3O1GA

Cathepsin k covalently bound to a 2-cyano pyrimidine inhibitor with a benzyl p3 group.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o1gA00
4OELA 4W4UA 3V6CA 3H89A 1U5IA 3M99A 2XU4A 2FRAA 1YALA 6PADA 5J94A 1VSNA 3IV2A 1F2AA 2R6NA 1CSBB 2C0YA 1YK7A 4YVAA 2DZZA 2YJCA 3K9MA 1QDQA 3U8EA 1AU4A 5FPWA 2E00A 3QSDA 2YJ2A 3CH3X 2G8JA 1PE6A 2R9CA 3GCBA 3OISA 2DC8A 8PCHA 4X6JA 2R9OA 3HD3A 2NQAA 3I06A 2FTDA 1QXPA 1KFUL 3NHEA 3PW3A 3F5VA 4Q8GA 4FIPA 2AYNA 5EF4A 1CB5A 1YK8A 1MIRA 3P5VA 4PP2E 4FK5A 1VJVA 3WXGA 1TU6A 2E02A 3PBHA 4ZUXU 1AU2A 1SNKA 3S3QA 3H8BA 5JA7A 4PI3A 3E1ZB 1THEA 2PBHA 3PNRA 2PNSA 1PPNA 2H7JA 2AU1A 3OVZA 5CVOB 2FUDA 3CBJA 1CV8A 2ATOA 1PIPA 5A24A 3B79A 2OZ2A 5PADA 1AYWA 4BS6A 2ACTA 4I05A 2DJFB 3N4CA 1ATKA 2P0RA 2CIOA 3C9EA 3H6SA 3HWNA 3BPMA 1X9YA 2IBIA 3N3KA 4QRVA 4W5BA 3MHHA 4YYSA 2FYEA 4P6EA 5EGWA 3WXEA 4P6GA 4N79A 2VHFA 3S3RA 1STFE 4YYQA 1MDWA 4YYWA 1CJLA 1NB3A 4I04A 1KFXL 2OULA 1O0EA 2G8EA 2P86A 2AS8A 3V6EA 4G54A 1GMYA 1FH0A 3K8UA 2NQDB 2B1NA 1AECA 3KKUA 4QRGA 1ME3A 1M6DA 1YT7A 1PPPA 2WBFX 2FQ9A 3KWZA 1KHQA 1Y4HA 2JQFR 2R9MA 4AXMA 1NLJA 1PPDA 4XUIA 3USVA 1NL6A 1U9WA 2FO5A 4CDCB 3MHSA 3LFYA 3QT4A 1BQIA 1BY8A 3KW9A 3D6SA 2AYOA 3RVXA 1XKGA 3P5UA 4K7CA 1MHWA 2F1GA 2IPPB 1GLOA 2ARYA 1MEGA 1HUCB 1PXVA 2DJGB 2DC7A 3IMAA 3P5XA 4YYUA 2XU5A 3HHAA 2DZYA 4X6IA 1U9VA 2YJ8A 4MSXA 2E01A 4X6HA 1IWDA 2E03A 3TNXA 3BOWA 1TL9A 1EWPA 3KWBX 4BQVA 3ZUAA 4DMYA 4QRXA 1QMYA 3OVXA 2O6XA 3LXSA 4WA6A 1KHPA 4RY2A 1MS6A 1YVBA 1CTEA 2BDZA 2NQIA 1POPA 1CQDA 4BSQA 3IOQA 1U9XA 4YYVA 4PP1A 2NQGA 4CDDB 1EWMA 2DCDA 1ICFA 1PCIA 1NB5A 1ZCMA 3I3TA 2JQGR 1A6RA 2VHSA 2HD5A 1PPOA 7PCKA 1S4VA 3RVVA 5JH3A 1EWOA 2CB5A 3O1GA 1JQPA 1K3BB 4CDFB 3BWKA 1CPJA 1CS8A 3N3GA 1KXRA 2DC9A 2F7DA 1AIMA 2R9FA 1ME4A 1DF0A 1AYUA 1MEMA 1Q6KA 1BGOA 1ZIVA 2HHNA 3CH2X 3CBKA 3AI8A 1GECE 1F2CA 5F02A 3PDFA 2Y5BA 4QH6A 2G6DA 2PREA 1Y08A 2G7YA 1NPZA 3WXFA 4YYRA 1DEUA 2XU3A 2DCAA 1AYVA 4Q8HA 4N8WA 3BCNA 1BP4A 4FJCA 3F75A 3KFQA 3P5WA 2BDLA 2YJ9A 2PADA 3KX1A 1QOLA 4CZWA 3DF0A 2OP3A 1PADA 2FRQA 1F2BA 2HXZA 2R9NA 1ITOA 3OF9A 2GFOA 1AU3A 2HH5A 4HWYA 9PAPA 1CVZA 3KSEA 5CHVA 2AVWA 2AUXA 4QBBA 3MORA 5K16A 3BC3A 4YV8A 2DCCA 3QJ3A 4MZSA 4BPVA 2DCBA 3IUTA 4W5CA 3BPFA 4OEMA 3H8CA 3O0UA 1NQCA 5CVNB 1AU0A 1GCBA 2GHUA 1SP4B 3IEJA 3RVWA 2AIMA 1F29A 3OF8A 1U9QX 2Y6EA 3H7DA 2DC6A 2AUZA 1EWLA 1TLOA 4PADA 1EF7A 2P7UA 4KLBA 4MZOA 3K24A 4AXLA 1PBHA 3MTNA 4XR7A 3ERVA 5CVMA 5CHTA 3IHPA 2YJBA 2B1MA 4CDEB 4BS5A 2XU1A 4N4ZA 4DMXA 3HHIA 4I07A 2FT2A
chains in the Genus database with same CATH superfamily
4OELA 4W4UA 3V6CA 3H89A 4RNAA 3W30A 3MJ5A 1U5IA 3M99A 2XU4A 2FRAA 3PT2A 1YALA 6PADA 5J94A 1VSNA 3IV2A 1F2AA 2R6NA 4WURA 3W31A 1CSBB 2C0YA 1YK7A 4YVAA 2DZZA 2YJCA 3K9MA 1QDQA 3U8EA 1AU4A 5FPWA 2E00A 3QSDA 2HWKA 2YJ2A 3CH3X 2J7QA 2G8JA 3ZNHA 1PE6A 2R9CA 4BOQA 2AGAA 3GCBA 3OISA 2DC8A 8PCHA 4X6JA 2R9OA 3HD3A 2NQAA 3I06A 4BOSA 2FTDA 1QXPA 1KFUL 3NHEA 3PW3A 3F5VA 4Q8GA 4FIPA 1YZBA 2AYNA 5EF4A 1CB5A 1YK8A 1MIRA 3P5VA 4PP2E 4FK5A 1VJVA 3WXGA 1TU6A 2E02A 4GUAA 3PBHA 4ZUXU 1AU2A 1SNKA 3S3QA 3H8BA 5JA7A 4PI3A 4REZA 3E1ZB 4D8EA 1THEA 2PBHA 3PNRA 2PNSA 1PPNA 2H7JA 2AU1A 3OVZA 4MI7A 5CVOB 2FUDA 2BU3A 2JTCA 3CBJA 1CV8A 2ATOA 1PIPA 5A24A 3B79A 2OZ2A 5PADA 1AYWA 4BS6A 2ACTA 4I05A 2DJFB 3N4CA 1ATKA 2P0RA 2CIOA 3C9EA 3H6SA 3HWNA 3BPMA 1X9YA 2IBIA 3N3KA 4QRVA 5JZEA 3BB7A 4W5BA 3PSEA 3MHHA 4YYSA 2FYEA 4P6EA 5EGWA 3WXEA 4P6GA 4N79A 2VHFA 2Z84A 3S3RA 5EZQA 1STFE 4YYQA 1MDWA 4YYWA 1CJLA 1NB3A 3PHWA 4I04A 1KFXL 2OULA 1O0EA 2G8EA 3BBAA 2P86A 3B21A 2AS8A 3V6EA 4G54A 1GMYA 1FH0A 3K8UA 2NQDB 4RF1A 2B1NA 1AECA 3KKUA 4QRGA 1ME3A 1M6DA 1YT7A 1PPPA 2WBFX 2FQ9A 3KWZA 1KHQA 1Y4HA 2JQFR 2R9MA 4BOUA 4AXMA 3PHUA 1NLJA 1PPDA 4XUIA 4OW0A 3USVA 1NL6A 1U9WA 2JRIA 2FO5A 4CDCB 3PRMA 3MHSA 3LFYA 3QT4A 1BQIA 1BY8A 3KW9A 3D6SA 2AYOA 3RVXA 1XKGA 3P5UA 4K7CA 1MHWA 2F1GA 2IPPB 1GLOA 2ARYA 1MEGA 1HUCB 1PXVA 2DJGB 2DC7A 3IMAA 3P5XA 4YYUA 2XU5A 4BOPA 3HHAA 2DZYA 3RNVA 4X6IA 4R3DA 1U9VA 2YJ8A 4XZXA 4MSXA 2E01A 4X6HA 1IWDA 2E03A 3TNXA 5E6JA 3BOWA 1TL9A 1EWPA 3KWBX 4BQVA 3ZUAA 2FE8A 4DMYA 4QRXA 2BTWA 1QMYA 3OVXA 2O6XA 3LXSA 4OVZB 4WA6A 1KHPA 4RY2A 1MS6A 1YVBA 1CTEA 3PRPA 4HXDB 2BDZA 2NQIA 1POPA 1CQDA 4M0WA 4BSQA 3IOQA 1U9XA 1DKIA 4A5UA 4YYVA 4PP1A 2NQGA 4CDDB 1EWMA 2DCDA 1ICFA 1PCIA 3MP2A 1NB5A 1ZCMA 3I3TA 2JQGR 1A6RA 2VHSA 2DOSA 2HD5A 1PPOA 7PCKA 1S4VA 3RVVA 5JH3A 1EWOA 2CB5A 3O1GA 1JQPA 1K3BB 4CDFB 3BWKA 4PT5A 1CPJA 3PHXA 3C0RA 1CS8A 3N3GA 1KXRA 2DC9A 2F7DA 4RF0A 1AIMA 2R9FA 1ME4A 1DF0A 1AYUA 1MEMA 1Q6KA 1BGOA 1ZIVA 2HHNA 3CH2X 3CBKA 3AI8A 1GECE 3TRKA 1F2CA 5F02A 3PDFA 2Y5BA 4QH6A 2G6DA 2PREA 1Y08A 2G7YA 1NPZA 3WXFA 4YYRA 1DEUA 2XU3A 2DCAA 1AYVA 4Q8HA 4N8WA 3BCNA 3IFUA 1BP4A 4FJCA 3F75A 3KFQA 3P5WA 2BDLA 2YJ9A 2PADA 3KX1A 1QOLA 4CZWA 3DF0A 2OP3A 1PADA 2FRQA 1F2BA 2HXZA 2J7QC 3BY4A 4IP3A 2R9NA 1ITOA 3OF9A 3O65A 2GFOA 2BTWB 4D8BA 1AU3A 4OVZA 2HH5A 4HWYA 9PAPA 1PVJA 1CVZA 3KSEA 5CHVA 2AVWA 2AUXA 4QBBA 3MORA 5K16A 3BC3A 4YV8A 2DCCA 3QJ3A 4MZSA 3OQCA 4BPVA 2DCBA 4RKXA 3IUTA 4W5CA 3BPFA 4OEMA 3H8CA 4D8IA 3O0UA 1NQCA 5CVNB 1AU0A 1GCBA 2GHUA 1SP4B 3IEJA 3RVWA 2AIMA 3TMPA 2UZJA 1F29A 3E9SA 3OF8A 1U9QX 2Y6EA 3H7DA 2DC6A 4P16A 4MM3B 2AUZA 1EWLA 1TLOA 4PADA 1EF7A 2P7UA 4KLBA 4MZOA 3K24A 4AXLA 1PBHA 3MTNA 4XR7A 3ERVA 5CVMA 5CHTA 4ZTBA 3IHPA 4IUMA 4BOZA 2YJBA 1UKFA 2B1MA 4CDEB 4BS5A 2XU1A 5EZSA 4N4ZA 4DMXA 3MTVA 3HHIA 4I07A 2FT2A 5KO3A
chains in the Genus database with same CATH topology
4OELA 4W4UA 3V6CA 3H89A 1U5IA 3M99A 2XU4A 2FRAA 1YALA 6PADA 5J94A 1VSNA 3IV2A 1F2AA 2R6NA 1CSBB 2C0YA 1YK7A 4YVAA 2DZZA 2YJCA 3K9MA 1QDQA 3U8EA 1AU4A 5FPWA 2E00A 3QSDA 1W5RA 2YJ2A 3CH3X 2G8JA 1PE6A 2R9CA 3GCBA 3OISA 1GX3A 2DC8A 8PCHA 4X6JA 2R9OA 3HD3A 2NQAA 3I06A 2BSZA 1QXPA 2FTDA 1KFUL 3NHEA 3PW3A 3F5VA 4Q8GA 4FIPA 2AYNA 5EF4A 1CB5A 1YK8A 1MIRA 3P5VA 4PP2E 4FK5A 1VJVA 3WXGA 1TU6A 2E02A 3PBHA 4ZUXU 1AU2A 1SNKA 3S3QA 3H8BA 5JA7A 4PI3A 3E1ZB 1THEA 2PBHA 3PNRA 2PNSA 1PPNA 2H7JA 2AU1A 3OVZA 5CVOB 2FUDA 3CBJA 1CV8A 2ATOA 1PIPA 5A24A 3B79A 2OZ2A 5PADA 1AYWA 4BS6A 2ACTA 4I05A 2DJFB 3N4CA 1ATKA 2P0RA 2CIOA 3C9EA 3H6SA 3HWNA 3BPMA 1X9YA 2IBIA 3N3KA 4QRVA 4W5BA 3MHHA 4YYSA 2FYEA 4P6EA 5EGWA 3WXEA 4P6GA 4N79A 2VHFA 3S3RA 1STFE 4YYQA 1MDWA 4YYWA 1CJLA 1NB3A 4I04A 1KFXL 2OULA 1O0EA 2G8EA 2P86A 3D9WA 2AS8A 3V6EA 4G54A 1GMYA 1FH0A 4NV8A 3K8UA 2NQDB 2B1NA 1AECA 3KKUA 4GUZA 4QRGA 1ME3A 1M6DA 1YT7A 1PPPA 2WBFX 2FQ9A 3KWZA 1KHQA 1Y4HA 1E2TA 2JQFR 2R9MA 4AXMA 1NLJA 1PPDA 4XUIA 3USVA 1NL6A 1U9WA 2FO5A 4CDCB 1W6FA 3MHSA 3LFYA 3QT4A 1BQIA 1BY8A 3KW9A 3D6SA 2AYOA 3RVXA 1XKGA 3P5UA 4K7CA 1MHWA 2F1GA 2IPPB 1GLOA 2ARYA 1MEGA 1HUCB 1PXVA 2DJGB 2DC7A 3IMAA 3P5XA 4YYUA 2XU5A 3HHAA 4C5PA 2DZYA 4X6IA 1U9VA 2YJ8A 2VFBA 4MSXA 2E01A 4X6HA 1IWDA 2E03A 3TNXA 3BOWA 1TL9A 1EWPA 3KWBX 4BQVA 3ZUAA 4DMYA 4QRXA 1QMYA 3OVXA 2O6XA 3LXSA 4WA6A 1KHPA 4RY2A 1MS6A 1YVBA 1CTEA 2BDZA 2NQIA 2VFCA 1POPA 1CQDA 4BGFA 4BSQA 3IOQA 1U9XA 4YYVA 4PP1A 2NQGA 4CDDB 1EWMA 2DCDA 1ICFA 1PCIA 1NB5A 1ZCMA 3I3TA 2JQGR 1A6RA 2VHSA 2HD5A 1PPOA 7PCKA 1S4VA 3RVVA 5JH3A 1EWOA 2CB5A 3O1GA 1JQPA 1K3BB 4CDFB 3BWKA 1CPJA 1CS8A 3N3GA 1KXRA 2DC9A 2F7DA 1AIMA 2R9FA 1ME4A 1DF0A 1AYUA 1MEMA 1Q6KA 1BGOA 1ZIVA 2HHNA 3CH2X 3CBKA 3AI8A 1GECE 1F2CA 5F02A 3PDFA 2Y5BA 4QH6A 2G6DA 2PREA 1Y08A 2G7YA 1NPZA 3WXFA 4YYRA 1DEUA 2XU3A 2DCAA 1AYVA 4Q8HA 4N8WA 3BCNA 1BP4A 4FJCA 3F75A 3KFQA 3P5WA 2BDLA 4NV7A 2YJ9A 2PADA 3KX1A 1QOLA 4CZWA 3DF0A 3LTWA 1W4TA 2OP3A 1PADA 2FRQA 1F2BA 2HXZA 2R9NA 1ITOA 3OF9A 2GFOA 1AU3A 2HH5A 4HWYA 9PAPA 1CVZA 3KSEA 5CHVA 2AVWA 2AUXA 4QBBA 3MORA 5K16A 3BC3A 4YV8A 2DCCA 3QJ3A 4MZSA 4BPVA 2DCBA 3IUTA 4W5CA 3BPFA 4OEMA 3H8CA 3O0UA 1NQCA 5CVNB 1AU0A 1GCBA 2GHUA 1SP4B 3IEJA 3RVWA 2AIMA 1F29A 4B55A 3OF8A 1U9QX 2Y6EA 3H7DA 2DC6A 2AUZA 1EWLA 1TLOA 4PADA 1EF7A 2P7UA 4KLBA 4MZOA 3K24A 4AXLA 1PBHA 3MTNA 4XR7A 3ERVA 5CVMA 5CHTA 3IHPA 2YJBA 2B1MA 4CDEB 4BS5A 2XU1A 4N4ZA 4DMXA 3HHIA 4I07A 2FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEL A;  4W4U A;  3V6C A;  3H89 A;  1U5I A;  3M99 A;  2XU4 A;  2FRA A;  1YAL A;  6PAD A;  5J94 A;  1VSN A;  3IV2 A;  1F2A A;  2R6N A;  1CSB B;  2C0Y A;  1YK7 A;  4YVA A;  2DZZ A;  2YJC A;  3K9M A;  1QDQ A;  3U8E A;  1AU4 A;  5FPW A;  2E00 A;  3QSD A;  2YJ2 A;  3CH3 X;  2G8J A;  1PE6 A;  2R9C A;  3GCB A;  3OIS A;  2DC8 A;  8PCH A;  4X6J A;  2R9O A;  3HD3 A;  2NQA A;  3I06 A;  2FTD A;  1QXP A;  1KFU L;  3NHE A;  3PW3 A;  3F5V A;  4Q8G A;  4FIP A;  2AYN A;  5EF4 A;  1CB5 A;  1YK8 A;  1MIR A;  3P5V A;  4PP2 E;  4FK5 A;  1VJV A;  3WXG A;  1TU6 A;  2E02 A;  3PBH A;  4ZUX U;  1AU2 A;  1SNK A;  3S3Q A;  3H8B A;  5JA7 A;  4PI3 A;  3E1Z B;  1THE A;  2PBH A;  3PNR A;  2PNS A;  1PPN A;  2H7J A;  2AU1 A;  3OVZ A;  5CVO B;  2FUD A;  3CBJ A;  1CV8 A;  2ATO A;  1PIP A;  5A24 A;  3B79 A;  2OZ2 A;  5PAD A;  1AYW A;  4BS6 A;  2ACT A;  4I05 A;  2DJF B;  3N4C A;  1ATK A;  2P0R A;  2CIO A;  3C9E A;  3H6S A;  3HWN A;  3BPM A;  1X9Y A;  2IBI A;  3N3K A;  4QRV A;  4W5B A;  3MHH A;  4YYS A;  2FYE A;  4P6E A;  5EGW A;  3WXE A;  4P6G A;  4N79 A;  2VHF A;  3S3R A;  1STF E;  4YYQ A;  1MDW A;  4YYW A;  1CJL A;  1NB3 A;  4I04 A;  1KFX L;  2OUL A;  1O0E A;  2G8E A;  2P86 A;  2AS8 A;  3V6E A;  4G54 A;  1GMY A;  1FH0 A;  3K8U A;  2NQD B;  2B1N A;  1AEC A;  3KKU A;  4QRG A;  1ME3 A;  1M6D A;  1YT7 A;  1PPP A;  2WBF X;  2FQ9 A;  3KWZ A;  1KHQ A;  1Y4H A;  2JQF R;  2R9M A;  4AXM A;  1NLJ A;  1PPD A;  4XUI A;  3USV A;  1NL6 A;  1U9W A;  2FO5 A;  4CDC B;  3MHS A;  3LFY A;  3QT4 A;  1BQI A;  1BY8 A;  3KW9 A;  3D6S A;  2AYO A;  3RVX A;  1XKG A;  3P5U A;  4K7C A;  1MHW A;  2F1G A;  2IPP B;  1GLO A;  2ARY A;  1MEG A;  1HUC B;  1PXV A;  2DJG B;  2DC7 A;  3IMA A;  3P5X A;  4YYU A;  2XU5 A;  3HHA A;  2DZY A;  4X6I A;  1U9V A;  2YJ8 A;  4MSX A;  2E01 A;  4X6H A;  1IWD A;  2E03 A;  3TNX A;  3BOW A;  1TL9 A;  1EWP A;  3KWB X;  4BQV A;  3ZUA A;  4DMY A;  4QRX A;  1QMY A;  3OVX A;  2O6X A;  3LXS A;  4WA6 A;  1KHP A;  4RY2 A;  1MS6 A;  1YVB A;  1CTE A;  2BDZ A;  2NQI A;  1POP A;  1CQD A;  4BSQ A;  3IOQ A;  1U9X A;  4YYV A;  4PP1 A;  2NQG A;  4CDD B;  1EWM A;  2DCD A;  1ICF A;  1PCI A;  1NB5 A;  1ZCM A;  3I3T A;  2JQG R;  1A6R A;  2VHS A;  2HD5 A;  1PPO A;  7PCK A;  1S4V A;  3RVV A;  5JH3 A;  1EWO A;  2CB5 A;  3O1G A;  1JQP A;  1K3B B;  4CDF B;  3BWK A;  1CPJ A;  1CS8 A;  3N3G A;  1KXR A;  2DC9 A;  2F7D A;  1AIM A;  2R9F A;  1ME4 A;  1DF0 A;  1AYU A;  1MEM A;  1Q6K A;  1BGO A;  1ZIV A;  2HHN A;  3CH2 X;  3CBK A;  3AI8 A;  1GEC E;  1F2C A;  5F02 A;  3PDF A;  2Y5B A;  4QH6 A;  2G6D A;  2PRE A;  1Y08 A;  2G7Y A;  1NPZ A;  3WXF A;  4YYR A;  1DEU A;  2XU3 A;  2DCA A;  1AYV A;  4Q8H A;  4N8W A;  3BCN A;  1BP4 A;  4FJC A;  3F75 A;  3KFQ A;  3P5W A;  2BDL A;  2YJ9 A;  2PAD A;  3KX1 A;  1QOL A;  4CZW A;  3DF0 A;  2OP3 A;  1PAD A;  2FRQ A;  1F2B A;  2HXZ A;  2R9N A;  1ITO A;  3OF9 A;  2GFO A;  1AU3 A;  2HH5 A;  4HWY A;  9PAP A;  1CVZ A;  3KSE A;  5CHV A;  2AVW A;  2AUX A;  4QBB A;  3MOR A;  5K16 A;  3BC3 A;  4YV8 A;  2DCC A;  3QJ3 A;  4MZS A;  4BPV A;  2DCB A;  3IUT A;  4W5C A;  3BPF A;  4OEM A;  3H8C A;  3O0U A;  1NQC A;  5CVN B;  1AU0 A;  1GCB A;  2GHU A;  1SP4 B;  3IEJ A;  3RVW A;  2AIM A;  1F29 A;  3OF8 A;  1U9Q X;  2Y6E A;  3H7D A;  2DC6 A;  2AUZ A;  1EWL A;  1TLO A;  4PAD A;  1EF7 A;  2P7U A;  4KLB A;  4MZO A;  3K24 A;  4AXL A;  1PBH A;  3MTN A;  4XR7 A;  3ERV A;  5CVM A;  5CHT A;  3IHP A;  2YJB A;  2B1M A;  4CDE B;  4BS5 A;  2XU1 A;  4N4Z A;  4DMX A;  3HHI A;  4I07 A;  2FT2 A; 
#chains in the Genus database with same CATH topology
 4OEL A;  4W4U A;  3V6C A;  3H89 A;  4RNA A;  3W30 A;  3MJ5 A;  1U5I A;  3M99 A;  2XU4 A;  2FRA A;  3PT2 A;  1YAL A;  6PAD A;  5J94 A;  1VSN A;  3IV2 A;  1F2A A;  2R6N A;  4WUR A;  3W31 A;  1CSB B;  2C0Y A;  1YK7 A;  4YVA A;  2DZZ A;  2YJC A;  3K9M A;  1QDQ A;  3U8E A;  1AU4 A;  5FPW A;  2E00 A;  3QSD A;  2HWK A;  2YJ2 A;  3CH3 X;  2J7Q A;  2G8J A;  3ZNH A;  1PE6 A;  2R9C A;  4BOQ A;  2AGA A;  3GCB A;  3OIS A;  2DC8 A;  8PCH A;  4X6J A;  2R9O A;  3HD3 A;  2NQA A;  3I06 A;  4BOS A;  2FTD A;  1QXP A;  1KFU L;  3NHE A;  3PW3 A;  3F5V A;  4Q8G A;  4FIP A;  1YZB A;  2AYN A;  5EF4 A;  1CB5 A;  1YK8 A;  1MIR A;  3P5V A;  4PP2 E;  4FK5 A;  1VJV A;  3WXG A;  1TU6 A;  2E02 A;  4GUA A;  3PBH A;  4ZUX U;  1AU2 A;  1SNK A;  3S3Q A;  3H8B A;  5JA7 A;  4PI3 A;  4REZ A;  3E1Z B;  4D8E A;  1THE A;  2PBH A;  3PNR A;  2PNS A;  1PPN A;  2H7J A;  2AU1 A;  3OVZ A;  4MI7 A;  5CVO B;  2FUD A;  2BU3 A;  2JTC A;  3CBJ A;  1CV8 A;  2ATO A;  1PIP A;  5A24 A;  3B79 A;  2OZ2 A;  5PAD A;  1AYW A;  4BS6 A;  2ACT A;  4I05 A;  2DJF B;  3N4C A;  1ATK A;  2P0R A;  2CIO A;  3C9E A;  3H6S A;  3HWN A;  3BPM A;  1X9Y A;  2IBI A;  3N3K A;  4QRV A;  5JZE A;  3BB7 A;  4W5B A;  3PSE A;  3MHH A;  4YYS A;  2FYE A;  4P6E A;  5EGW A;  3WXE A;  4P6G A;  4N79 A;  2VHF A;  2Z84 A;  3S3R A;  5EZQ A;  1STF E;  4YYQ A;  1MDW A;  4YYW A;  1CJL A;  1NB3 A;  3PHW A;  4I04 A;  1KFX L;  2OUL A;  1O0E A;  2G8E A;  3BBA A;  2P86 A;  3B21 A;  2AS8 A;  3V6E A;  4G54 A;  1GMY A;  1FH0 A;  3K8U A;  2NQD B;  4RF1 A;  2B1N A;  1AEC A;  3KKU A;  4QRG A;  1ME3 A;  1M6D A;  1YT7 A;  1PPP A;  2WBF X;  2FQ9 A;  3KWZ A;  1KHQ A;  1Y4H A;  2JQF R;  2R9M A;  4BOU A;  4AXM A;  3PHU A;  1NLJ A;  1PPD A;  4XUI A;  4OW0 A;  3USV A;  1NL6 A;  1U9W A;  2JRI A;  2FO5 A;  4CDC B;  3PRM A;  3MHS A;  3LFY A;  3QT4 A;  1BQI A;  1BY8 A;  3KW9 A;  3D6S A;  2AYO A;  3RVX A;  1XKG A;  3P5U A;  4K7C A;  1MHW A;  2F1G A;  2IPP B;  1GLO A;  2ARY A;  1MEG A;  1HUC B;  1PXV A;  2DJG B;  2DC7 A;  3IMA A;  3P5X A;  4YYU A;  2XU5 A;  4BOP A;  3HHA A;  2DZY A;  3RNV A;  4X6I A;  4R3D A;  1U9V A;  2YJ8 A;  4XZX A;  4MSX A;  2E01 A;  4X6H A;  1IWD A;  2E03 A;  3TNX A;  5E6J A;  3BOW A;  1TL9 A;  1EWP A;  3KWB X;  4BQV A;  3ZUA A;  2FE8 A;  4DMY A;  4QRX A;  2BTW A;  1QMY A;  3OVX A;  2O6X A;  3LXS A;  4OVZ B;  4WA6 A;  1KHP A;  4RY2 A;  1MS6 A;  1YVB A;  1CTE A;  3PRP A;  4HXD B;  2BDZ A;  2NQI A;  1POP A;  1CQD A;  4M0W A;  4BSQ A;  3IOQ A;  1U9X A;  1DKI A;  4A5U A;  4YYV A;  4PP1 A;  2NQG A;  4CDD B;  1EWM A;  2DCD A;  1ICF A;  1PCI A;  3MP2 A;  1NB5 A;  1ZCM A;  3I3T A;  2JQG R;  1A6R A;  2VHS A;  2DOS A;  2HD5 A;  1PPO A;  7PCK A;  1S4V A;  3RVV A;  5JH3 A;  1EWO A;  2CB5 A;  3O1G A;  1JQP A;  1K3B B;  4CDF B;  3BWK A;  4PT5 A;  1CPJ A;  3PHX A;  3C0R A;  1CS8 A;  3N3G A;  1KXR A;  2DC9 A;  2F7D A;  4RF0 A;  1AIM A;  2R9F A;  1ME4 A;  1DF0 A;  1AYU A;  1MEM A;  1Q6K A;  1BGO A;  1ZIV A;  2HHN A;  3CH2 X;  3CBK A;  3AI8 A;  1GEC E;  3TRK A;  1F2C A;  5F02 A;  3PDF A;  2Y5B A;  4QH6 A;  2G6D A;  2PRE A;  1Y08 A;  2G7Y A;  1NPZ A;  3WXF A;  4YYR A;  1DEU A;  2XU3 A;  2DCA A;  1AYV A;  4Q8H A;  4N8W A;  3BCN A;  3IFU A;  1BP4 A;  4FJC A;  3F75 A;  3KFQ A;  3P5W A;  2BDL A;  2YJ9 A;  2PAD A;  3KX1 A;  1QOL A;  4CZW A;  3DF0 A;  2OP3 A;  1PAD A;  2FRQ A;  1F2B A;  2HXZ A;  2J7Q C;  3BY4 A;  4IP3 A;  2R9N A;  1ITO A;  3OF9 A;  3O65 A;  2GFO A;  2BTW B;  4D8B A;  1AU3 A;  4OVZ A;  2HH5 A;  4HWY A;  9PAP A;  1PVJ A;  1CVZ A;  3KSE A;  5CHV A;  2AVW A;  2AUX A;  4QBB A;  3MOR A;  5K16 A;  3BC3 A;  4YV8 A;  2DCC A;  3QJ3 A;  4MZS A;  3OQC A;  4BPV A;  2DCB A;  4RKX A;  3IUT A;  4W5C A;  3BPF A;  4OEM A;  3H8C A;  4D8I A;  3O0U A;  1NQC A;  5CVN B;  1AU0 A;  1GCB A;  2GHU A;  1SP4 B;  3IEJ A;  3RVW A;  2AIM A;  3TMP A;  2UZJ A;  1F29 A;  3E9S A;  3OF8 A;  1U9Q X;  2Y6E A;  3H7D A;  2DC6 A;  4P16 A;  4MM3 B;  2AUZ A;  1EWL A;  1TLO A;  4PAD A;  1EF7 A;  2P7U A;  4KLB A;  4MZO A;  3K24 A;  4AXL A;  1PBH A;  3MTN A;  4XR7 A;  3ERV A;  5CVM A;  5CHT A;  4ZTB A;  3IHP A;  4IUM A;  4BOZ A;  2YJB A;  1UKF A;  2B1M A;  4CDE B;  4BS5 A;  2XU1 A;  5EZS A;  4N4Z A;  4DMX A;  3MTV A;  3HHI A;  4I07 A;  2FT2 A;  5KO3 A; 
#chains in the Genus database with same CATH homology
 4OEL A;  4W4U A;  3V6C A;  3H89 A;  1U5I A;  3M99 A;  2XU4 A;  2FRA A;  1YAL A;  6PAD A;  5J94 A;  1VSN A;  3IV2 A;  1F2A A;  2R6N A;  1CSB B;  2C0Y A;  1YK7 A;  4YVA A;  2DZZ A;  2YJC A;  3K9M A;  1QDQ A;  3U8E A;  1AU4 A;  5FPW A;  2E00 A;  3QSD A;  1W5R A;  2YJ2 A;  3CH3 X;  2G8J A;  1PE6 A;  2R9C A;  3GCB A;  3OIS A;  1GX3 A;  2DC8 A;  8PCH A;  4X6J A;  2R9O A;  3HD3 A;  2NQA A;  3I06 A;  2BSZ A;  1QXP A;  2FTD A;  1KFU L;  3NHE A;  3PW3 A;  3F5V A;  4Q8G A;  4FIP A;  2AYN A;  5EF4 A;  1CB5 A;  1YK8 A;  1MIR A;  3P5V A;  4PP2 E;  4FK5 A;  1VJV A;  3WXG A;  1TU6 A;  2E02 A;  3PBH A;  4ZUX U;  1AU2 A;  1SNK A;  3S3Q A;  3H8B A;  5JA7 A;  4PI3 A;  3E1Z B;  1THE A;  2PBH A;  3PNR A;  2PNS A;  1PPN A;  2H7J A;  2AU1 A;  3OVZ A;  5CVO B;  2FUD A;  3CBJ A;  1CV8 A;  2ATO A;  1PIP A;  5A24 A;  3B79 A;  2OZ2 A;  5PAD A;  1AYW A;  4BS6 A;  2ACT A;  4I05 A;  2DJF B;  3N4C A;  1ATK A;  2P0R A;  2CIO A;  3C9E A;  3H6S A;  3HWN A;  3BPM A;  1X9Y A;  2IBI A;  3N3K A;  4QRV A;  4W5B A;  3MHH A;  4YYS A;  2FYE A;  4P6E A;  5EGW A;  3WXE A;  4P6G A;  4N79 A;  2VHF A;  3S3R A;  1STF E;  4YYQ A;  1MDW A;  4YYW A;  1CJL A;  1NB3 A;  4I04 A;  1KFX L;  2OUL A;  1O0E A;  2G8E A;  2P86 A;  3D9W A;  2AS8 A;  3V6E A;  4G54 A;  1GMY A;  1FH0 A;  4NV8 A;  3K8U A;  2NQD B;  2B1N A;  1AEC A;  3KKU A;  4GUZ A;  4QRG A;  1ME3 A;  1M6D A;  1YT7 A;  1PPP A;  2WBF X;  2FQ9 A;  3KWZ A;  1KHQ A;  1Y4H A;  1E2T A;  2JQF R;  2R9M A;  4AXM A;  1NLJ A;  1PPD A;  4XUI A;  3USV A;  1NL6 A;  1U9W A;  2FO5 A;  4CDC B;  1W6F A;  3MHS A;  3LFY A;  3QT4 A;  1BQI A;  1BY8 A;  3KW9 A;  3D6S A;  2AYO A;  3RVX A;  1XKG A;  3P5U A;  4K7C A;  1MHW A;  2F1G A;  2IPP B;  1GLO A;  2ARY A;  1MEG A;  1HUC B;  1PXV A;  2DJG B;  2DC7 A;  3IMA A;  3P5X A;  4YYU A;  2XU5 A;  3HHA A;  4C5P A;  2DZY A;  4X6I A;  1U9V A;  2YJ8 A;  2VFB A;  4MSX A;  2E01 A;  4X6H A;  1IWD A;  2E03 A;  3TNX A;  3BOW A;  1TL9 A;  1EWP A;  3KWB X;  4BQV A;  3ZUA A;  4DMY A;  4QRX A;  1QMY A;  3OVX A;  2O6X A;  3LXS A;  4WA6 A;  1KHP A;  4RY2 A;  1MS6 A;  1YVB A;  1CTE A;  2BDZ A;  2NQI A;  2VFC A;  1POP A;  1CQD A;  4BGF A;  4BSQ A;  3IOQ A;  1U9X A;  4YYV A;  4PP1 A;  2NQG A;  4CDD B;  1EWM A;  2DCD A;  1ICF A;  1PCI A;  1NB5 A;  1ZCM A;  3I3T A;  2JQG R;  1A6R A;  2VHS A;  2HD5 A;  1PPO A;  7PCK A;  1S4V A;  3RVV A;  5JH3 A;  1EWO A;  2CB5 A;  3O1G A;  1JQP A;  1K3B B;  4CDF B;  3BWK A;  1CPJ A;  1CS8 A;  3N3G A;  1KXR A;  2DC9 A;  2F7D A;  1AIM A;  2R9F A;  1ME4 A;  1DF0 A;  1AYU A;  1MEM A;  1Q6K A;  1BGO A;  1ZIV A;  2HHN A;  3CH2 X;  3CBK A;  3AI8 A;  1GEC E;  1F2C A;  5F02 A;  3PDF A;  2Y5B A;  4QH6 A;  2G6D A;  2PRE A;  1Y08 A;  2G7Y A;  1NPZ A;  3WXF A;  4YYR A;  1DEU A;  2XU3 A;  2DCA A;  1AYV A;  4Q8H A;  4N8W A;  3BCN A;  1BP4 A;  4FJC A;  3F75 A;  3KFQ A;  3P5W A;  2BDL A;  4NV7 A;  2YJ9 A;  2PAD A;  3KX1 A;  1QOL A;  4CZW A;  3DF0 A;  3LTW A;  1W4T A;  2OP3 A;  1PAD A;  2FRQ A;  1F2B A;  2HXZ A;  2R9N A;  1ITO A;  3OF9 A;  2GFO A;  1AU3 A;  2HH5 A;  4HWY A;  9PAP A;  1CVZ A;  3KSE A;  5CHV A;  2AVW A;  2AUX A;  4QBB A;  3MOR A;  5K16 A;  3BC3 A;  4YV8 A;  2DCC A;  3QJ3 A;  4MZS A;  4BPV A;  2DCB A;  3IUT A;  4W5C A;  3BPF A;  4OEM A;  3H8C A;  3O0U A;  1NQC A;  5CVN B;  1AU0 A;  1GCB A;  2GHU A;  1SP4 B;  3IEJ A;  3RVW A;  2AIM A;  1F29 A;  4B55 A;  3OF8 A;  1U9Q X;  2Y6E A;  3H7D A;  2DC6 A;  2AUZ A;  1EWL A;  1TLO A;  4PAD A;  1EF7 A;  2P7U A;  4KLB A;  4MZO A;  3K24 A;  4AXL A;  1PBH A;  3MTN A;  4XR7 A;  3ERV A;  5CVM A;  5CHT A;  3IHP A;  2YJB A;  2B1M A;  4CDE B;  4BS5 A;  2XU1 A;  4N4Z A;  4DMX A;  3HHI A;  4I07 A;  2FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...