2AYOA

Structure of usp14 bound to ubquitin aldehyde
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
386
structure length
355
Chain Sequence
ASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
total genus 66
structure length 355
sequence length 386
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ayoA00
4ZUXU 2P0RA 2DC9A 2DJGB 2YJ8A 2H7JA 3LFYA 1CJLA 2YJ2A 2DZZA 2IBIA 5FPWA 2ARYA 1ME4A 3CH2X 3H6SA 3PW3A 3PDFA 1QXPA 2G8JA 3S3QA 1TL9A 3F5VA 3OVXA 4G54A 3ZUAA 3IMAA 3BWKA 3HWNA 2C0YA 4CDFB 3C9EA 1KHQA 1F29A 3KSEA 4MZOA 2FRQA 4DMXA 1CTEA 2FTDA 2DZYA 1QMYA 1AECA 3BPMA 1F2AA 1CPJA 3PNRA 5EF4A 3OF8A 3U8EA 3MORA 3N4CA 4YVAA 4PP2E 1YT7A 1AYVA 3QJ3A 5JH3A 2FT2A 3P5UA 1YK8A 1YALA 4CDDB 4I07A 4BQVA 4AXLA 1BQIA 1PPPA 4Q8HA 2O6XA 1NLJA 4KLBA 2XU5A 4N8WA 1KXRA 5CHTA 1NB3A 3BOWA 1BP4A 3MTNA 2R6NA 2YJBA 1CSBB 2B1MA 2DCBA 4OELA 1GECE 3NHEA 3HHIA 3P5WA 4W4UA 3BC3A 3H7DA 1GCBA 2AYNA 2G8EA 2R9NA 4BSQA 1MEMA 2DCAA 3B79A 6PADA 1YVBA 1POPA 3KX1A 2XU4A 1PPOA 4QH6A 3KWZA 3V6CA 1U9VA 3OF9A 1CVZA 2DJFB 4OEMA 3RVVA 1XKGA 2YJCA 2B1NA 3K24A 2JQFR 5J94A 2FRAA 1MDWA 2OP3A 3BPFA 1AYUA 1A6RA 2G6DA 5A24A 4X6JA 1NB5A 2GFOA 2VHSA 1VSNA 2OZ2A 1DF0A 4YV8A 4BS6A 1ME3A 2NQDB 1BY8A 3AI8A 4BS5A 1PADA 2OULA 4XUIA 5F02A 4YYRA 2P86A 1F2CA 4FK5A 3E1ZB 1AU0A 3N3GA 2WBFX 2AIMA 3GCBA 2DCDA 4YYVA 4W5BA 3HD3A 2FYEA 3HHAA 4N79A 4PADA 3PBHA 4X6HA 1QOLA 1AU2A 1AU3A 2Y5BA 2NQIA 1MHWA 1SNKA 5JA7A 2XU3A 2R9OA 3IV2A 1Y4HA 1PCIA 1NPZA 4WA6A 3RVWA 3WXGA 3DF0A 5EGWA 4Q8GA 4K7CA 1ZCMA 2E02A 3I06A 2R9CA 1SP4B 1KFUL 3USVA 2AVWA 3OISA 2AUXA 1F2BA 1DEUA 3MHHA 5PADA 1PIPA 2JQGR 4CDEB 1U9WA 4MSXA 3IOQA 1TLOA 4YYWA 1U5IA 3CBKA 4CZWA 1EWLA 1TU6A 1BGOA 2AS8A 3K8UA 3H8BA 1S4VA 2PBHA 1PBHA 3ERVA 4N4ZA 1PPNA 3O1GA 1THEA 2F7DA 3P5XA 1EWPA 1AU4A 1PE6A 2DC7A 2AUZA 1QDQA 8PCHA 2P7UA 5CVMA 2ACTA 2DC6A 1CB5A 4W5CA 4MZSA 1MEGA 3TNXA 3P5VA 3KWBX 4PP1A 2PREA 2AU1A 4RY2A 2PADA 2PNSA 3M99A 1MS6A 1Y08A 1NQCA 5K16A 1KFXL 4YYSA 1GMYA 2FO5A 4X6IA 2HH5A 3IUTA 3MHSA 2E00A 3BCNA 1EF7A 3IHPA 5CVOB 3QT4A 2HXZA 1PXVA 7PCKA 3WXFA 1CV8A 1M6DA 1EWOA 1ICFA 3K9MA 1IWDA 2NQAA 2E03A 2ATOA 2FQ9A 1AIMA 2F1GA 3V6EA 3CBJA 1ITOA 3KFQA 1YK7A 2CB5A 1NL6A 4QRGA 2VHFA 1GLOA 2BDLA 3KW9A 4FJCA 2CIOA 5CHVA 1PPDA 4XR7A 4HWYA 2DC8A 3N3KA 4YYQA 4YYUA 3RVXA 2YJ9A 4QRVA 3D6SA 2XU1A 1HUCB 3KKUA 4I05A 4QRXA 1U9XA 4PI3A 2AYOA 4AXMA 3H89A 3H8CA 1U9QX 4I04A 2R9FA 1CQDA 3LXSA 1ATKA 2BDZA 1FH0A 1EWMA 3O0UA 1O0EA 3WXEA 4P6GA 2GHUA 3F75A 4FIPA 1STFE 3IEJA 4CDCB 1MIRA 3QSDA 2G7YA 2HHNA 1AYWA 4QBBA 1KHPA 5CVNB 1X9YA 4DMYA 2FUDA 2Y6EA 3S3RA 1JQPA 4P6EA 2IPPB 2E01A 2DCCA 3CH3X 1Q6KA 1CS8A 9PAPA 2R9MA 1ZIVA 4BPVA 2NQGA 3I3TA 1VJVA 1K3BB 3OVZA 2HD5A
chains in the Genus database with same CATH superfamily
4ZUXU 2P0RA 2DC9A 2DJGB 2YJ8A 2H7JA 2BTWB 3LFYA 4D8BA 1CJLA 3W31A 2YJ2A 2DZZA 4IP3A 2IBIA 5FPWA 2ARYA 1ME4A 3CH2X 3H6SA 3PW3A 3PDFA 1QXPA 2G8JA 3S3QA 1TL9A 4P16A 3F5VA 3OVXA 4G54A 3ZUAA 3IMAA 3BWKA 3HWNA 2C0YA 3PSEA 4CDFB 3C9EA 2DOSA 1KHQA 1F29A 3KSEA 3PRMA 4MZOA 2FRQA 4DMXA 1CTEA 2FTDA 4BOZA 2DZYA 4MI7A 1QMYA 1AECA 3BPMA 1F2AA 1CPJA 3PNRA 5EF4A 3OF8A 3U8EA 3MORA 3N4CA 4YVAA 4PP2E 1YT7A 1AYVA 3QJ3A 5JH3A 2FT2A 3P5UA 1YK8A 1YALA 4CDDB 4I07A 4BQVA 4AXLA 1BQIA 4IUMA 1PPPA 4Q8HA 4OVZB 4D8IA 2O6XA 1NLJA 4KLBA 2XU5A 4N8WA 3TMPA 1KXRA 5CHTA 3MTVA 4RF0A 4R3DA 1NB3A 3BOWA 1BP4A 3MTNA 2R6NA 2YJBA 2AGAA 1CSBB 1YZBA 4PT5A 2B1MA 2DCBA 4OELA 1GECE 3NHEA 3HHIA 3P5WA 3BB7A 4W4UA 2JRIA 3BC3A 3H7DA 1GCBA 2AYNA 2G8EA 2R9NA 4RNAA 4BSQA 1MEMA 2DCAA 3B79A 6PADA 1YVBA 1POPA 3KX1A 2XU4A 1PPOA 4QH6A 3KWZA 4WURA 3V6CA 1U9VA 4BOPA 3OF9A 1CVZA 2DJFB 4OEMA 3RVVA 1XKGA 3OQCA 2YJCA 2B1NA 3K24A 2JQFR 5J94A 4A5UA 2FRAA 1MDWA 2OP3A 3BPFA 3RNVA 4HXDB 1AYUA 1A6RA 2G6DA 5A24A 4X6JA 1NB5A 3B21A 4ZTBA 2GFOA 2VHSA 1VSNA 2OZ2A 1DF0A 2BU3A 4M0WA 4YV8A 4BS6A 1ME3A 2NQDB 1BY8A 3AI8A 4BS5A 1PADA 2OULA 4XUIA 5F02A 4BOSA 4YYRA 2P86A 1F2CA 4FK5A 3MJ5A 3E1ZB 1AU0A 3N3GA 2WBFX 2AIMA 3GCBA 2DCDA 4YYVA 4W5BA 3HD3A 2FYEA 3O65A 2BTWA 3HHAA 4N79A 4PADA 3MP2A 3PBHA 4X6HA 1QOLA 1AU2A 1AU3A 2Y5BA 2NQIA 1MHWA 1SNKA 5JA7A 2XU3A 3E9SA 2R9OA 3IV2A 3ZNHA 2FE8A 4GUAA 1Y4HA 1PCIA 1NPZA 4WA6A 3RVWA 3WXGA 3DF0A 1DKIA 5EGWA 4Q8GA 4K7CA 1ZCMA 2E02A 3I06A 2R9CA 1SP4B 1KFUL 3USVA 4OVZA 2AVWA 3OISA 2AUXA 5EZSA 1F2BA 1DEUA 3MHHA 5PADA 1PIPA 2JQGR 4CDEB 1U9WA 4MSXA 3IOQA 1TLOA 4YYWA 1U5IA 3CBKA 4CZWA 1EWLA 1TU6A 1BGOA 4OW0A 2AS8A 2Z84A 3H8BA 3K8UA 4XZXA 1S4VA 2PBHA 1PBHA 3ERVA 4N4ZA 1PPNA 3O1GA 1THEA 2F7DA 3P5XA 1EWPA 1AU4A 1PE6A 2DC7A 2AUZA 1QDQA 4D8EA 2HWKA 8PCHA 5KO3A 2P7UA 5CVMA 2ACTA 3PHUA 2DC6A 1CB5A 4W5CA 4MZSA 1MEGA 3TNXA 3P5VA 3KWBX 4PP1A 4BOUA 3PRPA 2PREA 2AU1A 4RY2A 2PADA 2PNSA 2J7QA 3M99A 1MS6A 1Y08A 1NQCA 5K16A 1KFXL 5EZQA 4YYSA 1GMYA 2FO5A 4X6IA 2HH5A 3IUTA 3MHSA 4MM3B 2E00A 1PVJA 3BCNA 1EF7A 3IHPA 5CVOB 3QT4A 4RF1A 2HXZA 3TRKA 1PXVA 3BBAA 7PCKA 3WXFA 1CV8A 1M6DA 1EWOA 1ICFA 3K9MA 1IWDA 2NQAA 2E03A 2ATOA 2FQ9A 1AIMA 2F1GA 4RKXA 3V6EA 3CBJA 1ITOA 3KFQA 1YK7A 2CB5A 3PHXA 3PHWA 1NL6A 4QRGA 2VHFA 1GLOA 2BDLA 3KW9A 4FJCA 2CIOA 5CHVA 1PPDA 4XR7A 4HWYA 2DC8A 3N3KA 4YYQA 4YYUA 3BY4A 3RVXA 2YJ9A 2UZJA 4QRVA 3D6SA 2XU1A 1HUCB 3KKUA 4I05A 4QRXA 1U9XA 4PI3A 5JZEA 2AYOA 4AXMA 3H89A 3H8CA 1U9QX 4I04A 2R9FA 1CQDA 3LXSA 4BOQA 1ATKA 3W30A 2BDZA 1FH0A 3PT2A 1EWMA 3O0UA 1O0EA 3WXEA 4P6GA 5E6JA 2GHUA 3F75A 4FIPA 1STFE 2JTCA 3IEJA 4CDCB 1MIRA 3QSDA 2G7YA 2HHNA 3IFUA 1AYWA 4QBBA 1KHPA 5CVNB 1X9YA 4DMYA 2FUDA 4REZA 1UKFA 2Y6EA 3S3RA 1JQPA 4P6EA 3C0RA 2IPPB 2E01A 2DCCA 2J7QC 3CH3X 1Q6KA 1CS8A 9PAPA 2R9MA 1ZIVA 4BPVA 2NQGA 3I3TA 1VJVA 1K3BB 3OVZA 2HD5A
chains in the Genus database with same CATH topology
4ZUXU 2P0RA 2DC9A 2DJGB 2YJ8A 2H7JA 3LFYA 1CJLA 2YJ2A 2DZZA 2IBIA 5FPWA 2ARYA 1ME4A 3CH2X 3H6SA 3PW3A 3PDFA 1QXPA 2G8JA 3S3QA 1TL9A 3F5VA 3OVXA 4G54A 3ZUAA 3IMAA 3BWKA 3HWNA 2C0YA 4NV8A 4CDFB 3C9EA 1KHQA 1F29A 3KSEA 4MZOA 2FRQA 4DMXA 1CTEA 2FTDA 2DZYA 1QMYA 1AECA 3BPMA 1F2AA 1CPJA 3PNRA 5EF4A 3OF8A 3U8EA 3MORA 3N4CA 4YVAA 4PP2E 1YT7A 1AYVA 3QJ3A 5JH3A 2FT2A 3P5UA 1YK8A 1YALA 4CDDB 4I07A 4BQVA 4AXLA 1BQIA 1PPPA 2BSZA 4Q8HA 1W5RA 2VFCA 2O6XA 1NLJA 4KLBA 2XU5A 4N8WA 1KXRA 5CHTA 1NB3A 3BOWA 1BP4A 3MTNA 2R6NA 2YJBA 1CSBB 2B1MA 2DCBA 4OELA 1GECE 3NHEA 3HHIA 3P5WA 4W4UA 3BC3A 3H7DA 1GCBA 2AYNA 2G8EA 2R9NA 4BSQA 1MEMA 2DCAA 3B79A 6PADA 1YVBA 1POPA 3KX1A 2XU4A 1PPOA 4QH6A 3KWZA 3V6CA 1U9VA 3OF9A 1CVZA 2DJFB 4OEMA 3RVVA 1XKGA 2YJCA 2B1NA 3K24A 2JQFR 5J94A 2FRAA 1MDWA 2OP3A 3BPFA 1AYUA 1A6RA 2G6DA 5A24A 4X6JA 1NB5A 2GFOA 1W6FA 2VHSA 1VSNA 2OZ2A 1DF0A 4YV8A 4BS6A 1ME3A 2NQDB 1BY8A 3AI8A 4BS5A 1PADA 2OULA 4XUIA 5F02A 4YYRA 2P86A 1F2CA 4FK5A 3E1ZB 1AU0A 3N3GA 2WBFX 2AIMA 3GCBA 2DCDA 4YYVA 4W5BA 3HD3A 2FYEA 4BGFA 4NV7A 3HHAA 4N79A 4PADA 3PBHA 1GX3A 4X6HA 1QOLA 1AU2A 1AU3A 2Y5BA 2NQIA 1MHWA 1SNKA 5JA7A 2XU3A 2R9OA 3IV2A 1Y4HA 1PCIA 1NPZA 4WA6A 3RVWA 3WXGA 3DF0A 5EGWA 4Q8GA 4K7CA 1ZCMA 2E02A 3I06A 2R9CA 1SP4B 1KFUL 3USVA 2AVWA 3OISA 2AUXA 1F2BA 1DEUA 3MHHA 5PADA 1PIPA 2JQGR 4CDEB 1U9WA 4MSXA 3IOQA 1TLOA 4YYWA 1U5IA 3CBKA 4CZWA 1EWLA 1TU6A 1BGOA 2AS8A 1E2TA 3K8UA 3H8BA 1S4VA 2PBHA 1PBHA 3ERVA 4N4ZA 1PPNA 3O1GA 1THEA 2F7DA 3P5XA 1EWPA 1AU4A 1PE6A 2DC7A 2AUZA 1QDQA 8PCHA 2P7UA 5CVMA 2ACTA 2DC6A 1CB5A 4W5CA 4MZSA 1MEGA 3TNXA 3P5VA 3KWBX 4PP1A 2PREA 2AU1A 4RY2A 2PADA 2PNSA 3M99A 1MS6A 1Y08A 1NQCA 5K16A 1KFXL 4YYSA 1GMYA 2FO5A 4X6IA 2HH5A 3IUTA 3MHSA 2E00A 3BCNA 1EF7A 1W4TA 3IHPA 5CVOB 3QT4A 2HXZA 1PXVA 7PCKA 3WXFA 1CV8A 1M6DA 1EWOA 1ICFA 4GUZA 4C5PA 3K9MA 1IWDA 2NQAA 2E03A 2ATOA 2FQ9A 1AIMA 2F1GA 3V6EA 3CBJA 1ITOA 3KFQA 1YK7A 2CB5A 3LTWA 1NL6A 4QRGA 2VHFA 4B55A 1GLOA 2BDLA 3KW9A 4FJCA 2CIOA 5CHVA 1PPDA 4XR7A 4HWYA 2DC8A 3N3KA 4YYQA 4YYUA 3RVXA 2YJ9A 4QRVA 3D6SA 2XU1A 1HUCB 3KKUA 4I05A 4QRXA 1U9XA 4PI3A 2AYOA 4AXMA 3H89A 3H8CA 1U9QX 4I04A 2R9FA 1CQDA 3LXSA 1ATKA 2BDZA 1FH0A 1EWMA 3O0UA 1O0EA 3WXEA 4P6GA 2GHUA 3F75A 4FIPA 1STFE 3IEJA 4CDCB 1MIRA 3QSDA 2G7YA 2VFBA 2HHNA 1AYWA 4QBBA 1KHPA 5CVNB 1X9YA 4DMYA 2FUDA 2Y6EA 3S3RA 1JQPA 4P6EA 2IPPB 2E01A 2DCCA 3CH3X 1Q6KA 1CS8A 9PAPA 2R9MA 1ZIVA 4BPVA 2NQGA 3I3TA 3D9WA 1VJVA 1K3BB 3OVZA 2HD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX U;  2P0R A;  2DC9 A;  2DJG B;  2YJ8 A;  2H7J A;  3LFY A;  1CJL A;  2YJ2 A;  2DZZ A;  2IBI A;  5FPW A;  2ARY A;  1ME4 A;  3CH2 X;  3H6S A;  3PW3 A;  3PDF A;  1QXP A;  2G8J A;  3S3Q A;  1TL9 A;  3F5V A;  3OVX A;  4G54 A;  3ZUA A;  3IMA A;  3BWK A;  3HWN A;  2C0Y A;  4CDF B;  3C9E A;  1KHQ A;  1F29 A;  3KSE A;  4MZO A;  2FRQ A;  4DMX A;  1CTE A;  2FTD A;  2DZY A;  1QMY A;  1AEC A;  3BPM A;  1F2A A;  1CPJ A;  3PNR A;  5EF4 A;  3OF8 A;  3U8E A;  3MOR A;  3N4C A;  4YVA A;  4PP2 E;  1YT7 A;  1AYV A;  3QJ3 A;  5JH3 A;  2FT2 A;  3P5U A;  1YK8 A;  1YAL A;  4CDD B;  4I07 A;  4BQV A;  4AXL A;  1BQI A;  1PPP A;  4Q8H A;  2O6X A;  1NLJ A;  4KLB A;  2XU5 A;  4N8W A;  1KXR A;  5CHT A;  1NB3 A;  3BOW A;  1BP4 A;  3MTN A;  2R6N A;  2YJB A;  1CSB B;  2B1M A;  2DCB A;  4OEL A;  1GEC E;  3NHE A;  3HHI A;  3P5W A;  4W4U A;  3BC3 A;  3H7D A;  1GCB A;  2AYN A;  2G8E A;  2R9N A;  4BSQ A;  1MEM A;  2DCA A;  3B79 A;  6PAD A;  1YVB A;  1POP A;  3KX1 A;  2XU4 A;  1PPO A;  4QH6 A;  3KWZ A;  3V6C A;  1U9V A;  3OF9 A;  1CVZ A;  2DJF B;  4OEM A;  3RVV A;  1XKG A;  2YJC A;  2B1N A;  3K24 A;  2JQF R;  5J94 A;  2FRA A;  1MDW A;  2OP3 A;  3BPF A;  1AYU A;  1A6R A;  2G6D A;  5A24 A;  4X6J A;  1NB5 A;  2GFO A;  2VHS A;  1VSN A;  2OZ2 A;  1DF0 A;  4YV8 A;  4BS6 A;  1ME3 A;  2NQD B;  1BY8 A;  3AI8 A;  4BS5 A;  1PAD A;  2OUL A;  4XUI A;  5F02 A;  4YYR A;  2P86 A;  1F2C A;  4FK5 A;  3E1Z B;  1AU0 A;  3N3G A;  2WBF X;  2AIM A;  3GCB A;  2DCD A;  4YYV A;  4W5B A;  3HD3 A;  2FYE A;  3HHA A;  4N79 A;  4PAD A;  3PBH A;  4X6H A;  1QOL A;  1AU2 A;  1AU3 A;  2Y5B A;  2NQI A;  1MHW A;  1SNK A;  5JA7 A;  2XU3 A;  2R9O A;  3IV2 A;  1Y4H A;  1PCI A;  1NPZ A;  4WA6 A;  3RVW A;  3WXG A;  3DF0 A;  5EGW A;  4Q8G A;  4K7C A;  1ZCM A;  2E02 A;  3I06 A;  2R9C A;  1SP4 B;  1KFU L;  3USV A;  2AVW A;  3OIS A;  2AUX A;  1F2B A;  1DEU A;  3MHH A;  5PAD A;  1PIP A;  2JQG R;  4CDE B;  1U9W A;  4MSX A;  3IOQ A;  1TLO A;  4YYW A;  1U5I A;  3CBK A;  4CZW A;  1EWL A;  1TU6 A;  1BGO A;  2AS8 A;  3K8U A;  3H8B A;  1S4V A;  2PBH A;  1PBH A;  3ERV A;  4N4Z A;  1PPN A;  3O1G A;  1THE A;  2F7D A;  3P5X A;  1EWP A;  1AU4 A;  1PE6 A;  2DC7 A;  2AUZ A;  1QDQ A;  8PCH A;  2P7U A;  5CVM A;  2ACT A;  2DC6 A;  1CB5 A;  4W5C A;  4MZS A;  1MEG A;  3TNX A;  3P5V A;  3KWB X;  4PP1 A;  2PRE A;  2AU1 A;  4RY2 A;  2PAD A;  2PNS A;  3M99 A;  1MS6 A;  1Y08 A;  1NQC A;  5K16 A;  1KFX L;  4YYS A;  1GMY A;  2FO5 A;  4X6I A;  2HH5 A;  3IUT A;  3MHS A;  2E00 A;  3BCN A;  1EF7 A;  3IHP A;  5CVO B;  3QT4 A;  2HXZ A;  1PXV A;  7PCK A;  3WXF A;  1CV8 A;  1M6D A;  1EWO A;  1ICF A;  3K9M A;  1IWD A;  2NQA A;  2E03 A;  2ATO A;  2FQ9 A;  1AIM A;  2F1G A;  3V6E A;  3CBJ A;  1ITO A;  3KFQ A;  1YK7 A;  2CB5 A;  1NL6 A;  4QRG A;  2VHF A;  1GLO A;  2BDL A;  3KW9 A;  4FJC A;  2CIO A;  5CHV A;  1PPD A;  4XR7 A;  4HWY A;  2DC8 A;  3N3K A;  4YYQ A;  4YYU A;  3RVX A;  2YJ9 A;  4QRV A;  3D6S A;  2XU1 A;  1HUC B;  3KKU A;  4I05 A;  4QRX A;  1U9X A;  4PI3 A;  2AYO A;  4AXM A;  3H89 A;  3H8C A;  1U9Q X;  4I04 A;  2R9F A;  1CQD A;  3LXS A;  1ATK A;  2BDZ A;  1FH0 A;  1EWM A;  3O0U A;  1O0E A;  3WXE A;  4P6G A;  2GHU A;  3F75 A;  4FIP A;  1STF E;  3IEJ A;  4CDC B;  1MIR A;  3QSD A;  2G7Y A;  2HHN A;  1AYW A;  4QBB A;  1KHP A;  5CVN B;  1X9Y A;  4DMY A;  2FUD A;  2Y6E A;  3S3R A;  1JQP A;  4P6E A;  2IPP B;  2E01 A;  2DCC A;  3CH3 X;  1Q6K A;  1CS8 A;  9PAP A;  2R9M A;  1ZIV A;  4BPV A;  2NQG A;  3I3T A;  1VJV A;  1K3B B;  3OVZ A;  2HD5 A; 
#chains in the Genus database with same CATH topology
 4ZUX U;  2P0R A;  2DC9 A;  2DJG B;  2YJ8 A;  2H7J A;  2BTW B;  3LFY A;  4D8B A;  1CJL A;  3W31 A;  2YJ2 A;  2DZZ A;  4IP3 A;  2IBI A;  5FPW A;  2ARY A;  1ME4 A;  3CH2 X;  3H6S A;  3PW3 A;  3PDF A;  1QXP A;  2G8J A;  3S3Q A;  1TL9 A;  4P16 A;  3F5V A;  3OVX A;  4G54 A;  3ZUA A;  3IMA A;  3BWK A;  3HWN A;  2C0Y A;  3PSE A;  4CDF B;  3C9E A;  2DOS A;  1KHQ A;  1F29 A;  3KSE A;  3PRM A;  4MZO A;  2FRQ A;  4DMX A;  1CTE A;  2FTD A;  4BOZ A;  2DZY A;  4MI7 A;  1QMY A;  1AEC A;  3BPM A;  1F2A A;  1CPJ A;  3PNR A;  5EF4 A;  3OF8 A;  3U8E A;  3MOR A;  3N4C A;  4YVA A;  4PP2 E;  1YT7 A;  1AYV A;  3QJ3 A;  5JH3 A;  2FT2 A;  3P5U A;  1YK8 A;  1YAL A;  4CDD B;  4I07 A;  4BQV A;  4AXL A;  1BQI A;  4IUM A;  1PPP A;  4Q8H A;  4OVZ B;  4D8I A;  2O6X A;  1NLJ A;  4KLB A;  2XU5 A;  4N8W A;  3TMP A;  1KXR A;  5CHT A;  3MTV A;  4RF0 A;  4R3D A;  1NB3 A;  3BOW A;  1BP4 A;  3MTN A;  2R6N A;  2YJB A;  2AGA A;  1CSB B;  1YZB A;  4PT5 A;  2B1M A;  2DCB A;  4OEL A;  1GEC E;  3NHE A;  3HHI A;  3P5W A;  3BB7 A;  4W4U A;  2JRI A;  3BC3 A;  3H7D A;  1GCB A;  2AYN A;  2G8E A;  2R9N A;  4RNA A;  4BSQ A;  1MEM A;  2DCA A;  3B79 A;  6PAD A;  1YVB A;  1POP A;  3KX1 A;  2XU4 A;  1PPO A;  4QH6 A;  3KWZ A;  4WUR A;  3V6C A;  1U9V A;  4BOP A;  3OF9 A;  1CVZ A;  2DJF B;  4OEM A;  3RVV A;  1XKG A;  3OQC A;  2YJC A;  2B1N A;  3K24 A;  2JQF R;  5J94 A;  4A5U A;  2FRA A;  1MDW A;  2OP3 A;  3BPF A;  3RNV A;  4HXD B;  1AYU A;  1A6R A;  2G6D A;  5A24 A;  4X6J A;  1NB5 A;  3B21 A;  4ZTB A;  2GFO A;  2VHS A;  1VSN A;  2OZ2 A;  1DF0 A;  2BU3 A;  4M0W A;  4YV8 A;  4BS6 A;  1ME3 A;  2NQD B;  1BY8 A;  3AI8 A;  4BS5 A;  1PAD A;  2OUL A;  4XUI A;  5F02 A;  4BOS A;  4YYR A;  2P86 A;  1F2C A;  4FK5 A;  3MJ5 A;  3E1Z B;  1AU0 A;  3N3G A;  2WBF X;  2AIM A;  3GCB A;  2DCD A;  4YYV A;  4W5B A;  3HD3 A;  2FYE A;  3O65 A;  2BTW A;  3HHA A;  4N79 A;  4PAD A;  3MP2 A;  3PBH A;  4X6H A;  1QOL A;  1AU2 A;  1AU3 A;  2Y5B A;  2NQI A;  1MHW A;  1SNK A;  5JA7 A;  2XU3 A;  3E9S A;  2R9O A;  3IV2 A;  3ZNH A;  2FE8 A;  4GUA A;  1Y4H A;  1PCI A;  1NPZ A;  4WA6 A;  3RVW A;  3WXG A;  3DF0 A;  1DKI A;  5EGW A;  4Q8G A;  4K7C A;  1ZCM A;  2E02 A;  3I06 A;  2R9C A;  1SP4 B;  1KFU L;  3USV A;  4OVZ A;  2AVW A;  3OIS A;  2AUX A;  5EZS A;  1F2B A;  1DEU A;  3MHH A;  5PAD A;  1PIP A;  2JQG R;  4CDE B;  1U9W A;  4MSX A;  3IOQ A;  1TLO A;  4YYW A;  1U5I A;  3CBK A;  4CZW A;  1EWL A;  1TU6 A;  1BGO A;  4OW0 A;  2AS8 A;  2Z84 A;  3H8B A;  3K8U A;  4XZX A;  1S4V A;  2PBH A;  1PBH A;  3ERV A;  4N4Z A;  1PPN A;  3O1G A;  1THE A;  2F7D A;  3P5X A;  1EWP A;  1AU4 A;  1PE6 A;  2DC7 A;  2AUZ A;  1QDQ A;  4D8E A;  2HWK A;  8PCH A;  5KO3 A;  2P7U A;  5CVM A;  2ACT A;  3PHU A;  2DC6 A;  1CB5 A;  4W5C A;  4MZS A;  1MEG A;  3TNX A;  3P5V A;  3KWB X;  4PP1 A;  4BOU A;  3PRP A;  2PRE A;  2AU1 A;  4RY2 A;  2PAD A;  2PNS A;  2J7Q A;  3M99 A;  1MS6 A;  1Y08 A;  1NQC A;  5K16 A;  1KFX L;  5EZQ A;  4YYS A;  1GMY A;  2FO5 A;  4X6I A;  2HH5 A;  3IUT A;  3MHS A;  4MM3 B;  2E00 A;  1PVJ A;  3BCN A;  1EF7 A;  3IHP A;  5CVO B;  3QT4 A;  4RF1 A;  2HXZ A;  3TRK A;  1PXV A;  3BBA A;  7PCK A;  3WXF A;  1CV8 A;  1M6D A;  1EWO A;  1ICF A;  3K9M A;  1IWD A;  2NQA A;  2E03 A;  2ATO A;  2FQ9 A;  1AIM A;  2F1G A;  4RKX A;  3V6E A;  3CBJ A;  1ITO A;  3KFQ A;  1YK7 A;  2CB5 A;  3PHX A;  3PHW A;  1NL6 A;  4QRG A;  2VHF A;  1GLO A;  2BDL A;  3KW9 A;  4FJC A;  2CIO A;  5CHV A;  1PPD A;  4XR7 A;  4HWY A;  2DC8 A;  3N3K A;  4YYQ A;  4YYU A;  3BY4 A;  3RVX A;  2YJ9 A;  2UZJ A;  4QRV A;  3D6S A;  2XU1 A;  1HUC B;  3KKU A;  4I05 A;  4QRX A;  1U9X A;  4PI3 A;  5JZE A;  2AYO A;  4AXM A;  3H89 A;  3H8C A;  1U9Q X;  4I04 A;  2R9F A;  1CQD A;  3LXS A;  4BOQ A;  1ATK A;  3W30 A;  2BDZ A;  1FH0 A;  3PT2 A;  1EWM A;  3O0U A;  1O0E A;  3WXE A;  4P6G A;  5E6J A;  2GHU A;  3F75 A;  4FIP A;  1STF E;  2JTC A;  3IEJ A;  4CDC B;  1MIR A;  3QSD A;  2G7Y A;  2HHN A;  3IFU A;  1AYW A;  4QBB A;  1KHP A;  5CVN B;  1X9Y A;  4DMY A;  2FUD A;  4REZ A;  1UKF A;  2Y6E A;  3S3R A;  1JQP A;  4P6E A;  3C0R A;  2IPP B;  2E01 A;  2DCC A;  2J7Q C;  3CH3 X;  1Q6K A;  1CS8 A;  9PAP A;  2R9M A;  1ZIV A;  4BPV A;  2NQG A;  3I3T A;  1VJV A;  1K3B B;  3OVZ A;  2HD5 A; 
#chains in the Genus database with same CATH homology
 4ZUX U;  2P0R A;  2DC9 A;  2DJG B;  2YJ8 A;  2H7J A;  3LFY A;  1CJL A;  2YJ2 A;  2DZZ A;  2IBI A;  5FPW A;  2ARY A;  1ME4 A;  3CH2 X;  3H6S A;  3PW3 A;  3PDF A;  1QXP A;  2G8J A;  3S3Q A;  1TL9 A;  3F5V A;  3OVX A;  4G54 A;  3ZUA A;  3IMA A;  3BWK A;  3HWN A;  2C0Y A;  4NV8 A;  4CDF B;  3C9E A;  1KHQ A;  1F29 A;  3KSE A;  4MZO A;  2FRQ A;  4DMX A;  1CTE A;  2FTD A;  2DZY A;  1QMY A;  1AEC A;  3BPM A;  1F2A A;  1CPJ A;  3PNR A;  5EF4 A;  3OF8 A;  3U8E A;  3MOR A;  3N4C A;  4YVA A;  4PP2 E;  1YT7 A;  1AYV A;  3QJ3 A;  5JH3 A;  2FT2 A;  3P5U A;  1YK8 A;  1YAL A;  4CDD B;  4I07 A;  4BQV A;  4AXL A;  1BQI A;  1PPP A;  2BSZ A;  4Q8H A;  1W5R A;  2VFC A;  2O6X A;  1NLJ A;  4KLB A;  2XU5 A;  4N8W A;  1KXR A;  5CHT A;  1NB3 A;  3BOW A;  1BP4 A;  3MTN A;  2R6N A;  2YJB A;  1CSB B;  2B1M A;  2DCB A;  4OEL A;  1GEC E;  3NHE A;  3HHI A;  3P5W A;  4W4U A;  3BC3 A;  3H7D A;  1GCB A;  2AYN A;  2G8E A;  2R9N A;  4BSQ A;  1MEM A;  2DCA A;  3B79 A;  6PAD A;  1YVB A;  1POP A;  3KX1 A;  2XU4 A;  1PPO A;  4QH6 A;  3KWZ A;  3V6C A;  1U9V A;  3OF9 A;  1CVZ A;  2DJF B;  4OEM A;  3RVV A;  1XKG A;  2YJC A;  2B1N A;  3K24 A;  2JQF R;  5J94 A;  2FRA A;  1MDW A;  2OP3 A;  3BPF A;  1AYU A;  1A6R A;  2G6D A;  5A24 A;  4X6J A;  1NB5 A;  2GFO A;  1W6F A;  2VHS A;  1VSN A;  2OZ2 A;  1DF0 A;  4YV8 A;  4BS6 A;  1ME3 A;  2NQD B;  1BY8 A;  3AI8 A;  4BS5 A;  1PAD A;  2OUL A;  4XUI A;  5F02 A;  4YYR A;  2P86 A;  1F2C A;  4FK5 A;  3E1Z B;  1AU0 A;  3N3G A;  2WBF X;  2AIM A;  3GCB A;  2DCD A;  4YYV A;  4W5B A;  3HD3 A;  2FYE A;  4BGF A;  4NV7 A;  3HHA A;  4N79 A;  4PAD A;  3PBH A;  1GX3 A;  4X6H A;  1QOL A;  1AU2 A;  1AU3 A;  2Y5B A;  2NQI A;  1MHW A;  1SNK A;  5JA7 A;  2XU3 A;  2R9O A;  3IV2 A;  1Y4H A;  1PCI A;  1NPZ A;  4WA6 A;  3RVW A;  3WXG A;  3DF0 A;  5EGW A;  4Q8G A;  4K7C A;  1ZCM A;  2E02 A;  3I06 A;  2R9C A;  1SP4 B;  1KFU L;  3USV A;  2AVW A;  3OIS A;  2AUX A;  1F2B A;  1DEU A;  3MHH A;  5PAD A;  1PIP A;  2JQG R;  4CDE B;  1U9W A;  4MSX A;  3IOQ A;  1TLO A;  4YYW A;  1U5I A;  3CBK A;  4CZW A;  1EWL A;  1TU6 A;  1BGO A;  2AS8 A;  1E2T A;  3K8U A;  3H8B A;  1S4V A;  2PBH A;  1PBH A;  3ERV A;  4N4Z A;  1PPN A;  3O1G A;  1THE A;  2F7D A;  3P5X A;  1EWP A;  1AU4 A;  1PE6 A;  2DC7 A;  2AUZ A;  1QDQ A;  8PCH A;  2P7U A;  5CVM A;  2ACT A;  2DC6 A;  1CB5 A;  4W5C A;  4MZS A;  1MEG A;  3TNX A;  3P5V A;  3KWB X;  4PP1 A;  2PRE A;  2AU1 A;  4RY2 A;  2PAD A;  2PNS A;  3M99 A;  1MS6 A;  1Y08 A;  1NQC A;  5K16 A;  1KFX L;  4YYS A;  1GMY A;  2FO5 A;  4X6I A;  2HH5 A;  3IUT A;  3MHS A;  2E00 A;  3BCN A;  1EF7 A;  1W4T A;  3IHP A;  5CVO B;  3QT4 A;  2HXZ A;  1PXV A;  7PCK A;  3WXF A;  1CV8 A;  1M6D A;  1EWO A;  1ICF A;  4GUZ A;  4C5P A;  3K9M A;  1IWD A;  2NQA A;  2E03 A;  2ATO A;  2FQ9 A;  1AIM A;  2F1G A;  3V6E A;  3CBJ A;  1ITO A;  3KFQ A;  1YK7 A;  2CB5 A;  3LTW A;  1NL6 A;  4QRG A;  2VHF A;  4B55 A;  1GLO A;  2BDL A;  3KW9 A;  4FJC A;  2CIO A;  5CHV A;  1PPD A;  4XR7 A;  4HWY A;  2DC8 A;  3N3K A;  4YYQ A;  4YYU A;  3RVX A;  2YJ9 A;  4QRV A;  3D6S A;  2XU1 A;  1HUC B;  3KKU A;  4I05 A;  4QRX A;  1U9X A;  4PI3 A;  2AYO A;  4AXM A;  3H89 A;  3H8C A;  1U9Q X;  4I04 A;  2R9F A;  1CQD A;  3LXS A;  1ATK A;  2BDZ A;  1FH0 A;  1EWM A;  3O0U A;  1O0E A;  3WXE A;  4P6G A;  2GHU A;  3F75 A;  4FIP A;  1STF E;  3IEJ A;  4CDC B;  1MIR A;  3QSD A;  2G7Y A;  2VFB A;  2HHN A;  1AYW A;  4QBB A;  1KHP A;  5CVN B;  1X9Y A;  4DMY A;  2FUD A;  2Y6E A;  3S3R A;  1JQP A;  4P6E A;  2IPP B;  2E01 A;  2DCC A;  3CH3 X;  1Q6K A;  1CS8 A;  9PAP A;  2R9M A;  1ZIV A;  4BPV A;  2NQG A;  3I3T A;  3D9W A;  1VJV A;  1K3B B;  3OVZ A;  2HD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...