;  3PDF A;  3BOW A;  4P16 A;  1CQD A;  2R6N A;  3NHE A;  3PHW A;  1GMY A;  2DC6 A;  3E9S A;  1AU3 A;  4MM3 B;  3PBH A;  3BC3 A;  2Y6E A;  1A6R A;  3B21 A;  2BU3 A;  1BGO A;  3KKU A;  4X6H A;  4CDC B;  1AIM A;  4P6E A;  3MOR A;  1PCI A;  1CTE A;  4Q8H A;  3TMP A;  3HD3 A;  4QH6 A;  3ERV A;  3KX1 A;  3BB7 A;  1GEC E;  4RNA A;  1KXR A;  3QJ3 A;  3IEJ A;  4N79 A;  2PNS A;  4X6J A;  2E00 A;  1FH0 A;  3V6E A;  2DJF B; 
#chains in the Genus database with same CATH homology
 1PIP A;  2PRE A;  1IWD A;  1CVZ A;  2G6D A;  1AU2 A;  4BSQ A;  4MZO A;  1CSB B;  1MS6 A;  1PXV A;  2AYN A;  5CHT A;  3RVV A;  1F29 A;  3KWZ A;  1YK8 A;  1AU0 A;  4BQV A;  1CB5 A;  1KHQ A;  1NQC A;  3O1G A;  3PNR A;  2NQA A;  3OIS A;  1KHP A;  3HHI A;  4CDD B;  2E03 A;  2AS8 A;  3USV A;  1GLO A;  1E2T A;  1POP A;  2ATO A;  2B1M A;  4YYV A;  5CVO B;  2HXZ A;  4YVA A;  1X9Y A;  4WA6 A;  4AXM A;  4N4Z A;  4CDF B;  1EWL A;  2P0R A;  2FQ9 A;  1F2C A;  3CH2 X;  3QT4 A;  3RVX A;  3DF0 A;  2OUL A;  3MHS A;  2Y5B A;  2BDZ A;  2XU4 A;  1NPZ A;  3TNX A;  1QOL A;  1ZCM A;  1K3B B;  1EWO A;  3RVW A;  3C9E A;  1EWM A;  4YYR A;  4MZS A;  3PW3 A;  1VSN A;  3QSD A;  3LFY A;  2FRA A;  3MTN A;  1CS8 A;  2HH5 A;  1ME4 A;  2XU1 A;  3H7D A;  2FTD A;  1U5I A;  1QDQ A;  3E1Z B;  3H89 A;  1YVB A;  2AIM A;  2G8J A;  3KWB X;  5A24 A;  4FJC A;  4DMX A;  2ACT A;  1YK7 A;  1BQI A;  1PE6 A;  2VHS A;  2YJ9 A;  3WXE A;  2XU3 A;  1EWP A;  3IV2 A;  2YJC A;  4W5C A;  2O6X A;  4PP2 E;  1PBH A;  1TU6 A;  1ITO A;  3H6S A;  4XR7 A;  1AU4 A;  4PAD A;  2DC7 A;  1CJL A;  7PCK A;  3F5V A;  1PPN A;  1F2B A;  3HWN A;  2P7U A;  4CZW A;  4PI3 A;  2CB5 A;  2DCA A;  4FK5 A;  1STF E;  2DCC A;  3GCB A;  1XKG A;  3KW9 A;  1THE A;  4DMY A;  3P5W A;  2YJ8 A;  4QBB A;  1DEU A;  3V6C A;  1PPD A;  1W4T A;  3KSE A;  2NQD B;  2DZY A;  4XUI A;  2C0Y A;  3BPM A;  1AYW A;  5CHV A;  1CPJ A;  1NLJ A;  3KFQ A;  4RY2 A;  3LTW A;  2DCB A;  2DZZ A;  4N8W A;  1Q6K A;  1MIR A;  4P6G A;  3H8B A;  4MSX A;  3S3R A;  4BGF A;  2XU5 A;  1AYU A;  1SNK A;  4BPV A;  2HHN A;  4K7C A;  9PAP A;  2R9F A;  1JQP A;  2FUD A;  5FPW A;  3ZUA A;  4I05 A;  5EGW A;  4ZUX U;  4CDE B;  1NB3 A;  2VFB A;  3N3K A;  1YAL A;  1U9W A;  1SP4 B;  3F75 A;  1AYV A;  2FO5 A;  2VHF A;  2P86 A;  1M6D A;  3P5V A;  4QRX A;  1Y4H A;  1PAD A;  2AYO A;  4W5B A;  2DCD A;  1BP4 A;  5JA7 A;  2PBH A;  1U9X A;  5CVM A;  2F1G A;  4AXL A;  1CV8 A;  3IHP A;  2GFO A;  2IBI A;  2R9C A;  2AUX A;  3CBJ A;  2B1N A;  2R9N A;  2OP3 A;  2OZ2 A;  2WBF X;  4QRV A;  1KFU L;  3BPF A;  4YYQ A;  4I04 A;  2DC9 A;  4OEM A;  3MHH A;  2HD5 A;  4I07 A;  1PPP A;  3I3T A;  3OF8 A;  1ATK A;  2ARY A;  5CVN B;  3BWK A;  1YT7 A;  3IUT A;  3I06 A;  2AU1 A;  1HUC B;  2JQG R;  3K8U A;  3D9W A;  2AUZ A;  2YJB A;  4QRG A;  2BDL A;  3M99 A;  2H7J A;  3N3G A;  4BS6 A;  1ICF A;  4HWY A;  2DC8 A;  3WXF A;  2BSZ A;  3IOQ A;  5K16 A;  2AVW A;  1MEM A;  3CBK A;  1W6F A;  2JQF R;  3CH3 X;  4X6I A;  2G7Y A;  2CIO A;  2IPP B;  4G54 A;  4B55 A;  1DF0 A;  2FRQ A;  5J94 A;  2GHU A;  2YJ2 A;  1MHW A;  4NV7 A;  3B79 A;  1QXP A;  1KFX L;  3H8C A;  2E01 A;  8PCH A;  1ZIV A;  1W5R A;  5F02 A;  3OVZ A;  1TLO A;  1QMY A;  3P5U A;  3OVX A;  2NQG A;  4W4U A;  5JH3 A;  1NL6 A;  3O0U A;  1F2A A;  1U9V A;  2F7D A;  1VJV A;  3N4C A;  3AI8 A;  1GCB A;  5PAD A;  3LXS A;  4YYS A;  6PAD A;  1GX3 A;  2R9O A;  4YYU A;  4KLB A;  4FIP A;  3K9M A;  3HHA A;  1O0E A;  1S4V A;  4Q8G A;  3S3Q A;  1NB5 A;  2R9M A;  1Y08 A;  2G8E A;  3BCN A;  4NV8 A;  2DJG B;  5EF4 A;  4YYW A;  2NQI A;  2PAD A;  3WXG A;  1MEG A;  3K24 A;  2FT2 A;  3OF9 A;  3U8E A;  1MDW A;  3D6S A;  4C5P A;  1U9Q X;  2FYE A;  4GUZ A;  3P5X A;  1EF7 A;  4YV8 A;  4OEL A;  4PP1 A;  3IMA A;  4BS5 A;  1AEC A;  1ME3 A;  2E02 A;  1TL9 A;  1BY8 A;  1PPO A;  3PDF A;  3BOW A;  1CQD A;  2R6N A;  3NHE A;  1GMY A;  2DC6 A;  1AU3 A;  3PBH A;  3BC3 A;  2Y6E A;  1A6R A;  1BGO A;  3KKU A;  4X6H A;  4CDC B;  1AIM A;  4P6E A;  3MOR A;  1PCI A;  1CTE A;  2VFC A;  4Q8H A;  3HD3 A;  4QH6 A;  3ERV A;  3KX1 A;  1GEC E;  1KXR A;  3QJ3 A;  3IEJ A;  4N79 A;  2PNS A;  4X6J A;  2E00 A;  1FH0 A;  3V6E A;  2DJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...