2AYOA

Structure of usp14 bound to ubquitin aldehyde
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
386
structure length
355
Chain Sequence
ASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 355
sequence length 386
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ayoA00
2FQ9A 1QXPA 2DC9A 2PNSA 2P86A 1BQIA 1SP4B 1Q6KA 2YJ9A 4AXLA 1CB5A 2PADA 2ATOA 3RVXA 1AYVA 3CBKA 1KHPA 1S4VA 2NQGA 1NB5A 1PPNA 1F2AA 4OEMA 1NQCA 3KWZA 2CB5A 2DJGB 1PPPA 1EF7A 4MZSA 5F02A 4Q8HA 4MZOA 6PADA 3IOQA 1F2CA 3PW3A 3BOWA 1K3BB 3ERVA 3C9EA 3MORA 1QDQA 1CTEA 5JH3A 4OELA 4WA6A 3ZUAA 4QH6A 3P5UA 1U5IA 3K9MA 3USVA 4DMYA 4RY2A 5K16A 1TU6A 3I3TA 4Q8GA 1XKGA 3BWKA 1CS8A 2AUZA 2DJFB 4PADA 4YYWA 8PCHA 1STFE 3MTNA 2YJ8A 3M99A 2HXZA 1PPDA 2G7YA 2HH5A 1ICFA 4QRXA 3MHSA 1DEUA 3PDFA 1PPOA 2YJBA 2P7UA 1TL9A 1U9VA 2P0RA 1YK8A 3O0UA 1BGOA 4YVAA 1QMYA 2DCAA 3QSDA 1BY8A 3B79A 5CHTA 1AU2A 5CVNB 1NPZA 1VJVA 1NB3A 2FTDA 2AVWA 3AI8A 4CZWA 2OP3A 3HD3A 1F29A 4CDFB 2FYEA 2BDZA 3D6SA 3KWBX 3WXEA 3LXSA 3U8EA 1NL6A 1AECA 1HUCB 1KXRA 1BP4A 9PAPA 4YYUA 4W5BA 1YT7A 3P5XA 4HWYA 2VHFA 2HD5A 1AIMA 4YV8A 4P6EA 1CQDA 2HHNA 1JQPA 3BCNA 3O1GA 2PBHA 2AUXA 3PNRA 4BPVA 2G6DA 4MSXA 1NLJA 3K24A 3OF9A 3LFYA 1PIPA 1O0EA 1CSBB 1AU0A 4KLBA 2NQDB 4FK5A 2F1GA 5CVMA 4XR7A 1Y08A 1GMYA 1U9QX 2YJCA 4AXMA 2DCCA 5JA7A 1KFXL 4N8WA 4BS5A 3OF8A 3HHAA 4XUIA 2FRQA 3KX1A 1MEMA 4YYVA 1AU4A 1U9WA 1YALA 1KFUL 4DMXA 1CV8A 1ZIVA 2DZZA 2E03A 3KW9A 2DC6A 4I05A 3QT4A 1IWDA 2H7JA 2R9MA 1M6DA 1EWMA 4CDCB 2XU4A 2R6NA 3HWNA 1ME4A 1MHWA 1AYWA 5CHVA 1EWPA 2YJ2A 3IEJA 2F7DA 2DCBA 1YVBA 2JQFR 2BDLA 2XU1A 2AYOA 4PP2E 3V6CA 1THEA 2FO5A 4FJCA 4K7CA 3NHEA 2OULA 5PADA 1POPA 2NQAA 7PCKA 1MIRA 3E1ZB 1SNKA 1GLOA 2AS8A 4N79A 3IUTA 2CIOA 3S3QA 4PI3A 4YYSA 3CH3X 1EWOA 2FUDA 1MS6A 3P5VA 4I07A 2G8JA 2DC7A 1X9YA 2AYNA 4BS6A 2IPPB 2VHSA 1F2BA 3KFQA 1CVZA 3RVVA 2NQIA 2FT2A 4N4ZA 1QOLA 2R9CA 1PXVA 3F5VA 3H7DA 4QRVA 2GHUA 5EGWA 2JQGR 4YYRA 3V6EA 5EF4A 3H89A 2E02A 5A24A 2ARYA 1EWLA 2ACTA 1ATKA 3IMAA 3WXFA 2WBFX 1PADA 1CPJA 2AU1A 2XU3A 3TNXA 4FIPA 3OVZA 2R9OA 3IV2A 1DF0A 1AU3A 2IBIA 3HHIA 1GECE 3BPMA 4CDDB 3S3RA 3RVWA 4X6IA 1MEGA 4BQVA 3CBJA 3P5WA 4BSQA 1PCIA 3CH2X 3I06A 1AYUA 1PE6A 3QJ3A 4G54A 2B1MA 4CDEB 5J94A 5FPWA 3OVXA 4X6JA 3H6SA 2DC8A 2Y5BA 1KHQA 2XU5A 4X6HA 5CVOB 3PBHA 1ZCMA 2R9NA 2E00A 3KKUA 4PP1A 2O6XA 4QRGA 1TLOA 2B1NA 2GFOA 3KSEA 4W4UA 1MDWA 2DZYA 1Y4HA 3WXGA 3IHPA 1A6RA 3DF0A 3GCBA 3N4CA 3BC3A 2E01A 2Y6EA 2C0YA 3F75A 1U9XA 3N3GA 2OZ2A 1ITOA 2G8EA 4W5CA 3N3KA 1PBHA 1YK7A 2FRAA 3H8BA 4I04A 4P6GA 4QBBA 3BPFA 3H8CA 1GCBA 2R9FA 3OISA 1ME3A 2DCDA 1FH0A 3MHHA 4ZUXU 2PREA 3K8UA 2AIMA 4YYQA 1VSNA 1CJLA
chains in the Genus database with same CATH superfamily
2FQ9A 1QXPA 2DC9A 4RNAA 2PNSA 2P86A 1BQIA 1SP4B 2AGAA 1Q6KA 2YJ9A 4AXLA 1CB5A 2PADA 2ATOA 3RVXA 1AYVA 3CBKA 4IUMA 4OW0A 3B21A 1KHPA 1S4VA 2NQGA 1NB5A 1PPNA 2BTWA 1F2AA 4OEMA 4D8IA 1NQCA 3KWZA 2CB5A 2DJGB 1PPPA 1EF7A 4MZSA 5F02A 4Q8HA 4MZOA 6PADA 3IOQA 3O65A 1F2CA 3PW3A 2JTCA 4P16A 3BOWA 1K3BB 3MP2A 3ERVA 3C9EA 3MORA 1QDQA 1CTEA 5JH3A 4OELA 4WA6A 3ZUAA 4QH6A 3P5UA 1U5IA 3K9MA 3USVA 4DMYA 4RY2A 5K16A 1TU6A 3I3TA 4Q8GA 1XKGA 3BWKA 1CS8A 3RNVA 2AUZA 2DJFB 4PADA 4YYWA 4OVZA 4HXDB 8PCHA 1STFE 3MTNA 3PRPA 2YJ8A 3M99A 2HXZA 3ZNHA 1PPDA 2G7YA 2HH5A 1ICFA 4QRXA 3MHSA 3PHXA 1DEUA 4PT5A 3PDFA 1PPOA 2YJBA 2P7UA 1TL9A 3IFUA 3BBAA 1U9VA 4REZA 2P0RA 4XZXA 1YK8A 3O0UA 1BGOA 4YVAA 1QMYA 2DCAA 3QSDA 1BY8A 3B79A 5CHTA 1AU2A 5CVNB 5JZEA 1NPZA 4WURA 1VJVA 2JRIA 2Z84A 1NB3A 2FTDA 2AVWA 5EZSA 2BTWB 3AI8A 1PVJA 4CZWA 2OP3A 3HD3A 1F29A 4CDFB 3MJ5A 2FYEA 3C0RA 2BDZA 3D6SA 3KWBX 3WXEA 3LXSA 3U8EA 1NL6A 1AECA 1HUCB 4BOPA 1KXRA 3PHWA 1BP4A 9PAPA 4YYUA 4W5BA 1YT7A 3P5XA 4HWYA 2VHFA 2HD5A 1AIMA 4YV8A 4P6EA 1CQDA 3BY4A 2HHNA 1JQPA 3BCNA 3O1GA 2PBHA 2AUXA 3PNRA 4BPVA 2G6DA 4MSXA 1NLJA 3K24A 3OF9A 3LFYA 1PIPA 4RKXA 1O0EA 1CSBB 1AU0A 4KLBA 2NQDB 4FK5A 2F1GA 5CVMA 4MM3B 4XR7A 1Y08A 1GMYA 1U9QX 2YJCA 4AXMA 2DCCA 2FE8A 5JA7A 1KFXL 4N8WA 4BS5A 3OF8A 3HHAA 4XUIA 2UZJA 2FRQA 3KX1A 1DKIA 1MEMA 4YYVA 3BB7A 1AU4A 1U9WA 1YALA 1KFUL 4DMXA 1CV8A 4BOZA 1ZIVA 2DZZA 2E03A 3KW9A 2DC6A 4I05A 3QT4A 2J7QA 1IWDA 2H7JA 2R9MA 1M6DA 1EWMA 4CDCB 2XU4A 4BOQA 2R6NA 3HWNA 1ME4A 1MHWA 1AYWA 5CHVA 1EWPA 2YJ2A 3IEJA 4D8EA 2F7DA 2DCBA 1YVBA 2JQFR 3PT2A 1YZBA 2BDLA 2XU1A 2AYOA 4PP2E 3V6CA 1THEA 2FO5A 4FJCA 4K7CA 3NHEA 2OULA 5PADA 1POPA 2NQAA 7PCKA 3W30A 1MIRA 3E1ZB 1SNKA 1GLOA 3W31A 2AS8A 4N79A 3IUTA 2CIOA 3S3QA 2DOSA 4M0WA 4PI3A 4RF1A 4YYSA 3CH3X 1EWOA 2FUDA 3TRKA 1MS6A 3P5VA 4ZTBA 4I07A 4BOUA 2G8JA 2DC7A 1X9YA 2AYNA 4BS6A 2IPPB 2VHSA 1F2BA 3KFQA 1CVZA 3RVVA 2NQIA 2FT2A 4N4ZA 1QOLA 2R9CA 1PXVA 3F5VA 3H7DA 4QRVA 2GHUA 5EGWA 2JQGR 4YYRA 2BU3A 4OVZB 5EF4A 3V6EA 4BOSA 3H89A 2E02A 5A24A 2ARYA 1EWLA 2ACTA 1ATKA 4R3DA 3IMAA 3WXFA 2WBFX 1PADA 1CPJA 2AU1A 2XU3A 3TNXA 4FIPA 3OVZA 2R9OA 3IV2A 3PSEA 3MTVA 1DF0A 1AU3A 2IBIA 3HHIA 1GECE 3BPMA 4CDDB 3S3RA 3RVWA 4A5UA 4X6IA 1MEGA 4BQVA 4D8BA 2J7QC 3CBJA 3P5WA 3TMPA 4BSQA 1PCIA 3CH2X 3I06A 1AYUA 1PE6A 4IP3A 3QJ3A 4G54A 2B1MA 4CDEB 1UKFA 5J94A 5FPWA 3OVXA 4X6JA 4RF0A 3E9SA 3PHUA 3H6SA 2DC8A 2Y5BA 1KHQA 2XU5A 4X6HA 5CVOB 3PBHA 1ZCMA 2R9NA 2E00A 3KKUA 4PP1A 2O6XA 4QRGA 1TLOA 3OQCA 2B1NA 2GFOA 3KSEA 4W4UA 4GUAA 1MDWA 2DZYA 1Y4HA 3WXGA 3IHPA 1A6RA 3DF0A 5EZQA 3GCBA 3N4CA 3BC3A 2E01A 3PRMA 2Y6EA 5E6JA 2C0YA 3F75A 1U9XA 3N3GA 2OZ2A 1ITOA 4MI7A 2G8EA 4W5CA 3N3KA 1PBHA 1YK7A 2FRAA 3H8BA 4I04A 5KO3A 4P6GA 4QBBA 3BPFA 3H8CA 1GCBA 2R9FA 3OISA 1ME3A 2DCDA 1FH0A 2HWKA 3MHHA 4ZUXU 2PREA 3K8UA 2AIMA 4YYQA 1VSNA 1CJLA
chains in the Genus database with same CATH topology
2FQ9A 1QXPA 2DC9A 2PNSA 2P86A 1BQIA 1SP4B 1Q6KA 2YJ9A 4AXLA 1CB5A 2PADA 2ATOA 3RVXA 1AYVA 3CBKA 1KHPA 1S4VA 2NQGA 1NB5A 1PPNA 1F2AA 4OEMA 1NQCA 3KWZA 2CB5A 2DJGB 1PPPA 1EF7A 4MZSA 5F02A 4Q8HA 4MZOA 6PADA 3IOQA 1F2CA 3PW3A 3BOWA 1K3BB 3ERVA 3C9EA 3MORA 1QDQA 1CTEA 5JH3A 4OELA 4WA6A 3ZUAA 4QH6A 3P5UA 1U5IA 3K9MA 3USVA 4DMYA 4RY2A 5K16A 1TU6A 3I3TA 4Q8GA 1XKGA 3BWKA 1CS8A 1W6FA 2AUZA 2DJFB 4PADA 4YYWA 8PCHA 1STFE 3MTNA 2YJ8A 3M99A 2HXZA 1PPDA 2G7YA 2HH5A 1ICFA 4QRXA 3MHSA 1DEUA 3PDFA 1PPOA 2YJBA 2P7UA 1TL9A 1U9VA 2P0RA 1YK8A 3O0UA 1BGOA 4YVAA 1QMYA 1E2TA 2DCAA 3QSDA 1BY8A 3B79A 5CHTA 1AU2A 5CVNB 1NPZA 2BSZA 1VJVA 1NB3A 2FTDA 2AVWA 3AI8A 4CZWA 2OP3A 3HD3A 1F29A 4GUZA 4CDFB 2FYEA 2BDZA 3D6SA 3KWBX 3WXEA 3LXSA 3U8EA 1NL6A 1AECA 1HUCB 1KXRA 1BP4A 9PAPA 4YYUA 4W5BA 1YT7A 3P5XA 4HWYA 2VHFA 2HD5A 4NV7A 1AIMA 4YV8A 4P6EA 1CQDA 2HHNA 1JQPA 3BCNA 3O1GA 2PBHA 2AUXA 3PNRA 4BPVA 2G6DA 4MSXA 1NLJA 3K24A 3OF9A 3LFYA 1PIPA 1O0EA 1CSBB 1AU0A 4KLBA 2NQDB 4FK5A 2F1GA 5CVMA 4XR7A 1Y08A 1GMYA 1U9QX 2YJCA 4AXMA 2DCCA 5JA7A 1KFXL 4N8WA 4BS5A 3OF8A 3HHAA 4XUIA 2FRQA 3KX1A 1MEMA 4YYVA 3D9WA 1AU4A 1U9WA 1YALA 1KFUL 4DMXA 1CV8A 1ZIVA 2DZZA 2E03A 3KW9A 2DC6A 4I05A 3QT4A 1IWDA 2H7JA 2R9MA 1M6DA 1EWMA 4CDCB 2XU4A 2R6NA 3HWNA 1ME4A 1MHWA 1AYWA 5CHVA 1EWPA 2YJ2A 3IEJA 2F7DA 2DCBA 1YVBA 4NV8A 2JQFR 2BDLA 2XU1A 2AYOA 4PP2E 3V6CA 1THEA 2FO5A 4FJCA 4K7CA 3NHEA 2OULA 4B55A 5PADA 1POPA 2NQAA 7PCKA 1MIRA 3E1ZB 1SNKA 1GLOA 2AS8A 4N79A 3IUTA 2CIOA 3S3QA 4PI3A 4YYSA 3CH3X 1EWOA 2FUDA 1MS6A 3P5VA 4I07A 2G8JA 2DC7A 1X9YA 2AYNA 4BS6A 2IPPB 2VHSA 1F2BA 3KFQA 1CVZA 3RVVA 2NQIA 2FT2A 4N4ZA 1QOLA 2R9CA 1PXVA 3F5VA 3H7DA 4QRVA 2GHUA 5EGWA 2JQGR 4YYRA 3V6EA 5EF4A 3H89A 2E02A 5A24A 2ARYA 4C5PA 1EWLA 2ACTA 1ATKA 3IMAA 3WXFA 2WBFX 1PADA 1CPJA 2AU1A 2XU3A 3TNXA 4FIPA 3OVZA 2R9OA 3IV2A 1DF0A 1AU3A 1GX3A 2IBIA 3HHIA 1GECE 3BPMA 4CDDB 2VFCA 3S3RA 3RVWA 4X6IA 1MEGA 4BQVA 3CBJA 3P5WA 4BSQA 1PCIA 3CH2X 3I06A 1AYUA 1PE6A 3QJ3A 4G54A 2B1MA 4CDEB 5J94A 5FPWA 3OVXA 4X6JA 3H6SA 2DC8A 2Y5BA 1KHQA 3LTWA 2XU5A 4X6HA 5CVOB 3PBHA 1ZCMA 4BGFA 2R9NA 2E00A 3KKUA 4PP1A 2O6XA 4QRGA 1TLOA 2B1NA 2GFOA 3KSEA 4W4UA 2VFBA 1W4TA 1MDWA 2DZYA 1Y4HA 3WXGA 3IHPA 1A6RA 3DF0A 3GCBA 3N4CA 3BC3A 2E01A 2Y6EA 2C0YA 3F75A 1U9XA 3N3GA 2OZ2A 1ITOA 2G8EA 4W5CA 3N3KA 1PBHA 1YK7A 2FRAA 3H8BA 4I04A 4P6GA 4QBBA 3BPFA 3H8CA 1GCBA 1W5RA 2R9FA 3OISA 1ME3A 2DCDA 1FH0A 3MHHA 4ZUXU 2PREA 3K8UA 2AIMA 4YYQA 1VSNA 1CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ9 A;  1QXP A;  2DC9 A;  2PNS A;  2P86 A;  1BQI A;  1SP4 B;  1Q6K A;  2YJ9 A;  4AXL A;  1CB5 A;  2PAD A;  2ATO A;  3RVX A;  1AYV A;  3CBK A;  1KHP A;  1S4V A;  2NQG A;  1NB5 A;  1PPN A;  1F2A A;  4OEM A;  1NQC A;  3KWZ A;  2CB5 A;  2DJG B;  1PPP A;  1EF7 A;  4MZS A;  5F02 A;  4Q8H A;  4MZO A;  6PAD A;  3IOQ A;  1F2C A;  3PW3 A;  3BOW A;  1K3B B;  3ERV A;  3C9E A;  3MOR A;  1QDQ A;  1CTE A;  5JH3 A;  4OEL A;  4WA6 A;  3ZUA A;  4QH6 A;  3P5U A;  1U5I A;  3K9M A;  3USV A;  4DMY A;  4RY2 A;  5K16 A;  1TU6 A;  3I3T A;  4Q8G A;  1XKG A;  3BWK A;  1CS8 A;  2AUZ A;  2DJF B;  4PAD A;  4YYW A;  8PCH A;  1STF E;  3MTN A;  2YJ8 A;  3M99 A;  2HXZ A;  1PPD A;  2G7Y A;  2HH5 A;  1ICF A;  4QRX A;  3MHS A;  1DEU A;  3PDF A;  1PPO A;  2YJB A;  2P7U A;  1TL9 A;  1U9V A;  2P0R A;  1YK8 A;  3O0U A;  1BGO A;  4YVA A;  1QMY A;  2DCA A;  3QSD A;  1BY8 A;  3B79 A;  5CHT A;  1AU2 A;  5CVN B;  1NPZ A;  1VJV A;  1NB3 A;  2FTD A;  2AVW A;  3AI8 A;  4CZW A;  2OP3 A;  3HD3 A;  1F29 A;  4CDF B;  2FYE A;  2BDZ A;  3D6S A;  3KWB X;  3WXE A;  3LXS A;  3U8E A;  1NL6 A;  1AEC A;  1HUC B;  1KXR A;  1BP4 A;  9PAP A;  4YYU A;  4W5B A;  1YT7 A;  3P5X A;  4HWY A;  2VHF A;  2HD5 A;  1AIM A;  4YV8 A;  4P6E A;  1CQD A;  2HHN A;  1JQP A;  3BCN A;  3O1G A;  2PBH A;  2AUX A;  3PNR A;  4BPV A;  2G6D A;  4MSX A;  1NLJ A;  3K24 A;  3OF9 A;  3LFY A;  1PIP A;  1O0E A;  1CSB B;  1AU0 A;  4KLB A;  2NQD B;  4FK5 A;  2F1G A;  5CVM A;  4XR7 A;  1Y08 A;  1GMY A;  1U9Q X;  2YJC A;  4AXM A;  2DCC A;  5JA7 A;  1KFX L;  4N8W A;  4BS5 A;  3OF8 A;  3HHA A;  4XUI A;  2FRQ A;  3KX1 A;  1MEM A;  4YYV A;  1AU4 A;  1U9W A;  1YAL A;  1KFU L;  4DMX A;  1CV8 A;  1ZIV A;  2DZZ A;  2E03 A;  3KW9 A;  2DC6 A;  4I05 A;  3QT4 A;  1IWD A;  2H7J A;  2R9M A;  1M6D A;  1EWM A;  4CDC B;  2XU4 A;  2R6N A;  3HWN A;  1ME4 A;  1MHW A;  1AYW A;  5CHV A;  1EWP A;  2YJ2 A;  3IEJ A;  2F7D A;  2DCB A;  1YVB A;  2JQF R;  2BDL A;  2XU1 A;  2AYO A;  4PP2 E;  3V6C A;  1THE A;  2FO5 A;  4FJC A;  4K7C A;  3NHE A;  2OUL A;  5PAD A;  1POP A;  2NQA A;  7PCK A;  1MIR A;  3E1Z B;  1SNK A;  1GLO A;  2AS8 A;  4N79 A;  3IUT A;  2CIO A;  3S3Q A;  4PI3 A;  4YYS A;  3CH3 X;  1EWO A;  2FUD A;  1MS6 A;  3P5V A;  4I07 A;  2G8J A;  2DC7 A;  1X9Y A;  2AYN A;  4BS6 A;  2IPP B;  2VHS A;  1F2B A;  3KFQ A;  1CVZ A;  3RVV A;  2NQI A;  2FT2 A;  4N4Z A;  1QOL A;  2R9C A;  1PXV A;  3F5V A;  3H7D A;  4QRV A;  2GHU A;  5EGW A;  2JQG R;  4YYR A;  3V6E A;  5EF4 A;  3H89 A;  2E02 A;  5A24 A;  2ARY A;  1EWL A;  2ACT A;  1ATK A;  3IMA A;  3WXF A;  2WBF X;  1PAD A;  1CPJ A;  2AU1 A;  2XU3 A;  3TNX A;  4FIP A;  3OVZ A;  2R9O A;  3IV2 A;  1DF0 A;  1AU3 A;  2IBI A;  3HHI A;  1GEC E;  3BPM A;  4CDD B;  3S3R A;  3RVW A;  4X6I A;  1MEG A;  4BQV A;  3CBJ A;  3P5W A;  4BSQ A;  1PCI A;  3CH2 X;  3I06 A;  1AYU A;  1PE6 A;  3QJ3 A;  4G54 A;  2B1M A;  4CDE B;  5J94 A;  5FPW A;  3OVX A;  4X6J A;  3H6S A;  2DC8 A;  2Y5B A;  1KHQ A;  2XU5 A;  4X6H A;  5CVO B;  3PBH A;  1ZCM A;  2R9N A;  2E00 A;  3KKU A;  4PP1 A;  2O6X A;  4QRG A;  1TLO A;  2B1N A;  2GFO A;  3KSE A;  4W4U A;  1MDW A;  2DZY A;  1Y4H A;  3WXG A;  3IHP A;  1A6R A;  3DF0 A;  3GCB A;  3N4C A;  3BC3 A;  2E01 A;  2Y6E A;  2C0Y A;  3F75 A;  1U9X A;  3N3G A;  2OZ2 A;  1ITO A;  2G8E A;  4W5C A;  3N3K A;  1PBH A;  1YK7 A;  2FRA A;  3H8B A;  4I04 A;  4P6G A;  4QBB A;  3BPF A;  3H8C A;  1GCB A;  2R9F A;  3OIS A;  1ME3 A;  2DCD A;  1FH0 A;  3MHH A;  4ZUX U;  2PRE A;  3K8U A;  2AIM A;  4YYQ A;  1VSN A;  1CJL A; 
#chains in the Genus database with same CATH topology
 2FQ9 A;  1QXP A;  2DC9 A;  4RNA A;  2PNS A;  2P86 A;  1BQI A;  1SP4 B;  2AGA A;  1Q6K A;  2YJ9 A;  4AXL A;  1CB5 A;  2PAD A;  2ATO A;  3RVX A;  1AYV A;  3CBK A;  4IUM A;  4OW0 A;  3B21 A;  1KHP A;  1S4V A;  2NQG A;  1NB5 A;  1PPN A;  2BTW A;  1F2A A;  4OEM A;  4D8I A;  1NQC A;  3KWZ A;  2CB5 A;  2DJG B;  1PPP A;  1EF7 A;  4MZS A;  5F02 A;  4Q8H A;  4MZO A;  6PAD A;  3IOQ A;  3O65 A;  1F2C A;  3PW3 A;  2JTC A;  4P16 A;  3BOW A;  1K3B B;  3MP2 A;  3ERV A;  3C9E A;  3MOR A;  1QDQ A;  1CTE A;  5JH3 A;  4OEL A;  4WA6 A;  3ZUA A;  4QH6 A;  3P5U A;  1U5I A;  3K9M A;  3USV A;  4DMY A;  4RY2 A;  5K16 A;  1TU6 A;  3I3T A;  4Q8G A;  1XKG A;  3BWK A;  1CS8 A;  3RNV A;  2AUZ A;  2DJF B;  4PAD A;  4YYW A;  4OVZ A;  4HXD B;  8PCH A;  1STF E;  3MTN A;  3PRP A;  2YJ8 A;  3M99 A;  2HXZ A;  3ZNH A;  1PPD A;  2G7Y A;  2HH5 A;  1ICF A;  4QRX A;  3MHS A;  3PHX A;  1DEU A;  4PT5 A;  3PDF A;  1PPO A;  2YJB A;  2P7U A;  1TL9 A;  3IFU A;  3BBA A;  1U9V A;  4REZ A;  2P0R A;  4XZX A;  1YK8 A;  3O0U A;  1BGO A;  4YVA A;  1QMY A;  2DCA A;  3QSD A;  1BY8 A;  3B79 A;  5CHT A;  1AU2 A;  5CVN B;  5JZE A;  1NPZ A;  4WUR A;  1VJV A;  2JRI A;  2Z84 A;  1NB3 A;  2FTD A;  2AVW A;  5EZS A;  2BTW B;  3AI8 A;  1PVJ A;  4CZW A;  2OP3 A;  3HD3 A;  1F29 A;  4CDF B;  3MJ5 A;  2FYE A;  3C0R A;  2BDZ A;  3D6S A;  3KWB X;  3WXE A;  3LXS A;  3U8E A;  1NL6 A;  1AEC A;  1HUC B;  4BOP A;  1KXR A;  3PHW A;  1BP4 A;  9PAP A;  4YYU A;  4W5B A;  1YT7 A;  3P5X A;  4HWY A;  2VHF A;  2HD5 A;  1AIM A;  4YV8 A;  4P6E A;  1CQD A;  3BY4 A;  2HHN A;  1JQP A;  3BCN A;  3O1G A;  2PBH A;  2AUX A;  3PNR A;  4BPV A;  2G6D A;  4MSX A;  1NLJ A;  3K24 A;  3OF9 A;  3LFY A;  1PIP A;  4RKX A;  1O0E A;  1CSB B;  1AU0 A;  4KLB A;  2NQD B;  4FK5 A;  2F1G A;  5CVM A;  4MM3 B;  4XR7 A;  1Y08 A;  1GMY A;  1U9Q X;  2YJC A;  4AXM A;  2DCC A;  2FE8 A;  5JA7 A;  1KFX L;  4N8W A;  4BS5 A;  3OF8 A;  3HHA A;  4XUI A;  2UZJ A;  2FRQ A;  3KX1 A;  1DKI A;  1MEM A;  4YYV A;  3BB7 A;  1AU4 A;  1U9W A;  1YAL A;  1KFU L;  4DMX A;  1CV8 A;  4BOZ A;  1ZIV A;  2DZZ A;  2E03 A;  3KW9 A;  2DC6 A;  4I05 A;  3QT4 A;  2J7Q A;  1IWD A;  2H7J A;  2R9M A;  1M6D A;  1EWM A;  4CDC B;  2XU4 A;  4BOQ A;  2R6N A;  3HWN A;  1ME4 A;  1MHW A;  1AYW A;  5CHV A;  1EWP A;  2YJ2 A;  3IEJ A;  4D8E A;  2F7D A;  2DCB A;  1YVB A;  2JQF R;  3PT2 A;  1YZB A;  2BDL A;  2XU1 A;  2AYO A;  4PP2 E;  3V6C A;  1THE A;  2FO5 A;  4FJC A;  4K7C A;  3NHE A;  2OUL A;  5PAD A;  1POP A;  2NQA A;  7PCK A;  3W30 A;  1MIR A;  3E1Z B;  1SNK A;  1GLO A;  3W31 A;  2AS8 A;  4N79 A;  3IUT A;  2CIO A;  3S3Q A;  2DOS A;  4M0W A;  4PI3 A;  4RF1 A;  4YYS A;  3CH3 X;  1EWO A;  2FUD A;  3TRK A;  1MS6 A;  3P5V A;  4ZTB A;  4I07 A;  4BOU A;  2G8J A;  2DC7 A;  1X9Y A;  2AYN A;  4BS6 A;  2IPP B;  2VHS A;  1F2B A;  3KFQ A;  1CVZ A;  3RVV A;  2NQI A;  2FT2 A;  4N4Z A;  1QOL A;  2R9C A;  1PXV A;  3F5V A;  3H7D A;  4QRV A;  2GHU A;  5EGW A;  2JQG R;  4YYR A;  2BU3 A;  4OVZ B;  5EF4 A;  3V6E A;  4BOS A;  3H89 A;  2E02 A;  5A24 A;  2ARY A;  1EWL A;  2ACT A;  1ATK A;  4R3D A;  3IMA A;  3WXF A;  2WBF X;  1PAD A;  1CPJ A;  2AU1 A;  2XU3 A;  3TNX A;  4FIP A;  3OVZ A;  2R9O A;  3IV2 A;  3PSE A;  3MTV A;  1DF0 A;  1AU3 A;  2IBI A;  3HHI A;  1GEC E;  3BPM A;  4CDD B;  3S3R A;  3RVW A;  4A5U A;  4X6I A;  1MEG A;  4BQV A;  4D8B A;  2J7Q C;  3CBJ A;  3P5W A;  3TMP A;  4BSQ A;  1PCI A;  3CH2 X;  3I06 A;  1AYU A;  1PE6 A;  4IP3 A;  3QJ3 A;  4G54 A;  2B1M A;  4CDE B;  1UKF A;  5J94 A;  5FPW A;  3OVX A;  4X6J A;  4RF0 A;  3E9S A;  3PHU A;  3H6S A;  2DC8 A;  2Y5B A;  1KHQ A;  2XU5 A;  4X6H A;  5CVO B;  3PBH A;  1ZCM A;  2R9N A;  2E00 A;  3KKU A;  4PP1 A;  2O6X A;  4QRG A;  1TLO A;  3OQC A;  2B1N A;  2GFO A;  3KSE A;  4W4U A;  4GUA A;  1MDW A;  2DZY A;  1Y4H A;  3WXG A;  3IHP A;  1A6R A;  3DF0 A;  5EZQ A;  3GCB A;  3N4C A;  3BC3 A;  2E01 A;  3PRM A;  2Y6E A;  5E6J A;  2C0Y A;  3F75 A;  1U9X A;  3N3G A;  2OZ2 A;  1ITO A;  4MI7 A;  2G8E A;  4W5C A;  3N3K A;  1PBH A;  1YK7 A;  2FRA A;  3H8B A;  4I04 A;  5KO3 A;  4P6G A;  4QBB A;  3BPF A;  3H8C A;  1GCB A;  2R9F A;  3OIS A;  1ME3 A;  2DCD A;  1FH0 A;  2HWK A;  3MHH A;  4ZUX U;  2PRE A;  3K8U A;  2AIM A;  4YYQ A;  1VSN A;  1CJL A; 
#chains in the Genus database with same CATH homology
 2FQ9 A;  1QXP A;  2DC9 A;  2PNS A;  2P86 A;  1BQI A;  1SP4 B;  1Q6K A;  2YJ9 A;  4AXL A;  1CB5 A;  2PAD A;  2ATO A;  3RVX A;  1AYV A;  3CBK A;  1KHP A;  1S4V A;  2NQG A;  1NB5 A;  1PPN A;  1F2A A;  4OEM A;  1NQC A;  3KWZ A;  2CB5 A;  2DJG B;  1PPP A;  1EF7 A;  4MZS A;  5F02 A;  4Q8H A;  4MZO A;  6PAD A;  3IOQ A;  1F2C A;  3PW3 A;  3BOW A;  1K3B B;  3ERV A;  3C9E A;  3MOR A;  1QDQ A;  1CTE A;  5JH3 A;  4OEL A;  4WA6 A;  3ZUA A;  4QH6 A;  3P5U A;  1U5I A;  3K9M A;  3USV A;  4DMY A;  4RY2 A;  5K16 A;  1TU6 A;  3I3T A;  4Q8G A;  1XKG A;  3BWK A;  1CS8 A;  1W6F A;  2AUZ A;  2DJF B;  4PAD A;  4YYW A;  8PCH A;  1STF E;  3MTN A;  2YJ8 A;  3M99 A;  2HXZ A;  1PPD A;  2G7Y A;  2HH5 A;  1ICF A;  4QRX A;  3MHS A;  1DEU A;  3PDF A;  1PPO A;  2YJB A;  2P7U A;  1TL9 A;  1U9V A;  2P0R A;  1YK8 A;  3O0U A;  1BGO A;  4YVA A;  1QMY A;  1E2T A;  2DCA A;  3QSD A;  1BY8 A;  3B79 A;  5CHT A;  1AU2 A;  5CVN B;  1NPZ A;  2BSZ A;  1VJV A;  1NB3 A;  2FTD A;  2AVW A;  3AI8 A;  4CZW A;  2OP3 A;  3HD3 A;  1F29 A;  4GUZ A;  4CDF B;  2FYE A;  2BDZ A;  3D6S A;  3KWB X;  3WXE A;  3LXS A;  3U8E A;  1NL6 A;  1AEC A;  1HUC B;  1KXR A;  1BP4 A;  9PAP A;  4YYU A;  4W5B A;  1YT7 A;  3P5X A;  4HWY A;  2VHF A;  2HD5 A;  4NV7 A;  1AIM A;  4YV8 A;  4P6E A;  1CQD A;  2HHN A;  1JQP A;  3BCN A;  3O1G A;  2PBH A;  2AUX A;  3PNR A;  4BPV A;  2G6D A;  4MSX A;  1NLJ A;  3K24 A;  3OF9 A;  3LFY A;  1PIP A;  1O0E A;  1CSB B;  1AU0 A;  4KLB A;  2NQD B;  4FK5 A;  2F1G A;  5CVM A;  4XR7 A;  1Y08 A;  1GMY A;  1U9Q X;  2YJC A;  4AXM A;  2DCC A;  5JA7 A;  1KFX L;  4N8W A;  4BS5 A;  3OF8 A;  3HHA A;  4XUI A;  2FRQ A;  3KX1 A;  1MEM A;  4YYV A;  3D9W A;  1AU4 A;  1U9W A;  1YAL A;  1KFU L;  4DMX A;  1CV8 A;  1ZIV A;  2DZZ A;  2E03 A;  3KW9 A;  2DC6 A;  4I05 A;  3QT4 A;  1IWD A;  2H7J A;  2R9M A;  1M6D A;  1EWM A;  4CDC B;  2XU4 A;  2R6N A;  3HWN A;  1ME4 A;  1MHW A;  1AYW A;  5CHV A;  1EWP A;  2YJ2 A;  3IEJ A;  2F7D A;  2DCB A;  1YVB A;  4NV8 A;  2JQF R;  2BDL A;  2XU1 A;  2AYO A;  4PP2 E;  3V6C A;  1THE A;  2FO5 A;  4FJC A;  4K7C A;  3NHE A;  2OUL A;  4B55 A;  5PAD A;  1POP A;  2NQA A;  7PCK A;  1MIR A;  3E1Z B;  1SNK A;  1GLO A;  2AS8 A;  4N79 A;  3IUT A;  2CIO A;  3S3Q A;  4PI3 A;  4YYS A;  3CH3 X;  1EWO A;  2FUD A;  1MS6 A;  3P5V A;  4I07 A;  2G8J A;  2DC7 A;  1X9Y A;  2AYN A;  4BS6 A;  2IPP B;  2VHS A;  1F2B A;  3KFQ A;  1CVZ A;  3RVV A;  2NQI A;  2FT2 A;  4N4Z A;  1QOL A;  2R9C A;  1PXV A;  3F5V A;  3H7D A;  4QRV A;  2GHU A;  5EGW A;  2JQG R;  4YYR A;  3V6E A;  5EF4 A;  3H89 A;  2E02 A;  5A24 A;  2ARY A;  4C5P A;  1EWL A;  2ACT A;  1ATK A;  3IMA A;  3WXF A;  2WBF X;  1PAD A;  1CPJ A;  2AU1 A;  2XU3 A;  3TNX A;  4FIP A;  3OVZ A;  2R9O A;  3IV2 A;  1DF0 A;  1AU3 A;  1GX3 A;  2IBI A;  3HHI A;  1GEC E;  3BPM A;  4CDD B;  2VFC A;  3S3R A;  3RVW A;  4X6I A;  1MEG A;  4BQV A;  3CBJ A;  3P5W A;  4BSQ A;  1PCI A;  3CH2 X;  3I06 A;  1AYU A;  1PE6 A;  3QJ3 A;  4G54 A;  2B1M A;  4CDE B;  5J94 A;  5FPW A;  3OVX A;  4X6J A;  3H6S A;  2DC8 A;  2Y5B A;  1KHQ A;  3LTW A;  2XU5 A;  4X6H A;  5CVO B;  3PBH A;  1ZCM A;  4BGF A;  2R9N A;  2E00 A;  3KKU A;  4PP1 A;  2O6X A;  4QRG A;  1TLO A;  2B1N A;  2GFO A;  3KSE A;  4W4U A;  2VFB A;  1W4T A;  1MDW A;  2DZY A;  1Y4H A;  3WXG A;  3IHP A;  1A6R A;  3DF0 A;  3GCB A;  3N4C A;  3BC3 A;  2E01 A;  2Y6E A;  2C0Y A;  3F75 A;  1U9X A;  3N3G A;  2OZ2 A;  1ITO A;  2G8E A;  4W5C A;  3N3K A;  1PBH A;  1YK7 A;  2FRA A;  3H8B A;  4I04 A;  4P6G A;  4QBB A;  3BPF A;  3H8C A;  1GCB A;  1W5R A;  2R9F A;  3OIS A;  1ME3 A;  2DCD A;  1FH0 A;  3MHH A;  4ZUX U;  2PRE A;  3K8U A;  2AIM A;  4YYQ A;  1VSN A;  1CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...