3O1GA

Cathepsin k covalently bound to a 2-cyano pyrimidine inhibitor with a benzyl p3 group.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o1gA00
3PNRA 2Y5BA 3QSDA 2F7DA 3KKUA 4QRGA 1PPOA 3BC3A 1AU2A 1F2AA 1FH0A 1K3BB 4I05A 1AECA 1CB5A 3IOQA 5FPWA 3OVZA 3BCNA 4YYVA 2P0RA 3PW3A 1GCBA 2C0YA 2JQGR 4DMYA 1QXPA 2AVWA 2AS8A 5CVNB 3K9MA 1STFE 1VSNA 3BPMA 4XUIA 3H89A 2ATOA 2R9CA 2HXZA 3O1GA 2B1NA 1Y08A 1TL9A 3KW9A 2AYOA 5JH3A 3MORA 4P6GA 1PXVA 2DCCA 3LFYA 2Y6EA 1CQDA 2JQFR 5CHVA 2DCAA 1YK7A 2CB5A 2YJ9A 4N4ZA 2FRAA 2HD5A 1KFXL 1NB5A 1VJVA 1U9QX 4PADA 4N8WA 2FTDA 2BDZA 3HD3A 4PP1A 8PCHA 2GHUA 1NQCA 2XU1A 3BPFA 3KWZA 4FK5A 2G7YA 3K24A 4QRVA 3DF0A 1GECE 2FRQA 1DEUA 2OP3A 3ERVA 4AXLA 3IV2A 1F2CA 7PCKA 4YYUA 2O6XA 1ICFA 3KFQA 2OZ2A 2AU1A 1JQPA 3PDFA 2DZYA 1PPDA 2AYNA 1CVZA 4YVAA 1A6RA 2FT2A 2P86A 1KXRA 4Q8HA 1CS8A 5JA7A 3MHSA 2E03A 1NL6A 3IMAA 3RVWA 5CVOB 4QH6A 3S3QA 2FUDA 4QRXA 2PADA 5PADA 2HHNA 1HUCB 2OULA 1YK8A 4WA6A 2P7UA 1MEMA 4N79A 3BWKA 3C9EA 4CDDB 2E00A 3K8UA 5A24A 3QJ3A 2FQ9A 2FYEA 2XU4A 3H8CA 2G8JA 3O0UA 4K7CA 3U8EA 3BOWA 3IUTA 2YJCA 1AYVA 2DC6A 1AU4A 2DJFB 2R9OA 2VHFA 1ME4A 3OVXA 2DCBA 1NB3A 3QT4A 3HWNA 2BDLA 3GCBA 3HHIA 4BSQA 4AXMA 5CHTA 2PNSA 4CDFB 3CBJA 3I06A 4ZUXU 3B79A 1BQIA 4BQVA 2DZZA 1PBHA 4YV8A 2PREA 1MEGA 1U9XA 2YJ8A 3H8BA 1KHQA 3WXEA 4I04A 2NQGA 4CDCB 3V6CA 3N3KA 3IEJA 2FO5A 2DC7A 4FJCA 2E02A 3P5VA 1PPNA 1POPA 3M99A 3P5UA 2YJBA 1AIMA 4I07A 1ME3A 1KHPA 2HH5A 2F1GA 3KSEA 5F02A 4RY2A 1DF0A 1X9YA 2G6DA 2PBHA 3V6EA 1F2BA 4CZWA 3OF9A 4BPVA 1Q6KA 2AUXA 5J94A 3MTNA 1U9VA 1MS6A 1PE6A 3I3TA 3MHHA 3P5WA 3ZUAA 1AYUA 2IBIA 1EWMA 1NPZA 1QMYA 4YYQA 3OISA 2WBFX 3IHPA 2E01A 1PIPA 1U9WA 4X6IA 1Y4HA 1PCIA 3E1ZB 4W5CA 1XKGA 4FIPA 3P5XA 3WXFA 4BS5A 3H6SA 4DMXA 3RVVA 3LXSA 1EWPA 1PADA 2NQDB 1ITOA 3WXGA 5EF4A 1IWDA 3N3GA 4YYSA 1YALA 2XU5A 2CIOA 2ARYA 5CVMA 2NQAA 3NHEA 2NQIA 2R9FA 1NLJA 1SNKA 1EF7A 1EWLA 4YYWA 3CH2X 1S4VA 1THEA 3RVXA 3TNXA 3KX1A 1TU6A 3AI8A 3CBKA 2YJ2A 1KFUL 2DC8A 4CDEB 4MZSA 3USVA 3N4CA 1M6DA 1CSBB 4MSXA 4OELA 1GLOA 2B1MA 3OF8A 1MHWA 1QDQA 2R9MA 1MDWA 1AYWA 1ZCMA 4KLBA 2DJGB 4Q8GA 1BGOA 4PI3A 1F29A 3D6SA 3F75A 2XU3A 1YVBA 4X6JA 3HHAA 1QOLA 1SP4B 4BS6A 1CTEA 3KWBX 1MIRA 5EGWA 4G54A 4YYRA 1ZIVA 1U5IA 2G8EA 3F5VA 4MZOA 1ATKA 1AU0A 2H7JA 4OEMA 2VHSA 4HWYA 3S3RA 4PP2E 1GMYA 1CPJA 4P6EA 1PPPA 1YT7A 2GFOA 4XR7A 9PAPA 4W5BA 6PADA 3PBHA 4W4UA 3CH3X 2IPPB 2R9NA 1CJLA 4QBBA 1BP4A 2AIMA 2R6NA 2DC9A 1TLOA 2ACTA 1CV8A 2DCDA 1O0EA 4X6HA 2AUZA 1BY8A 5K16A 1EWOA 1AU3A 3H7DA
chains in the Genus database with same CATH superfamily
3PNRA 2Y5BA 3QSDA 2F7DA 3KKUA 1DKIA 3BY4A 5KO3A 4QRGA 4BOUA 1PPOA 3BC3A 1AU2A 1F2AA 1FH0A 1K3BB 4I05A 2J7QC 1AECA 1CB5A 3IOQA 5FPWA 1YZBA 3OVZA 3BCNA 4YYVA 3PSEA 2P0RA 3PW3A 1GCBA 2C0YA 2JQGR 4DMYA 1QXPA 2AVWA 2AS8A 5CVNB 4BOSA 3K9MA 1STFE 1VSNA 3BPMA 4XUIA 3H89A 2ATOA 2R9CA 2HXZA 3O1GA 2B1NA 3PHUA 1Y08A 1TL9A 3KW9A 2AYOA 5JH3A 3MORA 4P6GA 1PXVA 2DCCA 3LFYA 2Y6EA 4D8EA 1CQDA 2JQFR 5CHVA 2DCAA 1YK7A 2CB5A 2YJ9A 4N4ZA 2FRAA 2HD5A 1KFXL 1NB5A 1VJVA 1U9QX 4PADA 4N8WA 2FTDA 2BDZA 3HD3A 4WURA 4PP1A 3TMPA 8PCHA 2GHUA 3MJ5A 1NQCA 2XU1A 3BPFA 3KWZA 4FK5A 2G7YA 3K24A 4QRVA 3PRMA 3DF0A 1GECE 2FRQA 1DEUA 2OP3A 3ERVA 4AXLA 3IV2A 1F2CA 7PCKA 4YYUA 4BOPA 2O6XA 4BOQA 1ICFA 3KFQA 2OZ2A 2AU1A 2HWKA 1JQPA 3PDFA 4REZA 4RKXA 2DZYA 1PPDA 2AYNA 1CVZA 3W30A 2BU3A 4YVAA 1A6RA 2FT2A 2P86A 1KXRA 4Q8HA 1CS8A 5JA7A 3MHSA 2E03A 3IFUA 1NL6A 3IMAA 3RVWA 5CVOB 2DOSA 4QH6A 3S3QA 5JZEA 3B21A 2FUDA 4QRXA 2PADA 5PADA 2HHNA 1HUCB 3PHXA 2OULA 1YK8A 4WA6A 3C0RA 2P7UA 1MEMA 3PRPA 4N79A 3BWKA 3C9EA 4CDDB 2E00A 3K8UA 5A24A 3QJ3A 2FQ9A 2FYEA 2XU4A 3H8CA 2G8JA 3O0UA 4K7CA 3U8EA 3BBAA 3BOWA 3IUTA 2YJCA 1AYVA 2DC6A 4P16A 1AU4A 2DJFB 2R9OA 2VHFA 1ME4A 3OVXA 2DCBA 1NB3A 4D8IA 3QT4A 2FE8A 3W31A 3HWNA 2BDLA 3GCBA 3HHIA 4A5UA 4BSQA 4AXMA 5CHTA 2PNSA 4CDFB 3CBJA 3I06A 4ZUXU 3B79A 1BQIA 4BQVA 2DZZA 1PBHA 4YV8A 2PREA 4IP3A 4XZXA 3E9SA 1MEGA 1U9XA 2YJ8A 3H8BA 1KHQA 4M0WA 4HXDB 3WXEA 4I04A 2NQGA 4CDCB 3V6CA 3N3KA 3IEJA 2FO5A 2DC7A 4FJCA 2E02A 3P5VA 1PPNA 1POPA 3M99A 3P5UA 2J7QA 2YJBA 4R3DA 1AIMA 4I07A 1ME3A 1KHPA 2HH5A 3BB7A 2F1GA 5EZSA 3KSEA 5F02A 4RY2A 1DF0A 1X9YA 2G6DA 2PBHA 3V6EA 1F2BA 4CZWA 3OF9A 4BPVA 1Q6KA 2AUXA 5J94A 3MTNA 1U9VA 1MS6A 1PE6A 3I3TA 3MHHA 3P5WA 3ZNHA 3ZUAA 2UZJA 1AYUA 2IBIA 1EWMA 1NPZA 1QMYA 4RNAA 4YYQA 3OISA 3OQCA 2WBFX 3IHPA 2E01A 1PIPA 1U9WA 4X6IA 1UKFA 1Y4HA 1PCIA 3E1ZB 4W5CA 4ZTBA 4MI7A 1XKGA 4FIPA 3P5XA 3WXFA 3PT2A 4BS5A 3H6SA 4MM3B 4DMXA 3RVVA 3LXSA 1EWPA 4GUAA 1PADA 2NQDB 1ITOA 3WXGA 5EF4A 3MP2A 1IWDA 3N3GA 4YYSA 1YALA 2XU5A 2CIOA 2ARYA 5CVMA 2NQAA 3NHEA 2NQIA 2R9FA 1NLJA 1SNKA 1EF7A 2BTWA 1EWLA 4YYWA 3CH2X 1S4VA 1THEA 3RVXA 3TNXA 3KX1A 1TU6A 3AI8A 2AGAA 3CBKA 2YJ2A 1KFUL 2DC8A 4CDEB 3RNVA 4MZSA 3TRKA 3USVA 3N4CA 1M6DA 1CSBB 4MSXA 4OELA 1GLOA 2B1MA 3OF8A 1MHWA 1QDQA 2R9MA 1MDWA 1AYWA 1ZCMA 4KLBA 2BTWB 2DJGB 4Q8GA 1BGOA 4OW0A 4PI3A 4RF0A 1F29A 3D6SA 3F75A 4BOZA 2XU3A 1YVBA 4X6JA 3HHAA 1QOLA 1SP4B 3MTVA 4BS6A 3O65A 1CTEA 5E6JA 3KWBX 4RF1A 1MIRA 5EGWA 4G54A 4YYRA 1ZIVA 1U5IA 2G8EA 3F5VA 4MZOA 1ATKA 4OVZA 5EZQA 1AU0A 2H7JA 4OEMA 2VHSA 4HWYA 3PHWA 3S3RA 4PP2E 1GMYA 1CPJA 4P6EA 4D8BA 1PPPA 1YT7A 2GFOA 4XR7A 9PAPA 4W5BA 6PADA 3PBHA 4W4UA 3CH3X 2IPPB 2R9NA 2Z84A 4OVZB 1CJLA 4QBBA 1BP4A 2AIMA 2R6NA 2DC9A 1TLOA 2ACTA 1PVJA 1CV8A 4PT5A 2DCDA 2JTCA 1O0EA 4X6HA 2AUZA 1BY8A 5K16A 1EWOA 2JRIA 1AU3A 3H7DA 4IUMA
chains in the Genus database with same CATH topology
3PNRA 2Y5BA 3QSDA 2F7DA 3KKUA 4NV7A 1W6FA 4QRGA 1PPOA 3BC3A 1AU2A 1F2AA 1FH0A 1K3BB 4I05A 1AECA 1CB5A 3IOQA 5FPWA 3OVZA 3BCNA 4YYVA 2P0RA 3PW3A 1GCBA 2C0YA 2JQGR 4DMYA 1QXPA 2AVWA 2AS8A 5CVNB 3K9MA 1STFE 1VSNA 3BPMA 4XUIA 3H89A 2ATOA 2R9CA 2HXZA 3O1GA 2B1NA 1Y08A 1TL9A 3KW9A 2AYOA 5JH3A 3MORA 4P6GA 1PXVA 2DCCA 3LFYA 2Y6EA 1CQDA 2JQFR 5CHVA 2DCAA 1YK7A 2CB5A 2YJ9A 4N4ZA 2FRAA 2HD5A 1KFXL 1NB5A 1VJVA 1U9QX 4PADA 4N8WA 2FTDA 2BDZA 3HD3A 4PP1A 8PCHA 2GHUA 1NQCA 1E2TA 2XU1A 3BPFA 3KWZA 4FK5A 2G7YA 3K24A 4QRVA 3DF0A 4NV8A 1GECE 2FRQA 1DEUA 2OP3A 3ERVA 4AXLA 3IV2A 1F2CA 7PCKA 4YYUA 2O6XA 1ICFA 3KFQA 2OZ2A 2AU1A 1JQPA 3PDFA 2DZYA 1PPDA 2AYNA 1CVZA 4YVAA 1A6RA 2FT2A 2P86A 1KXRA 4Q8HA 1CS8A 5JA7A 3MHSA 2E03A 1NL6A 3IMAA 3RVWA 5CVOB 4QH6A 3S3QA 2FUDA 4QRXA 2PADA 5PADA 2HHNA 1HUCB 2OULA 1YK8A 4WA6A 2P7UA 1MEMA 4GUZA 4N79A 3BWKA 3C9EA 4CDDB 2E00A 3K8UA 5A24A 3QJ3A 2FQ9A 2FYEA 2XU4A 3H8CA 2G8JA 3O0UA 4K7CA 3U8EA 3BOWA 3IUTA 2YJCA 1AYVA 2DC6A 1AU4A 2DJFB 2R9OA 2VHFA 1ME4A 3OVXA 2DCBA 1NB3A 3QT4A 3HWNA 2BDLA 3GCBA 3HHIA 4BSQA 4AXMA 5CHTA 2PNSA 4CDFB 3CBJA 3I06A 4ZUXU 3B79A 1BQIA 4BQVA 2DZZA 1PBHA 4YV8A 2PREA 1MEGA 4B55A 1U9XA 2YJ8A 3H8BA 1KHQA 3WXEA 4I04A 2NQGA 4CDCB 3V6CA 3N3KA 3IEJA 2FO5A 2DC7A 4FJCA 2E02A 3P5VA 1PPNA 1POPA 3M99A 3P5UA 2YJBA 1AIMA 4I07A 1ME3A 1KHPA 2HH5A 2F1GA 3LTWA 3KSEA 5F02A 4RY2A 1DF0A 1X9YA 2G6DA 2PBHA 3V6EA 1F2BA 4CZWA 3OF9A 4BPVA 1Q6KA 2AUXA 5J94A 3MTNA 1U9VA 1MS6A 1PE6A 3I3TA 3MHHA 3P5WA 3ZUAA 1AYUA 2IBIA 1EWMA 1NPZA 1QMYA 4YYQA 3OISA 2WBFX 3IHPA 2E01A 1PIPA 1U9WA 4X6IA 1Y4HA 1W5RA 1PCIA 3E1ZB 4W5CA 1XKGA 4FIPA 3P5XA 3WXFA 4BS5A 3H6SA 4DMXA 3RVVA 3LXSA 1EWPA 1PADA 2NQDB 1ITOA 3WXGA 5EF4A 1IWDA 3N3GA 4YYSA 1YALA 2XU5A 2CIOA 2ARYA 5CVMA 2NQAA 3NHEA 2NQIA 2R9FA 1NLJA 1SNKA 1EF7A 1EWLA 4YYWA 3CH2X 1S4VA 1THEA 3RVXA 3TNXA 3KX1A 1TU6A 3AI8A 3CBKA 2YJ2A 1KFUL 2DC8A 4CDEB 4MZSA 3USVA 3N4CA 1M6DA 1CSBB 1W4TA 4MSXA 4OELA 1GLOA 2B1MA 3OF8A 1MHWA 1QDQA 2R9MA 1MDWA 2BSZA 1AYWA 1ZCMA 4KLBA 2DJGB 4Q8GA 1BGOA 4PI3A 1F29A 3D6SA 3F75A 2XU3A 1YVBA 4X6JA 3HHAA 1QOLA 1SP4B 4BS6A 1CTEA 3KWBX 1MIRA 5EGWA 4G54A 4YYRA 1ZIVA 1U5IA 2G8EA 2VFCA 3F5VA 4MZOA 1ATKA 1GX3A 3D9WA 1AU0A 2H7JA 4OEMA 2VHSA 4HWYA 3S3RA 2VFBA 4PP2E 1GMYA 1CPJA 4P6EA 1PPPA 4BGFA 1YT7A 2GFOA 4XR7A 9PAPA 4W5BA 6PADA 3PBHA 4W4UA 3CH3X 2IPPB 2R9NA 1CJLA 4QBBA 1BP4A 2AIMA 2R6NA 2DC9A 1TLOA 2ACTA 1CV8A 4C5PA 2DCDA 1O0EA 4X6HA 2AUZA 1BY8A 5K16A 1EWOA 1AU3A 3H7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNR A;  2Y5B A;  3QSD A;  2F7D A;  3KKU A;  4QRG A;  1PPO A;  3BC3 A;  1AU2 A;  1F2A A;  1FH0 A;  1K3B B;  4I05 A;  1AEC A;  1CB5 A;  3IOQ A;  5FPW A;  3OVZ A;  3BCN A;  4YYV A;  2P0R A;  3PW3 A;  1GCB A;  2C0Y A;  2JQG R;  4DMY A;  1QXP A;  2AVW A;  2AS8 A;  5CVN B;  3K9M A;  1STF E;  1VSN A;  3BPM A;  4XUI A;  3H89 A;  2ATO A;  2R9C A;  2HXZ A;  3O1G A;  2B1N A;  1Y08 A;  1TL9 A;  3KW9 A;  2AYO A;  5JH3 A;  3MOR A;  4P6G A;  1PXV A;  2DCC A;  3LFY A;  2Y6E A;  1CQD A;  2JQF R;  5CHV A;  2DCA A;  1YK7 A;  2CB5 A;  2YJ9 A;  4N4Z A;  2FRA A;  2HD5 A;  1KFX L;  1NB5 A;  1VJV A;  1U9Q X;  4PAD A;  4N8W A;  2FTD A;  2BDZ A;  3HD3 A;  4PP1 A;  8PCH A;  2GHU A;  1NQC A;  2XU1 A;  3BPF A;  3KWZ A;  4FK5 A;  2G7Y A;  3K24 A;  4QRV A;  3DF0 A;  1GEC E;  2FRQ A;  1DEU A;  2OP3 A;  3ERV A;  4AXL A;  3IV2 A;  1F2C A;  7PCK A;  4YYU A;  2O6X A;  1ICF A;  3KFQ A;  2OZ2 A;  2AU1 A;  1JQP A;  3PDF A;  2DZY A;  1PPD A;  2AYN A;  1CVZ A;  4YVA A;  1A6R A;  2FT2 A;  2P86 A;  1KXR A;  4Q8H A;  1CS8 A;  5JA7 A;  3MHS A;  2E03 A;  1NL6 A;  3IMA A;  3RVW A;  5CVO B;  4QH6 A;  3S3Q A;  2FUD A;  4QRX A;  2PAD A;  5PAD A;  2HHN A;  1HUC B;  2OUL A;  1YK8 A;  4WA6 A;  2P7U A;  1MEM A;  4N79 A;  3BWK A;  3C9E A;  4CDD B;  2E00 A;  3K8U A;  5A24 A;  3QJ3 A;  2FQ9 A;  2FYE A;  2XU4 A;  3H8C A;  2G8J A;  3O0U A;  4K7C A;  3U8E A;  3BOW A;  3IUT A;  2YJC A;  1AYV A;  2DC6 A;  1AU4 A;  2DJF B;  2R9O A;  2VHF A;  1ME4 A;  3OVX A;  2DCB A;  1NB3 A;  3QT4 A;  3HWN A;  2BDL A;  3GCB A;  3HHI A;  4BSQ A;  4AXM A;  5CHT A;  2PNS A;  4CDF B;  3CBJ A;  3I06 A;  4ZUX U;  3B79 A;  1BQI A;  4BQV A;  2DZZ A;  1PBH A;  4YV8 A;  2PRE A;  1MEG A;  1U9X A;  2YJ8 A;  3H8B A;  1KHQ A;  3WXE A;  4I04 A;  2NQG A;  4CDC B;  3V6C A;  3N3K A;  3IEJ A;  2FO5 A;  2DC7 A;  4FJC A;  2E02 A;  3P5V A;  1PPN A;  1POP A;  3M99 A;  3P5U A;  2YJB A;  1AIM A;  4I07 A;  1ME3 A;  1KHP A;  2HH5 A;  2F1G A;  3KSE A;  5F02 A;  4RY2 A;  1DF0 A;  1X9Y A;  2G6D A;  2PBH A;  3V6E A;  1F2B A;  4CZW A;  3OF9 A;  4BPV A;  1Q6K A;  2AUX A;  5J94 A;  3MTN A;  1U9V A;  1MS6 A;  1PE6 A;  3I3T A;  3MHH A;  3P5W A;  3ZUA A;  1AYU A;  2IBI A;  1EWM A;  1NPZ A;  1QMY A;  4YYQ A;  3OIS A;  2WBF X;  3IHP A;  2E01 A;  1PIP A;  1U9W A;  4X6I A;  1Y4H A;  1PCI A;  3E1Z B;  4W5C A;  1XKG A;  4FIP A;  3P5X A;  3WXF A;  4BS5 A;  3H6S A;  4DMX A;  3RVV A;  3LXS A;  1EWP A;  1PAD A;  2NQD B;  1ITO A;  3WXG A;  5EF4 A;  1IWD A;  3N3G A;  4YYS A;  1YAL A;  2XU5 A;  2CIO A;  2ARY A;  5CVM A;  2NQA A;  3NHE A;  2NQI A;  2R9F A;  1NLJ A;  1SNK A;  1EF7 A;  1EWL A;  4YYW A;  3CH2 X;  1S4V A;  1THE A;  3RVX A;  3TNX A;  3KX1 A;  1TU6 A;  3AI8 A;  3CBK A;  2YJ2 A;  1KFU L;  2DC8 A;  4CDE B;  4MZS A;  3USV A;  3N4C A;  1M6D A;  1CSB B;  4MSX A;  4OEL A;  1GLO A;  2B1M A;  3OF8 A;  1MHW A;  1QDQ A;  2R9M A;  1MDW A;  1AYW A;  1ZCM A;  4KLB A;  2DJG B;  4Q8G A;  1BGO A;  4PI3 A;  1F29 A;  3D6S A;  3F75 A;  2XU3 A;  1YVB A;  4X6J A;  3HHA A;  1QOL A;  1SP4 B;  4BS6 A;  1CTE A;  3KWB X;  1MIR A;  5EGW A;  4G54 A;  4YYR A;  1ZIV A;  1U5I A;  2G8E A;  3F5V A;  4MZO A;  1ATK A;  1AU0 A;  2H7J A;  4OEM A;  2VHS A;  4HWY A;  3S3R A;  4PP2 E;  1GMY A;  1CPJ A;  4P6E A;  1PPP A;  1YT7 A;  2GFO A;  4XR7 A;  9PAP A;  4W5B A;  6PAD A;  3PBH A;  4W4U A;  3CH3 X;  2IPP B;  2R9N A;  1CJL A;  4QBB A;  1BP4 A;  2AIM A;  2R6N A;  2DC9 A;  1TLO A;  2ACT A;  1CV8 A;  2DCD A;  1O0E A;  4X6H A;  2AUZ A;  1BY8 A;  5K16 A;  1EWO A;  1AU3 A;  3H7D A; 
#chains in the Genus database with same CATH topology
 3PNR A;  2Y5B A;  3QSD A;  2F7D A;  3KKU A;  1DKI A;  3BY4 A;  5KO3 A;  4QRG A;  4BOU A;  1PPO A;  3BC3 A;  1AU2 A;  1F2A A;  1FH0 A;  1K3B B;  4I05 A;  2J7Q C;  1AEC A;  1CB5 A;  3IOQ A;  5FPW A;  1YZB A;  3OVZ A;  3BCN A;  4YYV A;  3PSE A;  2P0R A;  3PW3 A;  1GCB A;  2C0Y A;  2JQG R;  4DMY A;  1QXP A;  2AVW A;  2AS8 A;  5CVN B;  4BOS A;  3K9M A;  1STF E;  1VSN A;  3BPM A;  4XUI A;  3H89 A;  2ATO A;  2R9C A;  2HXZ A;  3O1G A;  2B1N A;  3PHU A;  1Y08 A;  1TL9 A;  3KW9 A;  2AYO A;  5JH3 A;  3MOR A;  4P6G A;  1PXV A;  2DCC A;  3LFY A;  2Y6E A;  4D8E A;  1CQD A;  2JQF R;  5CHV A;  2DCA A;  1YK7 A;  2CB5 A;  2YJ9 A;  4N4Z A;  2FRA A;  2HD5 A;  1KFX L;  1NB5 A;  1VJV A;  1U9Q X;  4PAD A;  4N8W A;  2FTD A;  2BDZ A;  3HD3 A;  4WUR A;  4PP1 A;  3TMP A;  8PCH A;  2GHU A;  3MJ5 A;  1NQC A;  2XU1 A;  3BPF A;  3KWZ A;  4FK5 A;  2G7Y A;  3K24 A;  4QRV A;  3PRM A;  3DF0 A;  1GEC E;  2FRQ A;  1DEU A;  2OP3 A;  3ERV A;  4AXL A;  3IV2 A;  1F2C A;  7PCK A;  4YYU A;  4BOP A;  2O6X A;  4BOQ A;  1ICF A;  3KFQ A;  2OZ2 A;  2AU1 A;  2HWK A;  1JQP A;  3PDF A;  4REZ A;  4RKX A;  2DZY A;  1PPD A;  2AYN A;  1CVZ A;  3W30 A;  2BU3 A;  4YVA A;  1A6R A;  2FT2 A;  2P86 A;  1KXR A;  4Q8H A;  1CS8 A;  5JA7 A;  3MHS A;  2E03 A;  3IFU A;  1NL6 A;  3IMA A;  3RVW A;  5CVO B;  2DOS A;  4QH6 A;  3S3Q A;  5JZE A;  3B21 A;  2FUD A;  4QRX A;  2PAD A;  5PAD A;  2HHN A;  1HUC B;  3PHX A;  2OUL A;  1YK8 A;  4WA6 A;  3C0R A;  2P7U A;  1MEM A;  3PRP A;  4N79 A;  3BWK A;  3C9E A;  4CDD B;  2E00 A;  3K8U A;  5A24 A;  3QJ3 A;  2FQ9 A;  2FYE A;  2XU4 A;  3H8C A;  2G8J A;  3O0U A;  4K7C A;  3U8E A;  3BBA A;  3BOW A;  3IUT A;  2YJC A;  1AYV A;  2DC6 A;  4P16 A;  1AU4 A;  2DJF B;  2R9O A;  2VHF A;  1ME4 A;  3OVX A;  2DCB A;  1NB3 A;  4D8I A;  3QT4 A;  2FE8 A;  3W31 A;  3HWN A;  2BDL A;  3GCB A;  3HHI A;  4A5U A;  4BSQ A;  4AXM A;  5CHT A;  2PNS A;  4CDF B;  3CBJ A;  3I06 A;  4ZUX U;  3B79 A;  1BQI A;  4BQV A;  2DZZ A;  1PBH A;  4YV8 A;  2PRE A;  4IP3 A;  4XZX A;  3E9S A;  1MEG A;  1U9X A;  2YJ8 A;  3H8B A;  1KHQ A;  4M0W A;  4HXD B;  3WXE A;  4I04 A;  2NQG A;  4CDC B;  3V6C A;  3N3K A;  3IEJ A;  2FO5 A;  2DC7 A;  4FJC A;  2E02 A;  3P5V A;  1PPN A;  1POP A;  3M99 A;  3P5U A;  2J7Q A;  2YJB A;  4R3D A;  1AIM A;  4I07 A;  1ME3 A;  1KHP A;  2HH5 A;  3BB7 A;  2F1G A;  5EZS A;  3KSE A;  5F02 A;  4RY2 A;  1DF0 A;  1X9Y A;  2G6D A;  2PBH A;  3V6E A;  1F2B A;  4CZW A;  3OF9 A;  4BPV A;  1Q6K A;  2AUX A;  5J94 A;  3MTN A;  1U9V A;  1MS6 A;  1PE6 A;  3I3T A;  3MHH A;  3P5W A;  3ZNH A;  3ZUA A;  2UZJ A;  1AYU A;  2IBI A;  1EWM A;  1NPZ A;  1QMY A;  4RNA A;  4YYQ A;  3OIS A;  3OQC A;  2WBF X;  3IHP A;  2E01 A;  1PIP A;  1U9W A;  4X6I A;  1UKF A;  1Y4H A;  1PCI A;  3E1Z B;  4W5C A;  4ZTB A;  4MI7 A;  1XKG A;  4FIP A;  3P5X A;  3WXF A;  3PT2 A;  4BS5 A;  3H6S A;  4MM3 B;  4DMX A;  3RVV A;  3LXS A;  1EWP A;  4GUA A;  1PAD A;  2NQD B;  1ITO A;  3WXG A;  5EF4 A;  3MP2 A;  1IWD A;  3N3G A;  4YYS A;  1YAL A;  2XU5 A;  2CIO A;  2ARY A;  5CVM A;  2NQA A;  3NHE A;  2NQI A;  2R9F A;  1NLJ A;  1SNK A;  1EF7 A;  2BTW A;  1EWL A;  4YYW A;  3CH2 X;  1S4V A;  1THE A;  3RVX A;  3TNX A;  3KX1 A;  1TU6 A;  3AI8 A;  2AGA A;  3CBK A;  2YJ2 A;  1KFU L;  2DC8 A;  4CDE B;  3RNV A;  4MZS A;  3TRK A;  3USV A;  3N4C A;  1M6D A;  1CSB B;  4MSX A;  4OEL A;  1GLO A;  2B1M A;  3OF8 A;  1MHW A;  1QDQ A;  2R9M A;  1MDW A;  1AYW A;  1ZCM A;  4KLB A;  2BTW B;  2DJG B;  4Q8G A;  1BGO A;  4OW0 A;  4PI3 A;  4RF0 A;  1F29 A;  3D6S A;  3F75 A;  4BOZ A;  2XU3 A;  1YVB A;  4X6J A;  3HHA A;  1QOL A;  1SP4 B;  3MTV A;  4BS6 A;  3O65 A;  1CTE A;  5E6J A;  3KWB X;  4RF1 A;  1MIR A;  5EGW A;  4G54 A;  4YYR A;  1ZIV A;  1U5I A;  2G8E A;  3F5V A;  4MZO A;  1ATK A;  4OVZ A;  5EZQ A;  1AU0 A;  2H7J A;  4OEM A;  2VHS A;  4HWY A;  3PHW A;  3S3R A;  4PP2 E;  1GMY A;  1CPJ A;  4P6E A;  4D8B A;  1PPP A;  1YT7 A;  2GFO A;  4XR7 A;  9PAP A;  4W5B A;  6PAD A;  3PBH A;  4W4U A;  3CH3 X;  2IPP B;  2R9N A;  2Z84 A;  4OVZ B;  1CJL A;  4QBB A;  1BP4 A;  2AIM A;  2R6N A;  2DC9 A;  1TLO A;  2ACT A;  1PVJ A;  1CV8 A;  4PT5 A;  2DCD A;  2JTC A;  1O0E A;  4X6H A;  2AUZ A;  1BY8 A;  5K16 A;  1EWO A;  2JRI A;  1AU3 A;  3H7D A;  4IUM A; 
#chains in the Genus database with same CATH homology
 3PNR A;  2Y5B A;  3QSD A;  2F7D A;  3KKU A;  4NV7 A;  1W6F A;  4QRG A;  1PPO A;  3BC3 A;  1AU2 A;  1F2A A;  1FH0 A;  1K3B B;  4I05 A;  1AEC A;  1CB5 A;  3IOQ A;  5FPW A;  3OVZ A;  3BCN A;  4YYV A;  2P0R A;  3PW3 A;  1GCB A;  2C0Y A;  2JQG R;  4DMY A;  1QXP A;  2AVW A;  2AS8 A;  5CVN B;  3K9M A;  1STF E;  1VSN A;  3BPM A;  4XUI A;  3H89 A;  2ATO A;  2R9C A;  2HXZ A;  3O1G A;  2B1N A;  1Y08 A;  1TL9 A;  3KW9 A;  2AYO A;  5JH3 A;  3MOR A;  4P6G A;  1PXV A;  2DCC A;  3LFY A;  2Y6E A;  1CQD A;  2JQF R;  5CHV A;  2DCA A;  1YK7 A;  2CB5 A;  2YJ9 A;  4N4Z A;  2FRA A;  2HD5 A;  1KFX L;  1NB5 A;  1VJV A;  1U9Q X;  4PAD A;  4N8W A;  2FTD A;  2BDZ A;  3HD3 A;  4PP1 A;  8PCH A;  2GHU A;  1NQC A;  1E2T A;  2XU1 A;  3BPF A;  3KWZ A;  4FK5 A;  2G7Y A;  3K24 A;  4QRV A;  3DF0 A;  4NV8 A;  1GEC E;  2FRQ A;  1DEU A;  2OP3 A;  3ERV A;  4AXL A;  3IV2 A;  1F2C A;  7PCK A;  4YYU A;  2O6X A;  1ICF A;  3KFQ A;  2OZ2 A;  2AU1 A;  1JQP A;  3PDF A;  2DZY A;  1PPD A;  2AYN A;  1CVZ A;  4YVA A;  1A6R A;  2FT2 A;  2P86 A;  1KXR A;  4Q8H A;  1CS8 A;  5JA7 A;  3MHS A;  2E03 A;  1NL6 A;  3IMA A;  3RVW A;  5CVO B;  4QH6 A;  3S3Q A;  2FUD A;  4QRX A;  2PAD A;  5PAD A;  2HHN A;  1HUC B;  2OUL A;  1YK8 A;  4WA6 A;  2P7U A;  1MEM A;  4GUZ A;  4N79 A;  3BWK A;  3C9E A;  4CDD B;  2E00 A;  3K8U A;  5A24 A;  3QJ3 A;  2FQ9 A;  2FYE A;  2XU4 A;  3H8C A;  2G8J A;  3O0U A;  4K7C A;  3U8E A;  3BOW A;  3IUT A;  2YJC A;  1AYV A;  2DC6 A;  1AU4 A;  2DJF B;  2R9O A;  2VHF A;  1ME4 A;  3OVX A;  2DCB A;  1NB3 A;  3QT4 A;  3HWN A;  2BDL A;  3GCB A;  3HHI A;  4BSQ A;  4AXM A;  5CHT A;  2PNS A;  4CDF B;  3CBJ A;  3I06 A;  4ZUX U;  3B79 A;  1BQI A;  4BQV A;  2DZZ A;  1PBH A;  4YV8 A;  2PRE A;  1MEG A;  4B55 A;  1U9X A;  2YJ8 A;  3H8B A;  1KHQ A;  3WXE A;  4I04 A;  2NQG A;  4CDC B;  3V6C A;  3N3K A;  3IEJ A;  2FO5 A;  2DC7 A;  4FJC A;  2E02 A;  3P5V A;  1PPN A;  1POP A;  3M99 A;  3P5U A;  2YJB A;  1AIM A;  4I07 A;  1ME3 A;  1KHP A;  2HH5 A;  2F1G A;  3LTW A;  3KSE A;  5F02 A;  4RY2 A;  1DF0 A;  1X9Y A;  2G6D A;  2PBH A;  3V6E A;  1F2B A;  4CZW A;  3OF9 A;  4BPV A;  1Q6K A;  2AUX A;  5J94 A;  3MTN A;  1U9V A;  1MS6 A;  1PE6 A;  3I3T A;  3MHH A;  3P5W A;  3ZUA A;  1AYU A;  2IBI A;  1EWM A;  1NPZ A;  1QMY A;  4YYQ A;  3OIS A;  2WBF X;  3IHP A;  2E01 A;  1PIP A;  1U9W A;  4X6I A;  1Y4H A;  1W5R A;  1PCI A;  3E1Z B;  4W5C A;  1XKG A;  4FIP A;  3P5X A;  3WXF A;  4BS5 A;  3H6S A;  4DMX A;  3RVV A;  3LXS A;  1EWP A;  1PAD A;  2NQD B;  1ITO A;  3WXG A;  5EF4 A;  1IWD A;  3N3G A;  4YYS A;  1YAL A;  2XU5 A;  2CIO A;  2ARY A;  5CVM A;  2NQA A;  3NHE A;  2NQI A;  2R9F A;  1NLJ A;  1SNK A;  1EF7 A;  1EWL A;  4YYW A;  3CH2 X;  1S4V A;  1THE A;  3RVX A;  3TNX A;  3KX1 A;  1TU6 A;  3AI8 A;  3CBK A;  2YJ2 A;  1KFU L;  2DC8 A;  4CDE B;  4MZS A;  3USV A;  3N4C A;  1M6D A;  1CSB B;  1W4T A;  4MSX A;  4OEL A;  1GLO A;  2B1M A;  3OF8 A;  1MHW A;  1QDQ A;  2R9M A;  1MDW A;  2BSZ A;  1AYW A;  1ZCM A;  4KLB A;  2DJG B;  4Q8G A;  1BGO A;  4PI3 A;  1F29 A;  3D6S A;  3F75 A;  2XU3 A;  1YVB A;  4X6J A;  3HHA A;  1QOL A;  1SP4 B;  4BS6 A;  1CTE A;  3KWB X;  1MIR A;  5EGW A;  4G54 A;  4YYR A;  1ZIV A;  1U5I A;  2G8E A;  2VFC A;  3F5V A;  4MZO A;  1ATK A;  1GX3 A;  3D9W A;  1AU0 A;  2H7J A;  4OEM A;  2VHS A;  4HWY A;  3S3R A;  2VFB A;  4PP2 E;  1GMY A;  1CPJ A;  4P6E A;  1PPP A;  4BGF A;  1YT7 A;  2GFO A;  4XR7 A;  9PAP A;  4W5B A;  6PAD A;  3PBH A;  4W4U A;  3CH3 X;  2IPP B;  2R9N A;  1CJL A;  4QBB A;  1BP4 A;  2AIM A;  2R6N A;  2DC9 A;  1TLO A;  2ACT A;  1CV8 A;  4C5P A;  2DCD A;  1O0E A;  4X6H A;  2AUZ A;  1BY8 A;  5K16 A;  1EWO A;  1AU3 A;  3H7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...