3O1GA

Cathepsin k covalently bound to a 2-cyano pyrimidine inhibitor with a benzyl p3 group.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o1gA00
2ARYA 2OZ2A 4YYRA 1MHWA 1AU2A 2DC6A 1YK8A 2DCCA 4I05A 2FTDA 2F1GA 1TU6A 2P86A 4QBBA 2IBIA 3O0UA 2ATOA 3V6CA 5CVOB 4CDDB 3RVXA 1NB3A 1AU0A 2BDZA 2DC7A 3CH3X 1IWDA 2E01A 1MEMA 2FRQA 4BSQA 4CDCB 3CBKA 1NB5A 2F7DA 1DF0A 5EGWA 1QOLA 4N79A 1EWMA 1GLOA 4AXLA 1BP4A 5F02A 3NHEA 2XU3A 2AS8A 1ME3A 1KFUL 3IOQA 4YV8A 3OF8A 1QDQA 2GFOA 2R6NA 1MIRA 4MSXA 4RY2A 1PPPA 2NQGA 2AYNA 1JQPA 3DF0A 1AECA 1U9WA 2DJFB 4PP2E 3U8EA 1EWLA 1POPA 1AU4A 5A24A 2YJ9A 3TNXA 4QRXA 3OISA 2AU1A 3IHPA 2YJCA 1BQIA 1CSBB 3WXGA 4BQVA 3KSEA 3P5XA 1AYWA 1MDWA 1X9YA 4MZSA 3HHIA 3PNRA 1U9VA 3P5UA 2FT2A 4P6EA 2FYEA 1DEUA 4CDEB 2NQIA 4DMYA 1EF7A 1YK7A 3K8UA 1TL9A 1THEA 1EWPA 1YT7A 2AVWA 2R9CA 9PAPA 3E1ZB 4BPVA 2FO5A 3LFYA 2VHFA 4PADA 7PCKA 1XKGA 2VHSA 2HD5A 4BS6A 5CVNB 2NQAA 1GCBA 4YYSA 3RVWA 4KLBA 2DC8A 2GHUA 3M99A 1Q6KA 3I3TA 1CVZA 2R9NA 4QRGA 1AYVA 3S3QA 1CB5A 3H7DA 1YVBA 2NQDB 2R9OA 1U5IA 1MEGA 1PIPA 2BDLA 3IMAA 2AYOA 1NQCA 1ICFA 4Q8GA 3HHAA 2H7JA 4QH6A 3QSDA 3BCNA 5K16A 4FJCA 3KFQA 2G7YA 2WBFX 4FK5A 2YJ8A 2FRAA 3KWBX 2P0RA 3BPFA 3HWNA 3N4CA 4W5CA 4OEMA 2C0YA 1AYUA 3HD3A 2FQ9A 3CH2X 2HH5A 2CB5A 1KHQA 3F5VA 4I07A 5FPWA 1ME4A 5J94A 2P7UA 1PCIA 1HUCB 2O6XA 1ZCMA 1PPNA 1AIMA 4HWYA 2Y6EA 2HHNA 3D6SA 1Y4HA 2JQGR 3BC3A 1O0EA 3MORA 2AUXA 3QJ3A 2HXZA 2Y5BA 4FIPA 4XUIA 3BPMA 3RVVA 3PW3A 1KHPA 3MTNA 2G8JA 3WXFA 4Q8HA 1MS6A 4DMXA 4CZWA 1CQDA 1CJLA 2ACTA 2DCAA 3O1GA 8PCHA 3C9EA 2DJGB 4X6IA 4I04A 2E02A 4P6GA 1U9XA 3PBHA 4PI3A 5EF4A 2IPPB 4AXMA 2CIOA 1VSNA 4W5BA 3MHHA 3P5WA 2DCDA 1M6DA 1F2BA 1NPZA 1BY8A 2YJ2A 1NL6A 4PP1A 5PADA 1PBHA 3IUTA 1SP4B 1PADA 1QMYA 2G6DA 3K24A 1NLJA 2PBHA 3P5VA 1F29A 4X6HA 1CS8A 2OULA 3QT4A 1PPDA 2XU4A 3KWZA 3IV2A 1VJVA 2XU1A 3OF9A 2E03A 1YALA 2PNSA 4X6JA 5JH3A 1PPOA 1BGOA 4YYVA 3AI8A 3BOWA 3BWKA 2DC9A 4OELA 2DZZA 3K9MA 4W4UA 3IEJA 1U9QX 3USVA 1GMYA 3MHSA 3OVZA 1ITOA 3H8CA 3N3KA 3KW9A 3B79A 2PADA 3LXSA 2B1NA 4YYUA 3S3RA 5JA7A 2DCBA 3OVXA 4N8WA 2JQFR 3I06A 4YVAA 4ZUXU 3V6EA 1ATKA 3ERVA 2DZYA 2B1MA 3CBJA 1PE6A 4N4ZA 1GECE 1CTEA 2AIMA 2OP3A 2R9MA 2FUDA 6PADA 4CDFB 1CV8A 1K3BB 1F2CA 1AU3A 4BS5A 1KXRA 5CHTA 3F75A 1A6RA 4XR7A 1QXPA 2G8EA 3KKUA 3KX1A 3H89A 1TLOA 4WA6A 3GCBA 1KFXL 2E00A 5CVMA 3ZUAA 4K7CA 3WXEA 1ZIVA 1Y08A 4YYWA 2YJBA 2XU5A 1CPJA 2PREA 4QRVA 3PDFA 1S4VA 1EWOA 2AUZA 1F2AA 3H6SA 1STFE 5CHVA 1FH0A 4G54A 1PXVA 4YYQA 2R9FA 3H8BA 3N3GA 1SNKA 4MZOA
chains in the Genus database with same CATH superfamily
2ARYA 2OZ2A 4YYRA 1MHWA 3MTVA 1AU2A 2DC6A 1YK8A 4D8IA 2DCCA 4I05A 2FTDA 2F1GA 1TU6A 2P86A 4QBBA 2IBIA 3O0UA 2ATOA 3V6CA 3IFUA 4R3DA 4MI7A 5CVOB 4CDDB 3RVXA 1NB3A 5EZSA 4D8EA 1AU0A 2BDZA 2DC7A 3CH3X 1IWDA 2E01A 1MEMA 2FRQA 4BSQA 4CDCB 3CBKA 1NB5A 2F7DA 1DF0A 5EGWA 1QOLA 4N79A 1EWMA 1GLOA 4AXLA 1BP4A 5F02A 3NHEA 2XU3A 2AS8A 1ME3A 4XZXA 1KFUL 3IOQA 4YV8A 3OF8A 1QDQA 2GFOA 2R6NA 1MIRA 4MSXA 4RY2A 3MP2A 1PPPA 3PRMA 2NQGA 2AYNA 1JQPA 3DF0A 1AECA 3RNVA 4BOQA 1U9WA 2DJFB 4PP2E 1YZBA 4IUMA 3U8EA 1EWLA 1UKFA 1POPA 1AU4A 5A24A 2YJ9A 5E6JA 3TNXA 4QRXA 3OISA 2AU1A 3IHPA 2YJCA 1BQIA 3OQCA 1CSBB 3WXGA 4BQVA 3KSEA 3P5XA 1AYWA 1MDWA 1X9YA 3HHIA 4MZSA 3PNRA 1U9VA 3TMPA 3P5UA 2FT2A 4P6EA 2FYEA 1DEUA 4CDEB 2NQIA 1PVJA 4DMYA 4A5UA 1EF7A 1YK7A 3K8UA 1TL9A 1THEA 1EWPA 1YT7A 2AVWA 2R9CA 3BY4A 9PAPA 3E1ZB 4BPVA 4PT5A 2JRIA 2FO5A 3LFYA 2VHFA 4PADA 1DKIA 7PCKA 3ZNHA 1XKGA 2VHSA 2HD5A 4BS6A 5CVNB 2NQAA 1GCBA 4YYSA 3RVWA 3W30A 4BOPA 4KLBA 2DC8A 2GHUA 3M99A 1Q6KA 3I3TA 1CVZA 2R9NA 4QRGA 1AYVA 3S3QA 4REZA 1CB5A 3H7DA 3C0RA 1YVBA 2NQDB 2R9OA 1U5IA 1MEGA 4ZTBA 1PIPA 2BDLA 3IMAA 2AYOA 4BOUA 1NQCA 1ICFA 4HXDB 4Q8GA 3HHAA 2H7JA 4QH6A 4RF0A 3QSDA 3BCNA 5K16A 4FJCA 3KFQA 2G7YA 2WBFX 4FK5A 2YJ8A 2FRAA 3KWBX 2P0RA 3O65A 3BPFA 3HWNA 3N4CA 4W5CA 4OEMA 2C0YA 4OVZA 1AYUA 3HD3A 2FQ9A 3CH2X 2HH5A 2CB5A 1KHQA 3F5VA 4I07A 2BU3A 5FPWA 1ME4A 5J94A 2P7UA 4RKXA 4BOSA 3W31A 1PCIA 1HUCB 2O6XA 1ZCMA 1PPNA 2JTCA 3PT2A 4GUAA 1AIMA 4HWYA 4D8BA 2J7QA 2Y6EA 2HHNA 3D6SA 2AGAA 1Y4HA 4RF1A 2JQGR 3BC3A 3MJ5A 1O0EA 3MORA 2AUXA 3QJ3A 2HXZA 2Y5BA 4FIPA 4XUIA 3BPMA 3RVVA 3PW3A 1KHPA 3MTNA 3TRKA 2HWKA 2G8JA 3WXFA 4Q8HA 3PHXA 1MS6A 4DMXA 4CZWA 5KO3A 1CQDA 1CJLA 2ACTA 2DCAA 3O1GA 8PCHA 3C9EA 2DJGB 4X6IA 4I04A 2E02A 4P16A 4P6GA 1U9XA 3PBHA 2FE8A 4PI3A 5EF4A 2IPPB 4AXMA 2CIOA 1VSNA 4W5BA 3MHHA 3P5WA 2DCDA 1M6DA 1F2BA 1NPZA 1BY8A 2YJ2A 1NL6A 4PP1A 5PADA 4WURA 1PBHA 3IUTA 1SP4B 1PADA 1QMYA 2G6DA 3K24A 1NLJA 2PBHA 3P5VA 2J7QC 1F29A 5EZQA 4X6HA 1CS8A 2OULA 3QT4A 1PPDA 3PHWA 2XU4A 3KWZA 3BBAA 3IV2A 1VJVA 2XU1A 3OF9A 2E03A 1YALA 2PNSA 4X6JA 5JH3A 1PPOA 1BGOA 4YYVA 3AI8A 3B21A 3BOWA 3BWKA 2DC9A 4OELA 2DZZA 3K9MA 5JZEA 4W4UA 3IEJA 1U9QX 3USVA 1GMYA 3MHSA 3OVZA 2Z84A 2DOSA 1ITOA 3H8CA 3N3KA 3KW9A 3B79A 2PADA 3LXSA 2B1NA 4YYUA 3S3RA 5JA7A 2DCBA 4OVZB 3OVXA 4N8WA 2JQFR 3I06A 4YVAA 4ZUXU 3V6EA 1ATKA 3ERVA 2DZYA 2B1MA 3CBJA 4M0WA 1PE6A 4N4ZA 1GECE 1CTEA 2AIMA 2OP3A 2R9MA 2BTWA 2FUDA 4RNAA 6PADA 3E9SA 4CDFB 1CV8A 1K3BB 1F2CA 1AU3A 4MM3B 4BS5A 1KXRA 5CHTA 3F75A 1A6RA 4IP3A 4XR7A 1QXPA 2G8EA 3KKUA 2BTWB 3KX1A 3H89A 1TLOA 2UZJA 4WA6A 3GCBA 1KFXL 2E00A 5CVMA 3ZUAA 4K7CA 3PRPA 3WXEA 1ZIVA 1Y08A 4YYWA 2YJBA 4OW0A 3PHUA 2XU5A 3BB7A 1CPJA 3PSEA 2PREA 4QRVA 3PDFA 1S4VA 1EWOA 2AUZA 1F2AA 3H6SA 1STFE 5CHVA 1FH0A 4G54A 1PXVA 4YYQA 2R9FA 3H8BA 3N3GA 4BOZA 1SNKA 4MZOA
chains in the Genus database with same CATH topology
2ARYA 2OZ2A 2VFBA 1MHWA 4YYRA 1AU2A 2DC6A 1YK8A 2DCCA 4I05A 2FTDA 2F1GA 3D9WA 1TU6A 2P86A 4QBBA 2IBIA 3O0UA 2ATOA 3V6CA 5CVOB 4CDDB 3RVXA 1NB3A 1AU0A 2BDZA 2DC7A 3CH3X 1IWDA 2E01A 1MEMA 2FRQA 4BSQA 4CDCB 3CBKA 1NB5A 2F7DA 1DF0A 5EGWA 1QOLA 2VFCA 4N79A 1EWMA 1GLOA 4AXLA 1BP4A 5F02A 3NHEA 2XU3A 2AS8A 1ME3A 1KFUL 3IOQA 4YV8A 3OF8A 1QDQA 2GFOA 2R6NA 1MIRA 4MSXA 4RY2A 1PPPA 2NQGA 2AYNA 1JQPA 3DF0A 1AECA 1U9WA 2DJFB 4PP2E 3U8EA 1EWLA 1POPA 1AU4A 5A24A 2YJ9A 3TNXA 4QRXA 3OISA 2AU1A 3IHPA 2YJCA 1BQIA 1GX3A 1CSBB 3WXGA 4BQVA 3KSEA 3P5XA 1AYWA 1MDWA 1X9YA 4MZSA 3HHIA 3PNRA 1U9VA 3P5UA 2FT2A 4P6EA 2FYEA 1DEUA 4CDEB 2NQIA 4DMYA 1EF7A 1YK7A 3K8UA 1TL9A 1THEA 1EWPA 1YT7A 2AVWA 2R9CA 9PAPA 3E1ZB 4BPVA 2FO5A 2BSZA 3LFYA 2VHFA 4PADA 7PCKA 1XKGA 2VHSA 2HD5A 4BS6A 5CVNB 2NQAA 1GCBA 4YYSA 3RVWA 4KLBA 2DC8A 2GHUA 3M99A 1Q6KA 3I3TA 1CVZA 2R9NA 4QRGA 1AYVA 3S3QA 1W4TA 1CB5A 3H7DA 1YVBA 2NQDB 2R9OA 1U5IA 1MEGA 1PIPA 2BDLA 3IMAA 2AYOA 1NQCA 1ICFA 4Q8GA 3HHAA 2H7JA 4QH6A 3QSDA 3BCNA 5K16A 4FJCA 3KFQA 2G7YA 2WBFX 4FK5A 2YJ8A 2FRAA 3KWBX 2P0RA 3BPFA 3HWNA 4BGFA 3N4CA 4W5CA 4OEMA 2C0YA 1AYUA 3HD3A 2FQ9A 3CH2X 2HH5A 2CB5A 1KHQA 3F5VA 4I07A 5FPWA 1ME4A 5J94A 2P7UA 1PCIA 1HUCB 2O6XA 1ZCMA 1PPNA 1AIMA 4HWYA 2Y6EA 2HHNA 3D6SA 1Y4HA 2JQGR 3BC3A 1O0EA 3MORA 2AUXA 3QJ3A 2HXZA 2Y5BA 4FIPA 4XUIA 3BPMA 3RVVA 3PW3A 1KHPA 3MTNA 2G8JA 3WXFA 4Q8HA 1MS6A 4DMXA 4CZWA 1E2TA 1CQDA 1CJLA 2ACTA 2DCAA 3O1GA 8PCHA 3C9EA 2DJGB 4X6IA 4B55A 4I04A 2E02A 4P6GA 1U9XA 3PBHA 4PI3A 5EF4A 2IPPB 4AXMA 2CIOA 1W5RA 1VSNA 4W5BA 3MHHA 3P5WA 2DCDA 1M6DA 1F2BA 1NPZA 1BY8A 2YJ2A 1NL6A 4PP1A 5PADA 1PBHA 3IUTA 1SP4B 1PADA 1QMYA 2G6DA 3K24A 1NLJA 2PBHA 3P5VA 1F29A 4X6HA 1CS8A 2OULA 3QT4A 1PPDA 4GUZA 2XU4A 3KWZA 3IV2A 1VJVA 2XU1A 3OF9A 2E03A 1YALA 2PNSA 4X6JA 5JH3A 1PPOA 1BGOA 4YYVA 4NV8A 3AI8A 3BOWA 3BWKA 2DC9A 3LTWA 4OELA 2DZZA 3K9MA 4W4UA 3IEJA 4NV7A 1U9QX 3USVA 1GMYA 3MHSA 3OVZA 1ITOA 3H8CA 3N3KA 3KW9A 3B79A 2PADA 3LXSA 2B1NA 4YYUA 3S3RA 5JA7A 2DCBA 3OVXA 4N8WA 2JQFR 3I06A 4YVAA 4ZUXU 3V6EA 1ATKA 3ERVA 2DZYA 2B1MA 3CBJA 1PE6A 4N4ZA 1GECE 1CTEA 2AIMA 2OP3A 2R9MA 2FUDA 6PADA 4CDFB 1CV8A 1K3BB 1F2CA 1AU3A 4BS5A 1KXRA 5CHTA 3F75A 1A6RA 4XR7A 1QXPA 2G8EA 3KKUA 3KX1A 4C5PA 3H89A 1TLOA 4WA6A 3GCBA 1KFXL 2E00A 5CVMA 3ZUAA 4K7CA 3WXEA 1ZIVA 1Y08A 4YYWA 2YJBA 1W6FA 2XU5A 1CPJA 2PREA 4QRVA 3PDFA 1S4VA 1EWOA 2AUZA 1F2AA 3H6SA 1STFE 5CHVA 1FH0A 4G54A 1PXVA 4YYQA 2R9FA 3H8BA 3N3GA 1SNKA 4MZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARY A;  2OZ2 A;  4YYR A;  1MHW A;  1AU2 A;  2DC6 A;  1YK8 A;  2DCC A;  4I05 A;  2FTD A;  2F1G A;  1TU6 A;  2P86 A;  4QBB A;  2IBI A;  3O0U A;  2ATO A;  3V6C A;  5CVO B;  4CDD B;  3RVX A;  1NB3 A;  1AU0 A;  2BDZ A;  2DC7 A;  3CH3 X;  1IWD A;  2E01 A;  1MEM A;  2FRQ A;  4BSQ A;  4CDC B;  3CBK A;  1NB5 A;  2F7D A;  1DF0 A;  5EGW A;  1QOL A;  4N79 A;  1EWM A;  1GLO A;  4AXL A;  1BP4 A;  5F02 A;  3NHE A;  2XU3 A;  2AS8 A;  1ME3 A;  1KFU L;  3IOQ A;  4YV8 A;  3OF8 A;  1QDQ A;  2GFO A;  2R6N A;  1MIR A;  4MSX A;  4RY2 A;  1PPP A;  2NQG A;  2AYN A;  1JQP A;  3DF0 A;  1AEC A;  1U9W A;  2DJF B;  4PP2 E;  3U8E A;  1EWL A;  1POP A;  1AU4 A;  5A24 A;  2YJ9 A;  3TNX A;  4QRX A;  3OIS A;  2AU1 A;  3IHP A;  2YJC A;  1BQI A;  1CSB B;  3WXG A;  4BQV A;  3KSE A;  3P5X A;  1AYW A;  1MDW A;  1X9Y A;  4MZS A;  3HHI A;  3PNR A;  1U9V A;  3P5U A;  2FT2 A;  4P6E A;  2FYE A;  1DEU A;  4CDE B;  2NQI A;  4DMY A;  1EF7 A;  1YK7 A;  3K8U A;  1TL9 A;  1THE A;  1EWP A;  1YT7 A;  2AVW A;  2R9C A;  9PAP A;  3E1Z B;  4BPV A;  2FO5 A;  3LFY A;  2VHF A;  4PAD A;  7PCK A;  1XKG A;  2VHS A;  2HD5 A;  4BS6 A;  5CVN B;  2NQA A;  1GCB A;  4YYS A;  3RVW A;  4KLB A;  2DC8 A;  2GHU A;  3M99 A;  1Q6K A;  3I3T A;  1CVZ A;  2R9N A;  4QRG A;  1AYV A;  3S3Q A;  1CB5 A;  3H7D A;  1YVB A;  2NQD B;  2R9O A;  1U5I A;  1MEG A;  1PIP A;  2BDL A;  3IMA A;  2AYO A;  1NQC A;  1ICF A;  4Q8G A;  3HHA A;  2H7J A;  4QH6 A;  3QSD A;  3BCN A;  5K16 A;  4FJC A;  3KFQ A;  2G7Y A;  2WBF X;  4FK5 A;  2YJ8 A;  2FRA A;  3KWB X;  2P0R A;  3BPF A;  3HWN A;  3N4C A;  4W5C A;  4OEM A;  2C0Y A;  1AYU A;  3HD3 A;  2FQ9 A;  3CH2 X;  2HH5 A;  2CB5 A;  1KHQ A;  3F5V A;  4I07 A;  5FPW A;  1ME4 A;  5J94 A;  2P7U A;  1PCI A;  1HUC B;  2O6X A;  1ZCM A;  1PPN A;  1AIM A;  4HWY A;  2Y6E A;  2HHN A;  3D6S A;  1Y4H A;  2JQG R;  3BC3 A;  1O0E A;  3MOR A;  2AUX A;  3QJ3 A;  2HXZ A;  2Y5B A;  4FIP A;  4XUI A;  3BPM A;  3RVV A;  3PW3 A;  1KHP A;  3MTN A;  2G8J A;  3WXF A;  4Q8H A;  1MS6 A;  4DMX A;  4CZW A;  1CQD A;  1CJL A;  2ACT A;  2DCA A;  3O1G A;  8PCH A;  3C9E A;  2DJG B;  4X6I A;  4I04 A;  2E02 A;  4P6G A;  1U9X A;  3PBH A;  4PI3 A;  5EF4 A;  2IPP B;  4AXM A;  2CIO A;  1VSN A;  4W5B A;  3MHH A;  3P5W A;  2DCD A;  1M6D A;  1F2B A;  1NPZ A;  1BY8 A;  2YJ2 A;  1NL6 A;  4PP1 A;  5PAD A;  1PBH A;  3IUT A;  1SP4 B;  1PAD A;  1QMY A;  2G6D A;  3K24 A;  1NLJ A;  2PBH A;  3P5V A;  1F29 A;  4X6H A;  1CS8 A;  2OUL A;  3QT4 A;  1PPD A;  2XU4 A;  3KWZ A;  3IV2 A;  1VJV A;  2XU1 A;  3OF9 A;  2E03 A;  1YAL A;  2PNS A;  4X6J A;  5JH3 A;  1PPO A;  1BGO A;  4YYV A;  3AI8 A;  3BOW A;  3BWK A;  2DC9 A;  4OEL A;  2DZZ A;  3K9M A;  4W4U A;  3IEJ A;  1U9Q X;  3USV A;  1GMY A;  3MHS A;  3OVZ A;  1ITO A;  3H8C A;  3N3K A;  3KW9 A;  3B79 A;  2PAD A;  3LXS A;  2B1N A;  4YYU A;  3S3R A;  5JA7 A;  2DCB A;  3OVX A;  4N8W A;  2JQF R;  3I06 A;  4YVA A;  4ZUX U;  3V6E A;  1ATK A;  3ERV A;  2DZY A;  2B1M A;  3CBJ A;  1PE6 A;  4N4Z A;  1GEC E;  1CTE A;  2AIM A;  2OP3 A;  2R9M A;  2FUD A;  6PAD A;  4CDF B;  1CV8 A;  1K3B B;  1F2C A;  1AU3 A;  4BS5 A;  1KXR A;  5CHT A;  3F75 A;  1A6R A;  4XR7 A;  1QXP A;  2G8E A;  3KKU A;  3KX1 A;  3H89 A;  1TLO A;  4WA6 A;  3GCB A;  1KFX L;  2E00 A;  5CVM A;  3ZUA A;  4K7C A;  3WXE A;  1ZIV A;  1Y08 A;  4YYW A;  2YJB A;  2XU5 A;  1CPJ A;  2PRE A;  4QRV A;  3PDF A;  1S4V A;  1EWO A;  2AUZ A;  1F2A A;  3H6S A;  1STF E;  5CHV A;  1FH0 A;  4G54 A;  1PXV A;  4YYQ A;  2R9F A;  3H8B A;  3N3G A;  1SNK A;  4MZO A; 
#chains in the Genus database with same CATH topology
 2ARY A;  2OZ2 A;  4YYR A;  1MHW A;  3MTV A;  1AU2 A;  2DC6 A;  1YK8 A;  4D8I A;  2DCC A;  4I05 A;  2FTD A;  2F1G A;  1TU6 A;  2P86 A;  4QBB A;  2IBI A;  3O0U A;  2ATO A;  3V6C A;  3IFU A;  4R3D A;  4MI7 A;  5CVO B;  4CDD B;  3RVX A;  1NB3 A;  5EZS A;  4D8E A;  1AU0 A;  2BDZ A;  2DC7 A;  3CH3 X;  1IWD A;  2E01 A;  1MEM A;  2FRQ A;  4BSQ A;  4CDC B;  3CBK A;  1NB5 A;  2F7D A;  1DF0 A;  5EGW A;  1QOL A;  4N79 A;  1EWM A;  1GLO A;  4AXL A;  1BP4 A;  5F02 A;  3NHE A;  2XU3 A;  2AS8 A;  1ME3 A;  4XZX A;  1KFU L;  3IOQ A;  4YV8 A;  3OF8 A;  1QDQ A;  2GFO A;  2R6N A;  1MIR A;  4MSX A;  4RY2 A;  3MP2 A;  1PPP A;  3PRM A;  2NQG A;  2AYN A;  1JQP A;  3DF0 A;  1AEC A;  3RNV A;  4BOQ A;  1U9W A;  2DJF B;  4PP2 E;  1YZB A;  4IUM A;  3U8E A;  1EWL A;  1UKF A;  1POP A;  1AU4 A;  5A24 A;  2YJ9 A;  5E6J A;  3TNX A;  4QRX A;  3OIS A;  2AU1 A;  3IHP A;  2YJC A;  1BQI A;  3OQC A;  1CSB B;  3WXG A;  4BQV A;  3KSE A;  3P5X A;  1AYW A;  1MDW A;  1X9Y A;  3HHI A;  4MZS A;  3PNR A;  1U9V A;  3TMP A;  3P5U A;  2FT2 A;  4P6E A;  2FYE A;  1DEU A;  4CDE B;  2NQI A;  1PVJ A;  4DMY A;  4A5U A;  1EF7 A;  1YK7 A;  3K8U A;  1TL9 A;  1THE A;  1EWP A;  1YT7 A;  2AVW A;  2R9C A;  3BY4 A;  9PAP A;  3E1Z B;  4BPV A;  4PT5 A;  2JRI A;  2FO5 A;  3LFY A;  2VHF A;  4PAD A;  1DKI A;  7PCK A;  3ZNH A;  1XKG A;  2VHS A;  2HD5 A;  4BS6 A;  5CVN B;  2NQA A;  1GCB A;  4YYS A;  3RVW A;  3W30 A;  4BOP A;  4KLB A;  2DC8 A;  2GHU A;  3M99 A;  1Q6K A;  3I3T A;  1CVZ A;  2R9N A;  4QRG A;  1AYV A;  3S3Q A;  4REZ A;  1CB5 A;  3H7D A;  3C0R A;  1YVB A;  2NQD B;  2R9O A;  1U5I A;  1MEG A;  4ZTB A;  1PIP A;  2BDL A;  3IMA A;  2AYO A;  4BOU A;  1NQC A;  1ICF A;  4HXD B;  4Q8G A;  3HHA A;  2H7J A;  4QH6 A;  4RF0 A;  3QSD A;  3BCN A;  5K16 A;  4FJC A;  3KFQ A;  2G7Y A;  2WBF X;  4FK5 A;  2YJ8 A;  2FRA A;  3KWB X;  2P0R A;  3O65 A;  3BPF A;  3HWN A;  3N4C A;  4W5C A;  4OEM A;  2C0Y A;  4OVZ A;  1AYU A;  3HD3 A;  2FQ9 A;  3CH2 X;  2HH5 A;  2CB5 A;  1KHQ A;  3F5V A;  4I07 A;  2BU3 A;  5FPW A;  1ME4 A;  5J94 A;  2P7U A;  4RKX A;  4BOS A;  3W31 A;  1PCI A;  1HUC B;  2O6X A;  1ZCM A;  1PPN A;  2JTC A;  3PT2 A;  4GUA A;  1AIM A;  4HWY A;  4D8B A;  2J7Q A;  2Y6E A;  2HHN A;  3D6S A;  2AGA A;  1Y4H A;  4RF1 A;  2JQG R;  3BC3 A;  3MJ5 A;  1O0E A;  3MOR A;  2AUX A;  3QJ3 A;  2HXZ A;  2Y5B A;  4FIP A;  4XUI A;  3BPM A;  3RVV A;  3PW3 A;  1KHP A;  3MTN A;  3TRK A;  2HWK A;  2G8J A;  3WXF A;  4Q8H A;  3PHX A;  1MS6 A;  4DMX A;  4CZW A;  5KO3 A;  1CQD A;  1CJL A;  2ACT A;  2DCA A;  3O1G A;  8PCH A;  3C9E A;  2DJG B;  4X6I A;  4I04 A;  2E02 A;  4P16 A;  4P6G A;  1U9X A;  3PBH A;  2FE8 A;  4PI3 A;  5EF4 A;  2IPP B;  4AXM A;  2CIO A;  1VSN A;  4W5B A;  3MHH A;  3P5W A;  2DCD A;  1M6D A;  1F2B A;  1NPZ A;  1BY8 A;  2YJ2 A;  1NL6 A;  4PP1 A;  5PAD A;  4WUR A;  1PBH A;  3IUT A;  1SP4 B;  1PAD A;  1QMY A;  2G6D A;  3K24 A;  1NLJ A;  2PBH A;  3P5V A;  2J7Q C;  1F29 A;  5EZQ A;  4X6H A;  1CS8 A;  2OUL A;  3QT4 A;  1PPD A;  3PHW A;  2XU4 A;  3KWZ A;  3BBA A;  3IV2 A;  1VJV A;  2XU1 A;  3OF9 A;  2E03 A;  1YAL A;  2PNS A;  4X6J A;  5JH3 A;  1PPO A;  1BGO A;  4YYV A;  3AI8 A;  3B21 A;  3BOW A;  3BWK A;  2DC9 A;  4OEL A;  2DZZ A;  3K9M A;  5JZE A;  4W4U A;  3IEJ A;  1U9Q X;  3USV A;  1GMY A;  3MHS A;  3OVZ A;  2Z84 A;  2DOS A;  1ITO A;  3H8C A;  3N3K A;  3KW9 A;  3B79 A;  2PAD A;  3LXS A;  2B1N A;  4YYU A;  3S3R A;  5JA7 A;  2DCB A;  4OVZ B;  3OVX A;  4N8W A;  2JQF R;  3I06 A;  4YVA A;  4ZUX U;  3V6E A;  1ATK A;  3ERV A;  2DZY A;  2B1M A;  3CBJ A;  4M0W A;  1PE6 A;  4N4Z A;  1GEC E;  1CTE A;  2AIM A;  2OP3 A;  2R9M A;  2BTW A;  2FUD A;  4RNA A;  6PAD A;  3E9S A;  4CDF B;  1CV8 A;  1K3B B;  1F2C A;  1AU3 A;  4MM3 B;  4BS5 A;  1KXR A;  5CHT A;  3F75 A;  1A6R A;  4IP3 A;  4XR7 A;  1QXP A;  2G8E A;  3KKU A;  2BTW B;  3KX1 A;  3H89 A;  1TLO A;  2UZJ A;  4WA6 A;  3GCB A;  1KFX L;  2E00 A;  5CVM A;  3ZUA A;  4K7C A;  3PRP A;  3WXE A;  1ZIV A;  1Y08 A;  4YYW A;  2YJB A;  4OW0 A;  3PHU A;  2XU5 A;  3BB7 A;  1CPJ A;  3PSE A;  2PRE A;  4QRV A;  3PDF A;  1S4V A;  1EWO A;  2AUZ A;  1F2A A;  3H6S A;  1STF E;  5CHV A;  1FH0 A;  4G54 A;  1PXV A;  4YYQ A;  2R9F A;  3H8B A;  3N3G A;  4BOZ A;  1SNK A;  4MZO A; 
#chains in the Genus database with same CATH homology
 2ARY A;  2OZ2 A;  2VFB A;  1MHW A;  4YYR A;  1AU2 A;  2DC6 A;  1YK8 A;  2DCC A;  4I05 A;  2FTD A;  2F1G A;  3D9W A;  1TU6 A;  2P86 A;  4QBB A;  2IBI A;  3O0U A;  2ATO A;  3V6C A;  5CVO B;  4CDD B;  3RVX A;  1NB3 A;  1AU0 A;  2BDZ A;  2DC7 A;  3CH3 X;  1IWD A;  2E01 A;  1MEM A;  2FRQ A;  4BSQ A;  4CDC B;  3CBK A;  1NB5 A;  2F7D A;  1DF0 A;  5EGW A;  1QOL A;  2VFC A;  4N79 A;  1EWM A;  1GLO A;  4AXL A;  1BP4 A;  5F02 A;  3NHE A;  2XU3 A;  2AS8 A;  1ME3 A;  1KFU L;  3IOQ A;  4YV8 A;  3OF8 A;  1QDQ A;  2GFO A;  2R6N A;  1MIR A;  4MSX A;  4RY2 A;  1PPP A;  2NQG A;  2AYN A;  1JQP A;  3DF0 A;  1AEC A;  1U9W A;  2DJF B;  4PP2 E;  3U8E A;  1EWL A;  1POP A;  1AU4 A;  5A24 A;  2YJ9 A;  3TNX A;  4QRX A;  3OIS A;  2AU1 A;  3IHP A;  2YJC A;  1BQI A;  1GX3 A;  1CSB B;  3WXG A;  4BQV A;  3KSE A;  3P5X A;  1AYW A;  1MDW A;  1X9Y A;  4MZS A;  3HHI A;  3PNR A;  1U9V A;  3P5U A;  2FT2 A;  4P6E A;  2FYE A;  1DEU A;  4CDE B;  2NQI A;  4DMY A;  1EF7 A;  1YK7 A;  3K8U A;  1TL9 A;  1THE A;  1EWP A;  1YT7 A;  2AVW A;  2R9C A;  9PAP A;  3E1Z B;  4BPV A;  2FO5 A;  2BSZ A;  3LFY A;  2VHF A;  4PAD A;  7PCK A;  1XKG A;  2VHS A;  2HD5 A;  4BS6 A;  5CVN B;  2NQA A;  1GCB A;  4YYS A;  3RVW A;  4KLB A;  2DC8 A;  2GHU A;  3M99 A;  1Q6K A;  3I3T A;  1CVZ A;  2R9N A;  4QRG A;  1AYV A;  3S3Q A;  1W4T A;  1CB5 A;  3H7D A;  1YVB A;  2NQD B;  2R9O A;  1U5I A;  1MEG A;  1PIP A;  2BDL A;  3IMA A;  2AYO A;  1NQC A;  1ICF A;  4Q8G A;  3HHA A;  2H7J A;  4QH6 A;  3QSD A;  3BCN A;  5K16 A;  4FJC A;  3KFQ A;  2G7Y A;  2WBF X;  4FK5 A;  2YJ8 A;  2FRA A;  3KWB X;  2P0R A;  3BPF A;  3HWN A;  4BGF A;  3N4C A;  4W5C A;  4OEM A;  2C0Y A;  1AYU A;  3HD3 A;  2FQ9 A;  3CH2 X;  2HH5 A;  2CB5 A;  1KHQ A;  3F5V A;  4I07 A;  5FPW A;  1ME4 A;  5J94 A;  2P7U A;  1PCI A;  1HUC B;  2O6X A;  1ZCM A;  1PPN A;  1AIM A;  4HWY A;  2Y6E A;  2HHN A;  3D6S A;  1Y4H A;  2JQG R;  3BC3 A;  1O0E A;  3MOR A;  2AUX A;  3QJ3 A;  2HXZ A;  2Y5B A;  4FIP A;  4XUI A;  3BPM A;  3RVV A;  3PW3 A;  1KHP A;  3MTN A;  2G8J A;  3WXF A;  4Q8H A;  1MS6 A;  4DMX A;  4CZW A;  1E2T A;  1CQD A;  1CJL A;  2ACT A;  2DCA A;  3O1G A;  8PCH A;  3C9E A;  2DJG B;  4X6I A;  4B55 A;  4I04 A;  2E02 A;  4P6G A;  1U9X A;  3PBH A;  4PI3 A;  5EF4 A;  2IPP B;  4AXM A;  2CIO A;  1W5R A;  1VSN A;  4W5B A;  3MHH A;  3P5W A;  2DCD A;  1M6D A;  1F2B A;  1NPZ A;  1BY8 A;  2YJ2 A;  1NL6 A;  4PP1 A;  5PAD A;  1PBH A;  3IUT A;  1SP4 B;  1PAD A;  1QMY A;  2G6D A;  3K24 A;  1NLJ A;  2PBH A;  3P5V A;  1F29 A;  4X6H A;  1CS8 A;  2OUL A;  3QT4 A;  1PPD A;  4GUZ A;  2XU4 A;  3KWZ A;  3IV2 A;  1VJV A;  2XU1 A;  3OF9 A;  2E03 A;  1YAL A;  2PNS A;  4X6J A;  5JH3 A;  1PPO A;  1BGO A;  4YYV A;  4NV8 A;  3AI8 A;  3BOW A;  3BWK A;  2DC9 A;  3LTW A;  4OEL A;  2DZZ A;  3K9M A;  4W4U A;  3IEJ A;  4NV7 A;  1U9Q X;  3USV A;  1GMY A;  3MHS A;  3OVZ A;  1ITO A;  3H8C A;  3N3K A;  3KW9 A;  3B79 A;  2PAD A;  3LXS A;  2B1N A;  4YYU A;  3S3R A;  5JA7 A;  2DCB A;  3OVX A;  4N8W A;  2JQF R;  3I06 A;  4YVA A;  4ZUX U;  3V6E A;  1ATK A;  3ERV A;  2DZY A;  2B1M A;  3CBJ A;  1PE6 A;  4N4Z A;  1GEC E;  1CTE A;  2AIM A;  2OP3 A;  2R9M A;  2FUD A;  6PAD A;  4CDF B;  1CV8 A;  1K3B B;  1F2C A;  1AU3 A;  4BS5 A;  1KXR A;  5CHT A;  3F75 A;  1A6R A;  4XR7 A;  1QXP A;  2G8E A;  3KKU A;  3KX1 A;  4C5P A;  3H89 A;  1TLO A;  4WA6 A;  3GCB A;  1KFX L;  2E00 A;  5CVM A;  3ZUA A;  4K7C A;  3WXE A;  1ZIV A;  1Y08 A;  4YYW A;  2YJB A;  1W6F A;  2XU5 A;  1CPJ A;  2PRE A;  4QRV A;  3PDF A;  1S4V A;  1EWO A;  2AUZ A;  1F2A A;  3H6S A;  1STF E;  5CHV A;  1FH0 A;  4G54 A;  1PXV A;  4YYQ A;  2R9F A;  3H8B A;  3N3G A;  1SNK A;  4MZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...