3O1GA

Cathepsin k covalently bound to a 2-cyano pyrimidine inhibitor with a benzyl p3 group.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o1gA00
1VSNA 4RY2A 3IEJA 5K16A 2FTDA 1ATKA 3C9EA 1GLOA 2R9MA 3CBKA 2AUZA 3IOQA 3MORA 2DCDA 3H8BA 1U9VA 4AXMA 2XU1A 2P7UA 1QMYA 1TLOA 4YV8A 4WA6A 1PXVA 4N79A 1EWOA 2CIOA 2E00A 4MZOA 4BSQA 3N3KA 4CDCB 2ATOA 4I05A 1NPZA 1U5IA 1CVZA 2XU4A 3O1GA 2YJBA 2FT2A 2XU3A 4N4ZA 4PI3A 3BPMA 5JH3A 5CHVA 2Y6EA 4X6JA 2G7YA 3IUTA 1A6RA 1MIRA 1ZCMA 4QH6A 1GECE 5F02A 3KKUA 2BDLA 3O0UA 5FPWA 2FRAA 2HH5A 2B1MA 3BOWA 2OULA 1K3BB 3IV2A 3F5VA 1PPPA 1F2AA 2FQ9A 4W4UA 3MHHA 3HHIA 1EWLA 2ARYA 1X9YA 1FH0A 2DCCA 5EF4A 2O6XA 2P0RA 1GCBA 3BWKA 4OELA 1AU2A 1PCIA 2DCAA 3B79A 3CH2X 3CH3X 2R6NA 2DZYA 2R9NA 1CQDA 4YYRA 2HD5A 2PREA 2OP3A 1M6DA 3IHPA 3K24A 2ACTA 3KSEA 4YVAA 4QRXA 1ITOA 4N8WA 1S4VA 4W5BA 2YJ9A 2BDZA 4PADA 2AS8A 3CBJA 1MDWA 2AUXA 2CB5A 1QXPA 3NHEA 1KFXL 2XU5A 1AU3A 1BP4A 8PCHA 1KHQA 4YYQA 2H7JA 1YT7A 3H89A 2AVWA 4YYWA 1ME3A 1KXRA 2P86A 3I3TA 1EWPA 3OF9A 1BQIA 1U9XA 3LXSA 1AYWA 2GHUA 4CDFB 4CDEB 3AI8A 3RVXA 3OVZA 3TNXA 4I07A 4MSXA 1PBHA 3HD3A 2R9CA 1YK7A 4BS5A 2R9FA 2Y5BA 4DMXA 3BPFA 3N4CA 3M99A 5EGWA 3D6SA 1CTEA 1PPNA 3KFQA 4CZWA 1PIPA 1THEA 1QDQA 3S3RA 1YVBA 2F7DA 3E1ZB 3WXEA 2NQAA 2DJFB 1ME4A 4BPVA 3PBHA 2VHFA 4P6GA 2JQFR 4BQVA 4XR7A 1STFE 1AIMA 1HUCB 3MHSA 1CJLA 1EWMA 3ZUAA 1NL6A 2JQGR 4QRVA 3I06A 1ZIVA 3PW3A 2DC6A 1YALA 3KX1A 1ICFA 2NQGA 3DF0A 4HWYA 1CPJA 3BC3A 1SNKA 2DZZA 1KHPA 2B1NA 1O0EA 6PADA 1YK8A 2G8EA 1IWDA 2R9OA 3WXFA 2HHNA 2YJ8A 1POPA 4QRGA 2DC8A 2HXZA 2GFOA 1PE6A 2AU1A 3N3GA 3OVXA 4MZSA 2F1GA 1TU6A 4OEMA 1AECA 3HHAA 4FIPA 4PP1A 2DC7A 2FUDA 1U9QX 1TL9A 1BGOA 3P5UA 1F2BA 2YJ2A 3KWBX 3KW9A 1CS8A 4FJCA 3QT4A 1MHWA 2YJCA 3USVA 3RVWA 2G8JA 3K9MA 3KWZA 1F29A 4P6EA 4AXLA 2WBFX 1PPDA 3ERVA 3PNRA 5CVMA 3V6EA 3H7DA 1F2CA 3H8CA 3HWNA 2FO5A 1U9WA 1XKGA 2AYOA 1SP4B 2E01A 5A24A 3V6CA 2AIMA 3QSDA 1KFUL 3PDFA 2NQIA 4CDDB 3QJ3A 1NQCA 3LFYA 1MEGA 3H6SA 1CB5A 3RVVA 1NLJA 1CSBB 7PCKA 5CVOB 2PBHA 2DC9A 3MTNA 3P5XA 1AU4A 2DJGB 3K8UA 2PADA 3OF8A 2NQDB 4W5CA 4Q8HA 1EF7A 1AYVA 1MEMA 5CVNB 4G54A 2G6DA 3WXGA 2AYNA 9PAPA 1Q6KA 2FRQA 1VJVA 4YYVA 2OZ2A 3F75A 1NB3A 4KLBA 4YYUA 4K7CA 1AYUA 2FYEA 2IPPB 3GCBA 4FK5A 4PP2E 1MS6A 1PPOA 2E03A 5JA7A 2C0YA 1Y08A 2E02A 4YYSA 1DF0A 3S3QA 1JQPA 4X6HA 4Q8GA 4ZUXU 1AU0A 5J94A 1QOLA 1BY8A 3OISA 3IMAA 1DEUA 4I04A 2DCBA 5CHTA 2PNSA 5PADA 4XUIA 4DMYA 1Y4HA 2VHSA 1PADA 2IBIA 4BS6A 1NB5A 3P5WA 4X6IA 3U8EA 1CV8A 3P5VA 1GMYA 4QBBA 3BCNA
chains in the Genus database with same CATH superfamily
1VSNA 4RY2A 3IEJA 5K16A 2FTDA 1ATKA 3C9EA 5JZEA 1GLOA 2R9MA 2HWKA 3CBKA 2AUZA 3MORA 3IOQA 2DCDA 3H8BA 3TRKA 1U9VA 4AXMA 2XU1A 2P7UA 4BOUA 3RNVA 1QMYA 1TLOA 4YV8A 4WA6A 1PXVA 4N79A 1EWOA 2CIOA 2E00A 4MZOA 4BSQA 3N3KA 4CDCB 4BOZA 2ATOA 4I05A 1NPZA 1U5IA 1CVZA 2XU4A 3O1GA 2YJBA 2FT2A 2XU3A 4N4ZA 4PI3A 3BPMA 5JH3A 1YZBA 5CHVA 2Y6EA 4RF0A 4X6JA 2G7YA 3IUTA 1A6RA 1MIRA 2J7QA 3PT2A 4BOQA 1ZCMA 3E9SA 1DKIA 4QH6A 1GECE 5F02A 5EZQA 3KKUA 2BDLA 3O0UA 5FPWA 2FRAA 1PVJA 2HH5A 2B1MA 3BOWA 2OULA 1K3BB 3PSEA 3IV2A 3F5VA 1PPPA 1F2AA 5KO3A 2FQ9A 4W4UA 3MHHA 3PRMA 3HHIA 1EWLA 2ARYA 1X9YA 1FH0A 2DCCA 5EF4A 2O6XA 2P0RA 4RF1A 1GCBA 3BWKA 4OELA 1AU2A 1PCIA 2DCAA 3C0RA 3B79A 3CH2X 3CH3X 2R6NA 2DZYA 2R9NA 1CQDA 4YYRA 2HD5A 2PREA 2OP3A 1M6DA 4PT5A 3IHPA 3K24A 4ZTBA 2ACTA 3KSEA 4YVAA 4QRXA 1ITOA 4N8WA 1S4VA 3BY4A 4W5BA 2YJ9A 2BDZA 4PADA 5EZSA 2AS8A 3CBJA 1MDWA 2AUXA 2CB5A 1QXPA 3NHEA 1KFXL 2XU5A 1AU3A 1BP4A 4GUAA 4RNAA 8PCHA 1KHQA 4YYQA 2H7JA 1YT7A 3H89A 2AVWA 3MJ5A 4YYWA 1ME3A 4OVZA 1KXRA 4MI7A 2P86A 3I3TA 1EWPA 3OF9A 1BQIA 1U9XA 2BU3A 3W31A 3LXSA 1AYWA 2GHUA 4CDFB 3O65A 4D8EA 4CDEB 3AI8A 3RVXA 3OVZA 3TNXA 2Z84A 4I07A 4MSXA 1PBHA 3HD3A 2R9CA 3PHWA 1YK7A 4BS5A 2R9FA 2Y5BA 4DMXA 3BPFA 3N4CA 3M99A 5EGWA 3D6SA 2JTCA 3W30A 1CTEA 1PPNA 3KFQA 3MP2A 4CZWA 1PIPA 1THEA 1QDQA 3S3RA 4XZXA 1YVBA 2F7DA 3E1ZB 3WXEA 2NQAA 2DJFB 1ME4A 4BPVA 3PBHA 2VHFA 5E6JA 4P6GA 2JQFR 4BQVA 4XR7A 1STFE 1AIMA 1HUCB 3MHSA 1CJLA 1EWMA 3ZUAA 1NL6A 2JQGR 4QRVA 3I06A 1ZIVA 3PW3A 2DC6A 1YALA 3KX1A 1ICFA 2NQGA 3DF0A 4HWYA 1CPJA 3BC3A 1SNKA 2DZZA 1KHPA 2B1NA 1O0EA 6PADA 3BBAA 1YK8A 2G8EA 1UKFA 1IWDA 2R9OA 3WXFA 2HHNA 2YJ8A 1POPA 4HXDB 4QRGA 2DC8A 2HXZA 2GFOA 1PE6A 2AGAA 2AU1A 3N3GA 3OVXA 4MZSA 2BTWA 2F1GA 1TU6A 4OEMA 4BOPA 2DOSA 1AECA 3HHAA 2FE8A 4FIPA 4PP1A 2DC7A 2FUDA 1U9QX 1TL9A 1BGOA 3P5UA 1F2BA 2YJ2A 3KWBX 3KW9A 1CS8A 4OW0A 3B21A 4FJCA 3QT4A 1MHWA 2YJCA 3USVA 3RVWA 4BOSA 2G8JA 3K9MA 4IP3A 3KWZA 1F29A 4P6EA 4AXLA 2WBFX 4D8BA 1PPDA 3ERVA 3PNRA 5CVMA 3V6EA 3H7DA 1F2CA 3H8CA 3HWNA 2FO5A 2J7QC 1U9WA 1XKGA 2AYOA 1SP4B 2E01A 5A24A 4P16A 3V6CA 2AIMA 3QSDA 4R3DA 4D8IA 1KFUL 3PDFA 2NQIA 3PHUA 2UZJA 4CDDB 3QJ3A 3MTVA 1NQCA 3LFYA 4A5UA 1MEGA 3H6SA 1CB5A 3RVVA 1NLJA 1CSBB 2JRIA 7PCKA 5CVOB 2PBHA 2DC9A 3MTNA 3P5XA 1AU4A 3TMPA 2DJGB 3K8UA 2PADA 3OF8A 2NQDB 4W5CA 4Q8HA 1EF7A 1AYVA 1MEMA 5CVNB 4G54A 2G6DA 3WXGA 2AYNA 9PAPA 3PRPA 1Q6KA 4OVZB 2FRQA 1VJVA 4RKXA 4YYVA 2OZ2A 3F75A 1NB3A 3IFUA 4KLBA 4YYUA 4K7CA 2BTWB 4M0WA 1AYUA 2FYEA 2IPPB 3GCBA 4FK5A 4PP2E 1MS6A 1PPOA 2E03A 5JA7A 2C0YA 1Y08A 2E02A 3ZNHA 4YYSA 1DF0A 3S3QA 1JQPA 4X6HA 4Q8GA 4ZUXU 1AU0A 3BB7A 3PHXA 5J94A 1QOLA 1BY8A 3OISA 4MM3B 3IMAA 1DEUA 4I04A 3OQCA 4REZA 2DCBA 5CHTA 2PNSA 5PADA 4XUIA 4IUMA 4DMYA 1Y4HA 4WURA 2VHSA 1PADA 2IBIA 4BS6A 1NB5A 3P5WA 4X6IA 3U8EA 1CV8A 3P5VA 1GMYA 4QBBA 3BCNA
chains in the Genus database with same CATH topology
1VSNA 4RY2A 3IEJA 5K16A 2FTDA 1ATKA 4GUZA 3C9EA 1GLOA 2R9MA 3CBKA 2AUZA 3IOQA 3MORA 2DCDA 3H8BA 1U9VA 4AXMA 2XU1A 2P7UA 1QMYA 1TLOA 4YV8A 4WA6A 1PXVA 4N79A 1EWOA 2CIOA 2E00A 4MZOA 4BSQA 3N3KA 1GX3A 4CDCB 2ATOA 4I05A 1NPZA 1U5IA 1CVZA 2XU4A 3O1GA 2YJBA 2FT2A 2XU3A 4N4ZA 4PI3A 3BPMA 5JH3A 5CHVA 2Y6EA 4X6JA 2G7YA 3IUTA 1A6RA 1MIRA 1ZCMA 4QH6A 1GECE 5F02A 3KKUA 2BDLA 3O0UA 5FPWA 2FRAA 2HH5A 2B1MA 3BOWA 2OULA 1K3BB 3IV2A 3F5VA 1PPPA 4NV7A 1F2AA 2FQ9A 4W4UA 3MHHA 3HHIA 1EWLA 2ARYA 1X9YA 1FH0A 2DCCA 5EF4A 2O6XA 2P0RA 1GCBA 3BWKA 4OELA 1AU2A 1PCIA 2DCAA 3B79A 1E2TA 3CH2X 3CH3X 2R6NA 2DZYA 2R9NA 1CQDA 4YYRA 2HD5A 2PREA 2OP3A 1M6DA 3IHPA 3K24A 2ACTA 3KSEA 4YVAA 4QRXA 1ITOA 4N8WA 1S4VA 4W5BA 2YJ9A 2BDZA 4PADA 2AS8A 3CBJA 1MDWA 2AUXA 2CB5A 1QXPA 3NHEA 1KFXL 2XU5A 1AU3A 1BP4A 8PCHA 1KHQA 4YYQA 2H7JA 1YT7A 3H89A 2AVWA 4YYWA 1ME3A 1KXRA 2P86A 3I3TA 1EWPA 3OF9A 1BQIA 1U9XA 3LXSA 1W6FA 1AYWA 2GHUA 4CDFB 3D9WA 4CDEB 3AI8A 3RVXA 3OVZA 3TNXA 4I07A 4MSXA 1PBHA 3HD3A 2R9CA 2VFCA 1YK7A 4BS5A 2R9FA 4B55A 2Y5BA 4DMXA 3BPFA 3N4CA 3M99A 5EGWA 3D6SA 1CTEA 1PPNA 3KFQA 4CZWA 1PIPA 1THEA 1QDQA 3S3RA 1YVBA 2F7DA 3E1ZB 3WXEA 2NQAA 2DJFB 1ME4A 4BPVA 3PBHA 2VHFA 4P6GA 2JQFR 4BQVA 4XR7A 1STFE 1AIMA 1HUCB 3MHSA 1CJLA 1EWMA 3ZUAA 1NL6A 2JQGR 4QRVA 3I06A 1ZIVA 3PW3A 2DC6A 1YALA 3KX1A 1ICFA 2NQGA 3DF0A 4HWYA 1CPJA 3BC3A 1SNKA 2DZZA 1KHPA 2B1NA 1O0EA 6PADA 1YK8A 2G8EA 1IWDA 2R9OA 3WXFA 2HHNA 2YJ8A 1POPA 4QRGA 2DC8A 2HXZA 2GFOA 1PE6A 2AU1A 3N3GA 3OVXA 4MZSA 2F1GA 1TU6A 4OEMA 1AECA 3HHAA 4FIPA 4PP1A 2DC7A 2FUDA 1U9QX 1TL9A 1BGOA 3P5UA 1F2BA 2YJ2A 3KWBX 3KW9A 1CS8A 3LTWA 4FJCA 3QT4A 1MHWA 2YJCA 3USVA 3RVWA 2G8JA 3K9MA 1W5RA 1F29A 3KWZA 4P6EA 4AXLA 2WBFX 1PPDA 3ERVA 3PNRA 5CVMA 3V6EA 3H7DA 1F2CA 3H8CA 3HWNA 2FO5A 1U9WA 1XKGA 2AYOA 1SP4B 2E01A 5A24A 3V6CA 2AIMA 3QSDA 1KFUL 3PDFA 2NQIA 4CDDB 3QJ3A 1NQCA 2BSZA 3LFYA 1MEGA 3H6SA 1CB5A 3RVVA 1NLJA 1CSBB 7PCKA 5CVOB 2PBHA 2DC9A 3MTNA 3P5XA 1AU4A 2DJGB 3K8UA 2PADA 3OF8A 2NQDB 4W5CA 4BGFA 1EF7A 4Q8HA 1AYVA 1MEMA 5CVNB 4G54A 2G6DA 3WXGA 2AYNA 9PAPA 1Q6KA 4C5PA 2FRQA 1VJVA 4YYVA 2OZ2A 3F75A 1NB3A 4KLBA 4YYUA 4K7CA 1AYUA 2FYEA 2IPPB 3GCBA 4NV8A 4FK5A 4PP2E 1MS6A 1PPOA 2E03A 5JA7A 2C0YA 1Y08A 2E02A 4YYSA 1DF0A 3S3QA 1JQPA 4X6HA 4Q8GA 4ZUXU 1AU0A 5J94A 1QOLA 1BY8A 3OISA 3IMAA 1DEUA 4I04A 2DCBA 5CHTA 2PNSA 5PADA 4XUIA 4DMYA 1Y4HA 2VHSA 1PADA 2IBIA 4BS6A 2VFBA 1NB5A 3P5WA 4X6IA 3U8EA 1CV8A 3P5VA 1GMYA 4QBBA 3BCNA 1W4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSN A;  4RY2 A;  3IEJ A;  5K16 A;  2FTD A;  1ATK A;  3C9E A;  1GLO A;  2R9M A;  3CBK A;  2AUZ A;  3IOQ A;  3MOR A;  2DCD A;  3H8B A;  1U9V A;  4AXM A;  2XU1 A;  2P7U A;  1QMY A;  1TLO A;  4YV8 A;  4WA6 A;  1PXV A;  4N79 A;  1EWO A;  2CIO A;  2E00 A;  4MZO A;  4BSQ A;  3N3K A;  4CDC B;  2ATO A;  4I05 A;  1NPZ A;  1U5I A;  1CVZ A;  2XU4 A;  3O1G A;  2YJB A;  2FT2 A;  2XU3 A;  4N4Z A;  4PI3 A;  3BPM A;  5JH3 A;  5CHV A;  2Y6E A;  4X6J A;  2G7Y A;  3IUT A;  1A6R A;  1MIR A;  1ZCM A;  4QH6 A;  1GEC E;  5F02 A;  3KKU A;  2BDL A;  3O0U A;  5FPW A;  2FRA A;  2HH5 A;  2B1M A;  3BOW A;  2OUL A;  1K3B B;  3IV2 A;  3F5V A;  1PPP A;  1F2A A;  2FQ9 A;  4W4U A;  3MHH A;  3HHI A;  1EWL A;  2ARY A;  1X9Y A;  1FH0 A;  2DCC A;  5EF4 A;  2O6X A;  2P0R A;  1GCB A;  3BWK A;  4OEL A;  1AU2 A;  1PCI A;  2DCA A;  3B79 A;  3CH2 X;  3CH3 X;  2R6N A;  2DZY A;  2R9N A;  1CQD A;  4YYR A;  2HD5 A;  2PRE A;  2OP3 A;  1M6D A;  3IHP A;  3K24 A;  2ACT A;  3KSE A;  4YVA A;  4QRX A;  1ITO A;  4N8W A;  1S4V A;  4W5B A;  2YJ9 A;  2BDZ A;  4PAD A;  2AS8 A;  3CBJ A;  1MDW A;  2AUX A;  2CB5 A;  1QXP A;  3NHE A;  1KFX L;  2XU5 A;  1AU3 A;  1BP4 A;  8PCH A;  1KHQ A;  4YYQ A;  2H7J A;  1YT7 A;  3H89 A;  2AVW A;  4YYW A;  1ME3 A;  1KXR A;  2P86 A;  3I3T A;  1EWP A;  3OF9 A;  1BQI A;  1U9X A;  3LXS A;  1AYW A;  2GHU A;  4CDF B;  4CDE B;  3AI8 A;  3RVX A;  3OVZ A;  3TNX A;  4I07 A;  4MSX A;  1PBH A;  3HD3 A;  2R9C A;  1YK7 A;  4BS5 A;  2R9F A;  2Y5B A;  4DMX A;  3BPF A;  3N4C A;  3M99 A;  5EGW A;  3D6S A;  1CTE A;  1PPN A;  3KFQ A;  4CZW A;  1PIP A;  1THE A;  1QDQ A;  3S3R A;  1YVB A;  2F7D A;  3E1Z B;  3WXE A;  2NQA A;  2DJF B;  1ME4 A;  4BPV A;  3PBH A;  2VHF A;  4P6G A;  2JQF R;  4BQV A;  4XR7 A;  1STF E;  1AIM A;  1HUC B;  3MHS A;  1CJL A;  1EWM A;  3ZUA A;  1NL6 A;  2JQG R;  4QRV A;  3I06 A;  1ZIV A;  3PW3 A;  2DC6 A;  1YAL A;  3KX1 A;  1ICF A;  2NQG A;  3DF0 A;  4HWY A;  1CPJ A;  3BC3 A;  1SNK A;  2DZZ A;  1KHP A;  2B1N A;  1O0E A;  6PAD A;  1YK8 A;  2G8E A;  1IWD A;  2R9O A;  3WXF A;  2HHN A;  2YJ8 A;  1POP A;  4QRG A;  2DC8 A;  2HXZ A;  2GFO A;  1PE6 A;  2AU1 A;  3N3G A;  3OVX A;  4MZS A;  2F1G A;  1TU6 A;  4OEM A;  1AEC A;  3HHA A;  4FIP A;  4PP1 A;  2DC7 A;  2FUD A;  1U9Q X;  1TL9 A;  1BGO A;  3P5U A;  1F2B A;  2YJ2 A;  3KWB X;  3KW9 A;  1CS8 A;  4FJC A;  3QT4 A;  1MHW A;  2YJC A;  3USV A;  3RVW A;  2G8J A;  3K9M A;  3KWZ A;  1F29 A;  4P6E A;  4AXL A;  2WBF X;  1PPD A;  3ERV A;  3PNR A;  5CVM A;  3V6E A;  3H7D A;  1F2C A;  3H8C A;  3HWN A;  2FO5 A;  1U9W A;  1XKG A;  2AYO A;  1SP4 B;  2E01 A;  5A24 A;  3V6C A;  2AIM A;  3QSD A;  1KFU L;  3PDF A;  2NQI A;  4CDD B;  3QJ3 A;  1NQC A;  3LFY A;  1MEG A;  3H6S A;  1CB5 A;  3RVV A;  1NLJ A;  1CSB B;  7PCK A;  5CVO B;  2PBH A;  2DC9 A;  3MTN A;  3P5X A;  1AU4 A;  2DJG B;  3K8U A;  2PAD A;  3OF8 A;  2NQD B;  4W5C A;  4Q8H A;  1EF7 A;  1AYV A;  1MEM A;  5CVN B;  4G54 A;  2G6D A;  3WXG A;  2AYN A;  9PAP A;  1Q6K A;  2FRQ A;  1VJV A;  4YYV A;  2OZ2 A;  3F75 A;  1NB3 A;  4KLB A;  4YYU A;  4K7C A;  1AYU A;  2FYE A;  2IPP B;  3GCB A;  4FK5 A;  4PP2 E;  1MS6 A;  1PPO A;  2E03 A;  5JA7 A;  2C0Y A;  1Y08 A;  2E02 A;  4YYS A;  1DF0 A;  3S3Q A;  1JQP A;  4X6H A;  4Q8G A;  4ZUX U;  1AU0 A;  5J94 A;  1QOL A;  1BY8 A;  3OIS A;  3IMA A;  1DEU A;  4I04 A;  2DCB A;  5CHT A;  2PNS A;  5PAD A;  4XUI A;  4DMY A;  1Y4H A;  2VHS A;  1PAD A;  2IBI A;  4BS6 A;  1NB5 A;  3P5W A;  4X6I A;  3U8E A;  1CV8 A;  3P5V A;  1GMY A;  4QBB A;  3BCN A; 
#chains in the Genus database with same CATH topology
 1VSN A;  4RY2 A;  3IEJ A;  5K16 A;  2FTD A;  1ATK A;  3C9E A;  5JZE A;  1GLO A;  2R9M A;  2HWK A;  3CBK A;  2AUZ A;  3MOR A;  3IOQ A;  2DCD A;  3H8B A;  3TRK A;  1U9V A;  4AXM A;  2XU1 A;  2P7U A;  4BOU A;  3RNV A;  1QMY A;  1TLO A;  4YV8 A;  4WA6 A;  1PXV A;  4N79 A;  1EWO A;  2CIO A;  2E00 A;  4MZO A;  4BSQ A;  3N3K A;  4CDC B;  4BOZ A;  2ATO A;  4I05 A;  1NPZ A;  1U5I A;  1CVZ A;  2XU4 A;  3O1G A;  2YJB A;  2FT2 A;  2XU3 A;  4N4Z A;  4PI3 A;  3BPM A;  5JH3 A;  1YZB A;  5CHV A;  2Y6E A;  4RF0 A;  4X6J A;  2G7Y A;  3IUT A;  1A6R A;  1MIR A;  2J7Q A;  3PT2 A;  4BOQ A;  1ZCM A;  3E9S A;  1DKI A;  4QH6 A;  1GEC E;  5F02 A;  5EZQ A;  3KKU A;  2BDL A;  3O0U A;  5FPW A;  2FRA A;  1PVJ A;  2HH5 A;  2B1M A;  3BOW A;  2OUL A;  1K3B B;  3PSE A;  3IV2 A;  3F5V A;  1PPP A;  1F2A A;  5KO3 A;  2FQ9 A;  4W4U A;  3MHH A;  3PRM A;  3HHI A;  1EWL A;  2ARY A;  1X9Y A;  1FH0 A;  2DCC A;  5EF4 A;  2O6X A;  2P0R A;  4RF1 A;  1GCB A;  3BWK A;  4OEL A;  1AU2 A;  1PCI A;  2DCA A;  3C0R A;  3B79 A;  3CH2 X;  3CH3 X;  2R6N A;  2DZY A;  2R9N A;  1CQD A;  4YYR A;  2HD5 A;  2PRE A;  2OP3 A;  1M6D A;  4PT5 A;  3IHP A;  3K24 A;  4ZTB A;  2ACT A;  3KSE A;  4YVA A;  4QRX A;  1ITO A;  4N8W A;  1S4V A;  3BY4 A;  4W5B A;  2YJ9 A;  2BDZ A;  4PAD A;  5EZS A;  2AS8 A;  3CBJ A;  1MDW A;  2AUX A;  2CB5 A;  1QXP A;  3NHE A;  1KFX L;  2XU5 A;  1AU3 A;  1BP4 A;  4GUA A;  4RNA A;  8PCH A;  1KHQ A;  4YYQ A;  2H7J A;  1YT7 A;  3H89 A;  2AVW A;  3MJ5 A;  4YYW A;  1ME3 A;  4OVZ A;  1KXR A;  4MI7 A;  2P86 A;  3I3T A;  1EWP A;  3OF9 A;  1BQI A;  1U9X A;  2BU3 A;  3W31 A;  3LXS A;  1AYW A;  2GHU A;  4CDF B;  3O65 A;  4D8E A;  4CDE B;  3AI8 A;  3RVX A;  3OVZ A;  3TNX A;  2Z84 A;  4I07 A;  4MSX A;  1PBH A;  3HD3 A;  2R9C A;  3PHW A;  1YK7 A;  4BS5 A;  2R9F A;  2Y5B A;  4DMX A;  3BPF A;  3N4C A;  3M99 A;  5EGW A;  3D6S A;  2JTC A;  3W30 A;  1CTE A;  1PPN A;  3KFQ A;  3MP2 A;  4CZW A;  1PIP A;  1THE A;  1QDQ A;  3S3R A;  4XZX A;  1YVB A;  2F7D A;  3E1Z B;  3WXE A;  2NQA A;  2DJF B;  1ME4 A;  4BPV A;  3PBH A;  2VHF A;  5E6J A;  4P6G A;  2JQF R;  4BQV A;  4XR7 A;  1STF E;  1AIM A;  1HUC B;  3MHS A;  1CJL A;  1EWM A;  3ZUA A;  1NL6 A;  2JQG R;  4QRV A;  3I06 A;  1ZIV A;  3PW3 A;  2DC6 A;  1YAL A;  3KX1 A;  1ICF A;  2NQG A;  3DF0 A;  4HWY A;  1CPJ A;  3BC3 A;  1SNK A;  2DZZ A;  1KHP A;  2B1N A;  1O0E A;  6PAD A;  3BBA A;  1YK8 A;  2G8E A;  1UKF A;  1IWD A;  2R9O A;  3WXF A;  2HHN A;  2YJ8 A;  1POP A;  4HXD B;  4QRG A;  2DC8 A;  2HXZ A;  2GFO A;  1PE6 A;  2AGA A;  2AU1 A;  3N3G A;  3OVX A;  4MZS A;  2BTW A;  2F1G A;  1TU6 A;  4OEM A;  4BOP A;  2DOS A;  1AEC A;  3HHA A;  2FE8 A;  4FIP A;  4PP1 A;  2DC7 A;  2FUD A;  1U9Q X;  1TL9 A;  1BGO A;  3P5U A;  1F2B A;  2YJ2 A;  3KWB X;  3KW9 A;  1CS8 A;  4OW0 A;  3B21 A;  4FJC A;  3QT4 A;  1MHW A;  2YJC A;  3USV A;  3RVW A;  4BOS A;  2G8J A;  3K9M A;  4IP3 A;  3KWZ A;  1F29 A;  4P6E A;  4AXL A;  2WBF X;  4D8B A;  1PPD A;  3ERV A;  3PNR A;  5CVM A;  3V6E A;  3H7D A;  1F2C A;  3H8C A;  3HWN A;  2FO5 A;  2J7Q C;  1U9W A;  1XKG A;  2AYO A;  1SP4 B;  2E01 A;  5A24 A;  4P16 A;  3V6C A;  2AIM A;  3QSD A;  4R3D A;  4D8I A;  1KFU L;  3PDF A;  2NQI A;  3PHU A;  2UZJ A;  4CDD B;  3QJ3 A;  3MTV A;  1NQC A;  3LFY A;  4A5U A;  1MEG A;  3H6S A;  1CB5 A;  3RVV A;  1NLJ A;  1CSB B;  2JRI A;  7PCK A;  5CVO B;  2PBH A;  2DC9 A;  3MTN A;  3P5X A;  1AU4 A;  3TMP A;  2DJG B;  3K8U A;  2PAD A;  3OF8 A;  2NQD B;  4W5C A;  4Q8H A;  1EF7 A;  1AYV A;  1MEM A;  5CVN B;  4G54 A;  2G6D A;  3WXG A;  2AYN A;  9PAP A;  3PRP A;  1Q6K A;  4OVZ B;  2FRQ A;  1VJV A;  4RKX A;  4YYV A;  2OZ2 A;  3F75 A;  1NB3 A;  3IFU A;  4KLB A;  4YYU A;  4K7C A;  2BTW B;  4M0W A;  1AYU A;  2FYE A;  2IPP B;  3GCB A;  4FK5 A;  4PP2 E;  1MS6 A;  1PPO A;  2E03 A;  5JA7 A;  2C0Y A;  1Y08 A;  2E02 A;  3ZNH A;  4YYS A;  1DF0 A;  3S3Q A;  1JQP A;  4X6H A;  4Q8G A;  4ZUX U;  1AU0 A;  3BB7 A;  3PHX A;  5J94 A;  1QOL A;  1BY8 A;  3OIS A;  4MM3 B;  3IMA A;  1DEU A;  4I04 A;  3OQC A;  4REZ A;  2DCB A;  5CHT A;  2PNS A;  5PAD A;  4XUI A;  4IUM A;  4DMY A;  1Y4H A;  4WUR A;  2VHS A;  1PAD A;  2IBI A;  4BS6 A;  1NB5 A;  3P5W A;  4X6I A;  3U8E A;  1CV8 A;  3P5V A;  1GMY A;  4QBB A;  3BCN A; 
#chains in the Genus database with same CATH homology
 1VSN A;  4RY2 A;  3IEJ A;  5K16 A;  2FTD A;  1ATK A;  4GUZ A;  3C9E A;  1GLO A;  2R9M A;  3CBK A;  2AUZ A;  3IOQ A;  3MOR A;  2DCD A;  3H8B A;  1U9V A;  4AXM A;  2XU1 A;  2P7U A;  1QMY A;  1TLO A;  4YV8 A;  4WA6 A;  1PXV A;  4N79 A;  1EWO A;  2CIO A;  2E00 A;  4MZO A;  4BSQ A;  3N3K A;  1GX3 A;  4CDC B;  2ATO A;  4I05 A;  1NPZ A;  1U5I A;  1CVZ A;  2XU4 A;  3O1G A;  2YJB A;  2FT2 A;  2XU3 A;  4N4Z A;  4PI3 A;  3BPM A;  5JH3 A;  5CHV A;  2Y6E A;  4X6J A;  2G7Y A;  3IUT A;  1A6R A;  1MIR A;  1ZCM A;  4QH6 A;  1GEC E;  5F02 A;  3KKU A;  2BDL A;  3O0U A;  5FPW A;  2FRA A;  2HH5 A;  2B1M A;  3BOW A;  2OUL A;  1K3B B;  3IV2 A;  3F5V A;  1PPP A;  4NV7 A;  1F2A A;  2FQ9 A;  4W4U A;  3MHH A;  3HHI A;  1EWL A;  2ARY A;  1X9Y A;  1FH0 A;  2DCC A;  5EF4 A;  2O6X A;  2P0R A;  1GCB A;  3BWK A;  4OEL A;  1AU2 A;  1PCI A;  2DCA A;  3B79 A;  1E2T A;  3CH2 X;  3CH3 X;  2R6N A;  2DZY A;  2R9N A;  1CQD A;  4YYR A;  2HD5 A;  2PRE A;  2OP3 A;  1M6D A;  3IHP A;  3K24 A;  2ACT A;  3KSE A;  4YVA A;  4QRX A;  1ITO A;  4N8W A;  1S4V A;  4W5B A;  2YJ9 A;  2BDZ A;  4PAD A;  2AS8 A;  3CBJ A;  1MDW A;  2AUX A;  2CB5 A;  1QXP A;  3NHE A;  1KFX L;  2XU5 A;  1AU3 A;  1BP4 A;  8PCH A;  1KHQ A;  4YYQ A;  2H7J A;  1YT7 A;  3H89 A;  2AVW A;  4YYW A;  1ME3 A;  1KXR A;  2P86 A;  3I3T A;  1EWP A;  3OF9 A;  1BQI A;  1U9X A;  3LXS A;  1W6F A;  1AYW A;  2GHU A;  4CDF B;  3D9W A;  4CDE B;  3AI8 A;  3RVX A;  3OVZ A;  3TNX A;  4I07 A;  4MSX A;  1PBH A;  3HD3 A;  2R9C A;  2VFC A;  1YK7 A;  4BS5 A;  2R9F A;  4B55 A;  2Y5B A;  4DMX A;  3BPF A;  3N4C A;  3M99 A;  5EGW A;  3D6S A;  1CTE A;  1PPN A;  3KFQ A;  4CZW A;  1PIP A;  1THE A;  1QDQ A;  3S3R A;  1YVB A;  2F7D A;  3E1Z B;  3WXE A;  2NQA A;  2DJF B;  1ME4 A;  4BPV A;  3PBH A;  2VHF A;  4P6G A;  2JQF R;  4BQV A;  4XR7 A;  1STF E;  1AIM A;  1HUC B;  3MHS A;  1CJL A;  1EWM A;  3ZUA A;  1NL6 A;  2JQG R;  4QRV A;  3I06 A;  1ZIV A;  3PW3 A;  2DC6 A;  1YAL A;  3KX1 A;  1ICF A;  2NQG A;  3DF0 A;  4HWY A;  1CPJ A;  3BC3 A;  1SNK A;  2DZZ A;  1KHP A;  2B1N A;  1O0E A;  6PAD A;  1YK8 A;  2G8E A;  1IWD A;  2R9O A;  3WXF A;  2HHN A;  2YJ8 A;  1POP A;  4QRG A;  2DC8 A;  2HXZ A;  2GFO A;  1PE6 A;  2AU1 A;  3N3G A;  3OVX A;  4MZS A;  2F1G A;  1TU6 A;  4OEM A;  1AEC A;  3HHA A;  4FIP A;  4PP1 A;  2DC7 A;  2FUD A;  1U9Q X;  1TL9 A;  1BGO A;  3P5U A;  1F2B A;  2YJ2 A;  3KWB X;  3KW9 A;  1CS8 A;  3LTW A;  4FJC A;  3QT4 A;  1MHW A;  2YJC A;  3USV A;  3RVW A;  2G8J A;  3K9M A;  1W5R A;  1F29 A;  3KWZ A;  4P6E A;  4AXL A;  2WBF X;  1PPD A;  3ERV A;  3PNR A;  5CVM A;  3V6E A;  3H7D A;  1F2C A;  3H8C A;  3HWN A;  2FO5 A;  1U9W A;  1XKG A;  2AYO A;  1SP4 B;  2E01 A;  5A24 A;  3V6C A;  2AIM A;  3QSD A;  1KFU L;  3PDF A;  2NQI A;  4CDD B;  3QJ3 A;  1NQC A;  2BSZ A;  3LFY A;  1MEG A;  3H6S A;  1CB5 A;  3RVV A;  1NLJ A;  1CSB B;  7PCK A;  5CVO B;  2PBH A;  2DC9 A;  3MTN A;  3P5X A;  1AU4 A;  2DJG B;  3K8U A;  2PAD A;  3OF8 A;  2NQD B;  4W5C A;  4BGF A;  1EF7 A;  4Q8H A;  1AYV A;  1MEM A;  5CVN B;  4G54 A;  2G6D A;  3WXG A;  2AYN A;  9PAP A;  1Q6K A;  4C5P A;  2FRQ A;  1VJV A;  4YYV A;  2OZ2 A;  3F75 A;  1NB3 A;  4KLB A;  4YYU A;  4K7C A;  1AYU A;  2FYE A;  2IPP B;  3GCB A;  4NV8 A;  4FK5 A;  4PP2 E;  1MS6 A;  1PPO A;  2E03 A;  5JA7 A;  2C0Y A;  1Y08 A;  2E02 A;  4YYS A;  1DF0 A;  3S3Q A;  1JQP A;  4X6H A;  4Q8G A;  4ZUX U;  1AU0 A;  5J94 A;  1QOL A;  1BY8 A;  3OIS A;  3IMA A;  1DEU A;  4I04 A;  2DCB A;  5CHT A;  2PNS A;  5PAD A;  4XUI A;  4DMY A;  1Y4H A;  2VHS A;  1PAD A;  2IBI A;  4BS6 A;  2VFB A;  1NB5 A;  3P5W A;  4X6I A;  3U8E A;  1CV8 A;  3P5V A;  1GMY A;  4QBB A;  3BCN A;  1W4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...