2AYOA

Structure of usp14 bound to ubquitin aldehyde
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
386
structure length
355
Chain Sequence
ASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 355
sequence length 386
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ayoA00
2VHFA 2XU3A 2YJCA 4CDFB 1PADA 3IV2A 1PPPA 1QOLA 2AIMA 1MHWA 4XUIA 4ZUXU 3KW9A 3IUTA 3K24A 2ATOA 2FRQA 1EWMA 4MSXA 4RY2A 1JQPA 3F75A 1PE6A 3O1GA 3K8UA 4BQVA 1GCBA 1CS8A 4W5BA 1YK7A 3KWZA 1EWOA 3E1ZB 2XU4A 1POPA 5PADA 4YYWA 3C9EA 2Y6EA 3V6EA 3USVA 2R9FA 1CV8A 2DCCA 2G7YA 4P6GA 3OVZA 5J94A 3RVXA 3IEJA 2R9CA 2DC6A 3CBJA 1PBHA 3GCBA 5A24A 1X9YA 2Y5BA 3CH3X 2AUZA 2BDZA 3MHSA 4X6HA 1MDWA 4PP1A 2R9OA 3M99A 2FQ9A 1CJLA 4KLBA 2HXZA 2XU5A 1PPDA 2YJ2A 2F7DA 1EWLA 4AXMA 1QXPA 4FJCA 4MZOA 4W5CA 2ACTA 2R9MA 2G6DA 3BC3A 2E02A 4YYSA 2OULA 1CTEA 7PCKA 2O6XA 1K3BB 4I07A 3P5XA 3PNRA 5CHTA 1ICFA 2FTDA 1ME3A 5JH3A 4W4UA 3KKUA 4X6IA 1BQIA 1NB5A 1ITOA 3P5VA 5EF4A 4QRVA 1KHPA 3KSEA 4QH6A 2IPPB 3TNXA 2DC7A 2JQFR 4N8WA 2G8EA 1Q6KA 5FPWA 1CPJA 4CZWA 5CVMA 2ARYA 4CDEB 3ERVA 1A6RA 4AXLA 3P5UA 2OZ2A 4QRXA 2DCBA 1TU6A 2XU1A 1NQCA 3BCNA 1DF0A 4N4ZA 3H6SA 1AU4A 4QRGA 1KFXL 2NQIA 3PBHA 3D6SA 1STFE 4X6JA 3LXSA 3N4CA 1TL9A 3N3GA 3RVWA 1PIPA 2CB5A 4PI3A 1FH0A 1U5IA 1CSBB 4XR7A 2WBFX 1Y08A 3IOQA 1MIRA 3OF8A 1AU0A 2C0YA 2YJ9A 1KHQA 4QBBA 2B1MA 1VSNA 1NB3A 4YYRA 3KWBX 3WXEA 3PDFA 3AI8A 1EF7A 2FT2A 1AYUA 3MORA 3OF9A 4WA6A 4BS5A 1THEA 2PREA 2YJBA 5F02A 1F2CA 3IHPA 2CIOA 1VJVA 1S4VA 1HUCB 2JQGR 2PNSA 2PBHA 2VHSA 1CB5A 6PADA 1U9XA 1ZIVA 2DZZA 1SNKA 4MZSA 2G8JA 5K16A 3HWNA 4YYVA 3DF0A 3H7DA 1AU3A 4N79A 2R6NA 1PXVA 3S3QA 3IMAA 1F2BA 2P86A 1XKGA 2DCAA 4BSQA 4PADA 1MEGA 2HHNA 1QDQA 4CDDB 2HD5A 1AYWA 1U9QX 4YVAA 2OP3A 4Q8GA 2FYEA 3KX1A 1CQDA 3B79A 2AYOA 5EGWA 3WXGA 1U9WA 3V6CA 3NHEA 3OISA 3CH2X 1ATKA 3H8BA 4HWYA 1BP4A 2H7JA 3BPFA 1ME4A 2FO5A 2AS8A 2AVWA 1F29A 3H8CA 4FK5A 3HHAA 4YV8A 1KXRA 2NQAA 3BWKA 3PW3A 4I05A 1YVBA 3LFYA 4I04A 3CBKA 3F5VA 2FRAA 1SP4B 1ZCMA 3BOWA 1YALA 4FIPA 1BY8A 1O0EA 3MHHA 4BS6A 4P6EA 1BGOA 4G54A 1AU2A 2AU1A 2PADA 1M6DA 4YYQA 1GMYA 3ZUAA 1Y4HA 2DZYA 2DJFB 5CHVA 1CVZA 4K7CA 2GFOA 2YJ8A 3I3TA 3MTNA 1NL6A 3KFQA 5CVNB 1PPNA 4OEMA 4OELA 5CVOB 3OVXA 5JA7A 1NPZA 1AIMA 1U9VA 2F1GA 4YYUA 1GLOA 2BDLA 1NLJA 3RVVA 3QSDA 2R9NA 1F2AA 2HH5A 2NQDB 3H89A 2DC9A 1MS6A 2GHUA 3HD3A 1AECA 3O0UA 4DMYA 3QJ3A 2DCDA 1AYVA 1PPOA 3K9MA 1YK8A 2FUDA 2E00A 3QT4A 1EWPA 1TLOA 3WXFA 2AUXA 8PCHA 2B1NA 4Q8HA 3N3KA 2E03A 2DJGB 1PCIA 4BPVA 1DEUA 2P7UA 3BPMA 2IBIA 3HHIA 3P5WA 4CDCB 2NQGA 9PAPA 2E01A 1KFUL 3I06A 2AYNA 1MEMA 4DMXA 3U8EA 1YT7A 2P0RA 4PP2E 2DC8A 1QMYA 3S3RA 1IWDA 1GECE
chains in the Genus database with same CATH superfamily
2VHFA 2XU3A 2YJCA 4RNAA 4CDFB 1PADA 2BTWA 3IV2A 1PPPA 1QOLA 2AIMA 1MHWA 4XUIA 4ZUXU 3KW9A 3IUTA 3K24A 2ATOA 3B21A 2FRQA 1EWMA 4MSXA 4RY2A 1JQPA 3F75A 1PE6A 3ZNHA 3O1GA 3K8UA 3MP2A 1GCBA 1CS8A 4BQVA 4W5BA 1YK7A 1YZBA 3KWZA 1EWOA 3E1ZB 2XU4A 4M0WA 1POPA 5PADA 4YYWA 3C9EA 2Y6EA 3V6EA 3USVA 2R9FA 1CV8A 2DCCA 2G7YA 3PRMA 4P6GA 3OVZA 4OVZA 5J94A 3RVXA 3IEJA 2R9CA 2DC6A 3BBAA 3CBJA 1PBHA 3GCBA 5A24A 5EZSA 1X9YA 2Y5BA 3CH3X 2AUZA 2BDZA 3MHSA 4X6HA 1MDWA 4PP1A 2R9OA 3M99A 2FQ9A 2UZJA 1CJLA 4KLBA 4D8EA 2HXZA 2XU5A 1PPDA 2YJ2A 2F7DA 1EWLA 4AXMA 1QXPA 4FJCA 4MZOA 4W5CA 2ACTA 2R9MA 2G6DA 3BC3A 2E02A 4YYSA 2OULA 1CTEA 7PCKA 2O6XA 1K3BB 4I07A 3P5XA 5KO3A 3PNRA 5CHTA 1ICFA 2FTDA 1ME3A 5JH3A 4W4UA 3KKUA 4X6IA 1BQIA 1NB5A 1ITOA 3P5VA 5EF4A 4QRVA 1KHPA 3KSEA 4QH6A 2IPPB 3TNXA 3MTVA 2DC7A 2JQFR 4N8WA 2G8EA 1Q6KA 5FPWA 1CPJA 4CZWA 5CVMA 2ARYA 4CDEB 1UKFA 3ERVA 1A6RA 4AXLA 3P5UA 2OZ2A 4GUAA 4QRXA 2DCBA 1TU6A 5EZQA 2XU1A 4RF1A 1NQCA 3BCNA 1DF0A 4N4ZA 3H6SA 1AU4A 4QRGA 1KFXL 2NQIA 3PBHA 3D6SA 1STFE 4X6JA 3LXSA 3N4CA 1TL9A 3N3GA 4XZXA 3RNVA 3RVWA 1PIPA 2CB5A 4PI3A 1FH0A 3C0RA 4R3DA 1U5IA 3OQCA 1CSBB 4XR7A 2WBFX 4OVZB 1Y08A 4RKXA 3TMPA 3IOQA 1MIRA 3OF8A 1AU0A 2C0YA 2YJ9A 1KHQA 4QBBA 2B1MA 1VSNA 1NB3A 4YYRA 3KWBX 3WXEA 3PDFA 3AI8A 1PVJA 1EF7A 2FT2A 1AYUA 3MORA 3OF9A 4WA6A 4BS5A 1THEA 2PREA 2YJBA 2JTCA 5F02A 1F2CA 3IHPA 2CIOA 1VJVA 1S4VA 2AGAA 1HUCB 2JQGR 2PNSA 2PBHA 2VHSA 1CB5A 6PADA 1U9XA 1ZIVA 2DZZA 1SNKA 4MZSA 2G8JA 5K16A 3HWNA 4YYVA 3DF0A 3H7DA 1AU3A 4N79A 2R6NA 1PXVA 3S3QA 3IMAA 1F2BA 2DOSA 2P86A 4REZA 1XKGA 3TRKA 2DCAA 4BSQA 4OW0A 4PADA 1MEGA 2HHNA 3PHXA 1QDQA 4CDDB 2HD5A 3BB7A 1AYWA 1U9QX 4YVAA 2OP3A 4Q8GA 2FYEA 3KX1A 3E9SA 1CQDA 3B79A 2AYOA 5EGWA 3WXGA 4PT5A 1U9WA 2BU3A 3W31A 3V6CA 3NHEA 2BTWB 3OISA 3CH2X 4RF0A 2FE8A 1ATKA 3H8BA 4HWYA 1BP4A 2H7JA 3BPFA 1ME4A 3PT2A 4WURA 2FO5A 2AS8A 2J7QC 2Z84A 2AVWA 1F29A 3H8CA 4FK5A 3HHAA 4YV8A 1KXRA 2NQAA 3BWKA 3PW3A 4I05A 3PHWA 1YVBA 4IUMA 3LFYA 4I04A 3CBKA 3F5VA 1DKIA 2FRAA 4P16A 1SP4B 1ZCMA 2J7QA 3BOWA 3PSEA 1YALA 4FIPA 4MM3B 1BY8A 1O0EA 3MHHA 4BS6A 4P6EA 1BGOA 4G54A 1AU2A 2AU1A 2PADA 1M6DA 4YYQA 1GMYA 3ZUAA 1Y4HA 4HXDB 2DZYA 4BOPA 2DJFB 4A5UA 5CHVA 1CVZA 4BOQA 4K7CA 2GFOA 2YJ8A 3I3TA 4BOUA 3MTNA 1NL6A 4BOSA 3KFQA 5CVNB 4D8BA 1PPNA 3O65A 4OEMA 4OELA 5CVOB 3OVXA 3IFUA 4MI7A 5JA7A 1NPZA 2JRIA 1AIMA 1U9VA 2F1GA 4YYUA 5JZEA 1GLOA 3PHUA 2BDLA 1NLJA 3RVVA 3QSDA 2R9NA 1F2AA 2HH5A 4D8IA 2NQDB 4IP3A 3H89A 2DC9A 1MS6A 2GHUA 3HD3A 1AECA 5E6JA 3O0UA 4ZTBA 4DMYA 3QJ3A 2DCDA 1AYVA 1PPOA 3K9MA 1YK8A 2FUDA 3MJ5A 2E00A 3QT4A 1EWPA 1TLOA 3WXFA 2AUXA 8PCHA 2B1NA 4Q8HA 4BOZA 3N3KA 2E03A 2DJGB 1PCIA 4BPVA 1DEUA 2P7UA 3BPMA 2IBIA 3HHIA 3P5WA 4CDCB 3PRPA 2NQGA 9PAPA 2E01A 1KFUL 3I06A 3W30A 2AYNA 1MEMA 4DMXA 3U8EA 1YT7A 2P0RA 4PP2E 3BY4A 2DC8A 2HWKA 1QMYA 3S3RA 1IWDA 1GECE
chains in the Genus database with same CATH topology
2VHFA 2XU3A 2YJCA 4CDFB 1PADA 3IV2A 1PPPA 1QOLA 2AIMA 1MHWA 4XUIA 4ZUXU 3KW9A 3IUTA 3K24A 2ATOA 2FRQA 1EWMA 3LTWA 4MSXA 4RY2A 1JQPA 3F75A 1PE6A 3O1GA 3K8UA 4BQVA 1GCBA 1CS8A 4W5BA 1YK7A 3KWZA 1EWOA 3E1ZB 2XU4A 1POPA 5PADA 4YYWA 3C9EA 2Y6EA 3V6EA 3USVA 2R9FA 1CV8A 2DCCA 2G7YA 4P6GA 3OVZA 5J94A 3RVXA 1E2TA 3IEJA 2R9CA 2DC6A 3CBJA 1PBHA 3GCBA 5A24A 1X9YA 2Y5BA 3CH3X 2AUZA 2BDZA 3MHSA 4X6HA 1MDWA 4PP1A 2R9OA 3M99A 2FQ9A 1CJLA 4KLBA 2HXZA 2XU5A 1PPDA 2YJ2A 2F7DA 1EWLA 4AXMA 1QXPA 4FJCA 1W5RA 4MZOA 4W5CA 2ACTA 2R9MA 2G6DA 3BC3A 2BSZA 2E02A 4YYSA 2OULA 1CTEA 7PCKA 2O6XA 1K3BB 4I07A 3P5XA 3PNRA 5CHTA 1ICFA 2FTDA 1ME3A 5JH3A 4W4UA 3KKUA 4X6IA 1BQIA 1NB5A 1ITOA 3P5VA 5EF4A 4QRVA 1KHPA 3KSEA 4QH6A 2IPPB 3TNXA 2DC7A 2JQFR 4N8WA 2G8EA 1Q6KA 5FPWA 1CPJA 4CZWA 5CVMA 2ARYA 4CDEB 3ERVA 1A6RA 4AXLA 3P5UA 2OZ2A 4QRXA 2DCBA 1TU6A 3D9WA 2VFCA 2XU1A 1NQCA 3BCNA 1DF0A 4N4ZA 3H6SA 1AU4A 4QRGA 1KFXL 2NQIA 3PBHA 3D6SA 1STFE 4X6JA 3LXSA 3N4CA 1TL9A 3N3GA 3RVWA 1PIPA 4NV8A 2CB5A 4PI3A 1FH0A 4BGFA 1U5IA 1CSBB 4XR7A 2WBFX 1Y08A 3IOQA 1MIRA 3OF8A 1AU0A 2C0YA 2YJ9A 1KHQA 4QBBA 2B1MA 1VSNA 1NB3A 4YYRA 3KWBX 3WXEA 3PDFA 3AI8A 1GX3A 1EF7A 2FT2A 1AYUA 3MORA 3OF9A 4WA6A 4BS5A 1THEA 2PREA 2YJBA 5F02A 1F2CA 3IHPA 2CIOA 1VJVA 1S4VA 1HUCB 2JQGR 2PNSA 2PBHA 2VHSA 1CB5A 6PADA 1U9XA 1ZIVA 2DZZA 1SNKA 4MZSA 2G8JA 5K16A 3HWNA 4YYVA 3DF0A 3H7DA 1AU3A 4N79A 2R6NA 1PXVA 3S3QA 3IMAA 1W4TA 1F2BA 2P86A 1XKGA 2DCAA 4BSQA 4PADA 1MEGA 2HHNA 1QDQA 4CDDB 2HD5A 1AYWA 1U9QX 4YVAA 4B55A 2OP3A 4Q8GA 2FYEA 3KX1A 1CQDA 3B79A 2AYOA 5EGWA 3WXGA 1U9WA 3V6CA 3NHEA 3OISA 3CH2X 1ATKA 3H8BA 4NV7A 4HWYA 1BP4A 2H7JA 3BPFA 1ME4A 2FO5A 2AS8A 2AVWA 2VFBA 1F29A 3H8CA 1W6FA 4FK5A 3HHAA 4YV8A 1KXRA 2NQAA 3BWKA 3PW3A 4I05A 1YVBA 3LFYA 4I04A 3CBKA 3F5VA 2FRAA 1SP4B 1ZCMA 3BOWA 1YALA 4FIPA 1BY8A 1O0EA 3MHHA 4BS6A 4P6EA 1BGOA 4G54A 1AU2A 2AU1A 2PADA 1M6DA 4YYQA 1GMYA 3ZUAA 1Y4HA 2DZYA 2DJFB 5CHVA 1CVZA 4K7CA 2GFOA 2YJ8A 3I3TA 3MTNA 1NL6A 3KFQA 5CVNB 1PPNA 4OEMA 4OELA 5CVOB 3OVXA 5JA7A 1NPZA 4C5PA 1AIMA 1U9VA 2F1GA 4YYUA 4GUZA 1GLOA 2BDLA 1NLJA 3RVVA 3QSDA 2R9NA 1F2AA 2HH5A 2NQDB 3H89A 2DC9A 1MS6A 2GHUA 3HD3A 1AECA 3O0UA 4DMYA 3QJ3A 2DCDA 1AYVA 1PPOA 3K9MA 1YK8A 2FUDA 2E00A 3QT4A 1EWPA 1TLOA 3WXFA 2AUXA 8PCHA 2B1NA 4Q8HA 3N3KA 2E03A 2DJGB 1PCIA 4BPVA 1DEUA 2P7UA 3BPMA 2IBIA 3HHIA 3P5WA 4CDCB 2NQGA 9PAPA 2E01A 1KFUL 3I06A 2AYNA 1MEMA 4DMXA 3U8EA 1YT7A 2P0RA 4PP2E 2DC8A 1QMYA 3S3RA 1IWDA 1GECE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VHF A;  2XU3 A;  2YJC A;  4CDF B;  1PAD A;  3IV2 A;  1PPP A;  1QOL A;  2AIM A;  1MHW A;  4XUI A;  4ZUX U;  3KW9 A;  3IUT A;  3K24 A;  2ATO A;  2FRQ A;  1EWM A;  4MSX A;  4RY2 A;  1JQP A;  3F75 A;  1PE6 A;  3O1G A;  3K8U A;  4BQV A;  1GCB A;  1CS8 A;  4W5B A;  1YK7 A;  3KWZ A;  1EWO A;  3E1Z B;  2XU4 A;  1POP A;  5PAD A;  4YYW A;  3C9E A;  2Y6E A;  3V6E A;  3USV A;  2R9F A;  1CV8 A;  2DCC A;  2G7Y A;  4P6G A;  3OVZ A;  5J94 A;  3RVX A;  3IEJ A;  2R9C A;  2DC6 A;  3CBJ A;  1PBH A;  3GCB A;  5A24 A;  1X9Y A;  2Y5B A;  3CH3 X;  2AUZ A;  2BDZ A;  3MHS A;  4X6H A;  1MDW A;  4PP1 A;  2R9O A;  3M99 A;  2FQ9 A;  1CJL A;  4KLB A;  2HXZ A;  2XU5 A;  1PPD A;  2YJ2 A;  2F7D A;  1EWL A;  4AXM A;  1QXP A;  4FJC A;  4MZO A;  4W5C A;  2ACT A;  2R9M A;  2G6D A;  3BC3 A;  2E02 A;  4YYS A;  2OUL A;  1CTE A;  7PCK A;  2O6X A;  1K3B B;  4I07 A;  3P5X A;  3PNR A;  5CHT A;  1ICF A;  2FTD A;  1ME3 A;  5JH3 A;  4W4U A;  3KKU A;  4X6I A;  1BQI A;  1NB5 A;  1ITO A;  3P5V A;  5EF4 A;  4QRV A;  1KHP A;  3KSE A;  4QH6 A;  2IPP B;  3TNX A;  2DC7 A;  2JQF R;  4N8W A;  2G8E A;  1Q6K A;  5FPW A;  1CPJ A;  4CZW A;  5CVM A;  2ARY A;  4CDE B;  3ERV A;  1A6R A;  4AXL A;  3P5U A;  2OZ2 A;  4QRX A;  2DCB A;  1TU6 A;  2XU1 A;  1NQC A;  3BCN A;  1DF0 A;  4N4Z A;  3H6S A;  1AU4 A;  4QRG A;  1KFX L;  2NQI A;  3PBH A;  3D6S A;  1STF E;  4X6J A;  3LXS A;  3N4C A;  1TL9 A;  3N3G A;  3RVW A;  1PIP A;  2CB5 A;  4PI3 A;  1FH0 A;  1U5I A;  1CSB B;  4XR7 A;  2WBF X;  1Y08 A;  3IOQ A;  1MIR A;  3OF8 A;  1AU0 A;  2C0Y A;  2YJ9 A;  1KHQ A;  4QBB A;  2B1M A;  1VSN A;  1NB3 A;  4YYR A;  3KWB X;  3WXE A;  3PDF A;  3AI8 A;  1EF7 A;  2FT2 A;  1AYU A;  3MOR A;  3OF9 A;  4WA6 A;  4BS5 A;  1THE A;  2PRE A;  2YJB A;  5F02 A;  1F2C A;  3IHP A;  2CIO A;  1VJV A;  1S4V A;  1HUC B;  2JQG R;  2PNS A;  2PBH A;  2VHS A;  1CB5 A;  6PAD A;  1U9X A;  1ZIV A;  2DZZ A;  1SNK A;  4MZS A;  2G8J A;  5K16 A;  3HWN A;  4YYV A;  3DF0 A;  3H7D A;  1AU3 A;  4N79 A;  2R6N A;  1PXV A;  3S3Q A;  3IMA A;  1F2B A;  2P86 A;  1XKG A;  2DCA A;  4BSQ A;  4PAD A;  1MEG A;  2HHN A;  1QDQ A;  4CDD B;  2HD5 A;  1AYW A;  1U9Q X;  4YVA A;  2OP3 A;  4Q8G A;  2FYE A;  3KX1 A;  1CQD A;  3B79 A;  2AYO A;  5EGW A;  3WXG A;  1U9W A;  3V6C A;  3NHE A;  3OIS A;  3CH2 X;  1ATK A;  3H8B A;  4HWY A;  1BP4 A;  2H7J A;  3BPF A;  1ME4 A;  2FO5 A;  2AS8 A;  2AVW A;  1F29 A;  3H8C A;  4FK5 A;  3HHA A;  4YV8 A;  1KXR A;  2NQA A;  3BWK A;  3PW3 A;  4I05 A;  1YVB A;  3LFY A;  4I04 A;  3CBK A;  3F5V A;  2FRA A;  1SP4 B;  1ZCM A;  3BOW A;  1YAL A;  4FIP A;  1BY8 A;  1O0E A;  3MHH A;  4BS6 A;  4P6E A;  1BGO A;  4G54 A;  1AU2 A;  2AU1 A;  2PAD A;  1M6D A;  4YYQ A;  1GMY A;  3ZUA A;  1Y4H A;  2DZY A;  2DJF B;  5CHV A;  1CVZ A;  4K7C A;  2GFO A;  2YJ8 A;  3I3T A;  3MTN A;  1NL6 A;  3KFQ A;  5CVN B;  1PPN A;  4OEM A;  4OEL A;  5CVO B;  3OVX A;  5JA7 A;  1NPZ A;  1AIM A;  1U9V A;  2F1G A;  4YYU A;  1GLO A;  2BDL A;  1NLJ A;  3RVV A;  3QSD A;  2R9N A;  1F2A A;  2HH5 A;  2NQD B;  3H89 A;  2DC9 A;  1MS6 A;  2GHU A;  3HD3 A;  1AEC A;  3O0U A;  4DMY A;  3QJ3 A;  2DCD A;  1AYV A;  1PPO A;  3K9M A;  1YK8 A;  2FUD A;  2E00 A;  3QT4 A;  1EWP A;  1TLO A;  3WXF A;  2AUX A;  8PCH A;  2B1N A;  4Q8H A;  3N3K A;  2E03 A;  2DJG B;  1PCI A;  4BPV A;  1DEU A;  2P7U A;  3BPM A;  2IBI A;  3HHI A;  3P5W A;  4CDC B;  2NQG A;  9PAP A;  2E01 A;  1KFU L;  3I06 A;  2AYN A;  1MEM A;  4DMX A;  3U8E A;  1YT7 A;  2P0R A;  4PP2 E;  2DC8 A;  1QMY A;  3S3R A;  1IWD A;  1GEC E; 
#chains in the Genus database with same CATH topology
 2VHF A;  2XU3 A;  2YJC A;  4RNA A;  4CDF B;  1PAD A;  2BTW A;  3IV2 A;  1PPP A;  1QOL A;  2AIM A;  1MHW A;  4XUI A;  4ZUX U;  3KW9 A;  3IUT A;  3K24 A;  2ATO A;  3B21 A;  2FRQ A;  1EWM A;  4MSX A;  4RY2 A;  1JQP A;  3F75 A;  1PE6 A;  3ZNH A;  3O1G A;  3K8U A;  3MP2 A;  1GCB A;  1CS8 A;  4BQV A;  4W5B A;  1YK7 A;  1YZB A;  3KWZ A;  1EWO A;  3E1Z B;  2XU4 A;  4M0W A;  1POP A;  5PAD A;  4YYW A;  3C9E A;  2Y6E A;  3V6E A;  3USV A;  2R9F A;  1CV8 A;  2DCC A;  2G7Y A;  3PRM A;  4P6G A;  3OVZ A;  4OVZ A;  5J94 A;  3RVX A;  3IEJ A;  2R9C A;  2DC6 A;  3BBA A;  3CBJ A;  1PBH A;  3GCB A;  5A24 A;  5EZS A;  1X9Y A;  2Y5B A;  3CH3 X;  2AUZ A;  2BDZ A;  3MHS A;  4X6H A;  1MDW A;  4PP1 A;  2R9O A;  3M99 A;  2FQ9 A;  2UZJ A;  1CJL A;  4KLB A;  4D8E A;  2HXZ A;  2XU5 A;  1PPD A;  2YJ2 A;  2F7D A;  1EWL A;  4AXM A;  1QXP A;  4FJC A;  4MZO A;  4W5C A;  2ACT A;  2R9M A;  2G6D A;  3BC3 A;  2E02 A;  4YYS A;  2OUL A;  1CTE A;  7PCK A;  2O6X A;  1K3B B;  4I07 A;  3P5X A;  5KO3 A;  3PNR A;  5CHT A;  1ICF A;  2FTD A;  1ME3 A;  5JH3 A;  4W4U A;  3KKU A;  4X6I A;  1BQI A;  1NB5 A;  1ITO A;  3P5V A;  5EF4 A;  4QRV A;  1KHP A;  3KSE A;  4QH6 A;  2IPP B;  3TNX A;  3MTV A;  2DC7 A;  2JQF R;  4N8W A;  2G8E A;  1Q6K A;  5FPW A;  1CPJ A;  4CZW A;  5CVM A;  2ARY A;  4CDE B;  1UKF A;  3ERV A;  1A6R A;  4AXL A;  3P5U A;  2OZ2 A;  4GUA A;  4QRX A;  2DCB A;  1TU6 A;  5EZQ A;  2XU1 A;  4RF1 A;  1NQC A;  3BCN A;  1DF0 A;  4N4Z A;  3H6S A;  1AU4 A;  4QRG A;  1KFX L;  2NQI A;  3PBH A;  3D6S A;  1STF E;  4X6J A;  3LXS A;  3N4C A;  1TL9 A;  3N3G A;  4XZX A;  3RNV A;  3RVW A;  1PIP A;  2CB5 A;  4PI3 A;  1FH0 A;  3C0R A;  4R3D A;  1U5I A;  3OQC A;  1CSB B;  4XR7 A;  2WBF X;  4OVZ B;  1Y08 A;  4RKX A;  3TMP A;  3IOQ A;  1MIR A;  3OF8 A;  1AU0 A;  2C0Y A;  2YJ9 A;  1KHQ A;  4QBB A;  2B1M A;  1VSN A;  1NB3 A;  4YYR A;  3KWB X;  3WXE A;  3PDF A;  3AI8 A;  1PVJ A;  1EF7 A;  2FT2 A;  1AYU A;  3MOR A;  3OF9 A;  4WA6 A;  4BS5 A;  1THE A;  2PRE A;  2YJB A;  2JTC A;  5F02 A;  1F2C A;  3IHP A;  2CIO A;  1VJV A;  1S4V A;  2AGA A;  1HUC B;  2JQG R;  2PNS A;  2PBH A;  2VHS A;  1CB5 A;  6PAD A;  1U9X A;  1ZIV A;  2DZZ A;  1SNK A;  4MZS A;  2G8J A;  5K16 A;  3HWN A;  4YYV A;  3DF0 A;  3H7D A;  1AU3 A;  4N79 A;  2R6N A;  1PXV A;  3S3Q A;  3IMA A;  1F2B A;  2DOS A;  2P86 A;  4REZ A;  1XKG A;  3TRK A;  2DCA A;  4BSQ A;  4OW0 A;  4PAD A;  1MEG A;  2HHN A;  3PHX A;  1QDQ A;  4CDD B;  2HD5 A;  3BB7 A;  1AYW A;  1U9Q X;  4YVA A;  2OP3 A;  4Q8G A;  2FYE A;  3KX1 A;  3E9S A;  1CQD A;  3B79 A;  2AYO A;  5EGW A;  3WXG A;  4PT5 A;  1U9W A;  2BU3 A;  3W31 A;  3V6C A;  3NHE A;  2BTW B;  3OIS A;  3CH2 X;  4RF0 A;  2FE8 A;  1ATK A;  3H8B A;  4HWY A;  1BP4 A;  2H7J A;  3BPF A;  1ME4 A;  3PT2 A;  4WUR A;  2FO5 A;  2AS8 A;  2J7Q C;  2Z84 A;  2AVW A;  1F29 A;  3H8C A;  4FK5 A;  3HHA A;  4YV8 A;  1KXR A;  2NQA A;  3BWK A;  3PW3 A;  4I05 A;  3PHW A;  1YVB A;  4IUM A;  3LFY A;  4I04 A;  3CBK A;  3F5V A;  1DKI A;  2FRA A;  4P16 A;  1SP4 B;  1ZCM A;  2J7Q A;  3BOW A;  3PSE A;  1YAL A;  4FIP A;  4MM3 B;  1BY8 A;  1O0E A;  3MHH A;  4BS6 A;  4P6E A;  1BGO A;  4G54 A;  1AU2 A;  2AU1 A;  2PAD A;  1M6D A;  4YYQ A;  1GMY A;  3ZUA A;  1Y4H A;  4HXD B;  2DZY A;  4BOP A;  2DJF B;  4A5U A;  5CHV A;  1CVZ A;  4BOQ A;  4K7C A;  2GFO A;  2YJ8 A;  3I3T A;  4BOU A;  3MTN A;  1NL6 A;  4BOS A;  3KFQ A;  5CVN B;  4D8B A;  1PPN A;  3O65 A;  4OEM A;  4OEL A;  5CVO B;  3OVX A;  3IFU A;  4MI7 A;  5JA7 A;  1NPZ A;  2JRI A;  1AIM A;  1U9V A;  2F1G A;  4YYU A;  5JZE A;  1GLO A;  3PHU A;  2BDL A;  1NLJ A;  3RVV A;  3QSD A;  2R9N A;  1F2A A;  2HH5 A;  4D8I A;  2NQD B;  4IP3 A;  3H89 A;  2DC9 A;  1MS6 A;  2GHU A;  3HD3 A;  1AEC A;  5E6J A;  3O0U A;  4ZTB A;  4DMY A;  3QJ3 A;  2DCD A;  1AYV A;  1PPO A;  3K9M A;  1YK8 A;  2FUD A;  3MJ5 A;  2E00 A;  3QT4 A;  1EWP A;  1TLO A;  3WXF A;  2AUX A;  8PCH A;  2B1N A;  4Q8H A;  4BOZ A;  3N3K A;  2E03 A;  2DJG B;  1PCI A;  4BPV A;  1DEU A;  2P7U A;  3BPM A;  2IBI A;  3HHI A;  3P5W A;  4CDC B;  3PRP A;  2NQG A;  9PAP A;  2E01 A;  1KFU L;  3I06 A;  3W30 A;  2AYN A;  1MEM A;  4DMX A;  3U8E A;  1YT7 A;  2P0R A;  4PP2 E;  3BY4 A;  2DC8 A;  2HWK A;  1QMY A;  3S3R A;  1IWD A;  1GEC E; 
#chains in the Genus database with same CATH homology
 2VHF A;  2XU3 A;  2YJC A;  4CDF B;  1PAD A;  3IV2 A;  1PPP A;  1QOL A;  2AIM A;  1MHW A;  4XUI A;  4ZUX U;  3KW9 A;  3IUT A;  3K24 A;  2ATO A;  2FRQ A;  1EWM A;  3LTW A;  4MSX A;  4RY2 A;  1JQP A;  3F75 A;  1PE6 A;  3O1G A;  3K8U A;  4BQV A;  1GCB A;  1CS8 A;  4W5B A;  1YK7 A;  3KWZ A;  1EWO A;  3E1Z B;  2XU4 A;  1POP A;  5PAD A;  4YYW A;  3C9E A;  2Y6E A;  3V6E A;  3USV A;  2R9F A;  1CV8 A;  2DCC A;  2G7Y A;  4P6G A;  3OVZ A;  5J94 A;  3RVX A;  1E2T A;  3IEJ A;  2R9C A;  2DC6 A;  3CBJ A;  1PBH A;  3GCB A;  5A24 A;  1X9Y A;  2Y5B A;  3CH3 X;  2AUZ A;  2BDZ A;  3MHS A;  4X6H A;  1MDW A;  4PP1 A;  2R9O A;  3M99 A;  2FQ9 A;  1CJL A;  4KLB A;  2HXZ A;  2XU5 A;  1PPD A;  2YJ2 A;  2F7D A;  1EWL A;  4AXM A;  1QXP A;  4FJC A;  1W5R A;  4MZO A;  4W5C A;  2ACT A;  2R9M A;  2G6D A;  3BC3 A;  2BSZ A;  2E02 A;  4YYS A;  2OUL A;  1CTE A;  7PCK A;  2O6X A;  1K3B B;  4I07 A;  3P5X A;  3PNR A;  5CHT A;  1ICF A;  2FTD A;  1ME3 A;  5JH3 A;  4W4U A;  3KKU A;  4X6I A;  1BQI A;  1NB5 A;  1ITO A;  3P5V A;  5EF4 A;  4QRV A;  1KHP A;  3KSE A;  4QH6 A;  2IPP B;  3TNX A;  2DC7 A;  2JQF R;  4N8W A;  2G8E A;  1Q6K A;  5FPW A;  1CPJ A;  4CZW A;  5CVM A;  2ARY A;  4CDE B;  3ERV A;  1A6R A;  4AXL A;  3P5U A;  2OZ2 A;  4QRX A;  2DCB A;  1TU6 A;  3D9W A;  2VFC A;  2XU1 A;  1NQC A;  3BCN A;  1DF0 A;  4N4Z A;  3H6S A;  1AU4 A;  4QRG A;  1KFX L;  2NQI A;  3PBH A;  3D6S A;  1STF E;  4X6J A;  3LXS A;  3N4C A;  1TL9 A;  3N3G A;  3RVW A;  1PIP A;  4NV8 A;  2CB5 A;  4PI3 A;  1FH0 A;  4BGF A;  1U5I A;  1CSB B;  4XR7 A;  2WBF X;  1Y08 A;  3IOQ A;  1MIR A;  3OF8 A;  1AU0 A;  2C0Y A;  2YJ9 A;  1KHQ A;  4QBB A;  2B1M A;  1VSN A;  1NB3 A;  4YYR A;  3KWB X;  3WXE A;  3PDF A;  3AI8 A;  1GX3 A;  1EF7 A;  2FT2 A;  1AYU A;  3MOR A;  3OF9 A;  4WA6 A;  4BS5 A;  1THE A;  2PRE A;  2YJB A;  5F02 A;  1F2C A;  3IHP A;  2CIO A;  1VJV A;  1S4V A;  1HUC B;  2JQG R;  2PNS A;  2PBH A;  2VHS A;  1CB5 A;  6PAD A;  1U9X A;  1ZIV A;  2DZZ A;  1SNK A;  4MZS A;  2G8J A;  5K16 A;  3HWN A;  4YYV A;  3DF0 A;  3H7D A;  1AU3 A;  4N79 A;  2R6N A;  1PXV A;  3S3Q A;  3IMA A;  1W4T A;  1F2B A;  2P86 A;  1XKG A;  2DCA A;  4BSQ A;  4PAD A;  1MEG A;  2HHN A;  1QDQ A;  4CDD B;  2HD5 A;  1AYW A;  1U9Q X;  4YVA A;  4B55 A;  2OP3 A;  4Q8G A;  2FYE A;  3KX1 A;  1CQD A;  3B79 A;  2AYO A;  5EGW A;  3WXG A;  1U9W A;  3V6C A;  3NHE A;  3OIS A;  3CH2 X;  1ATK A;  3H8B A;  4NV7 A;  4HWY A;  1BP4 A;  2H7J A;  3BPF A;  1ME4 A;  2FO5 A;  2AS8 A;  2AVW A;  2VFB A;  1F29 A;  3H8C A;  1W6F A;  4FK5 A;  3HHA A;  4YV8 A;  1KXR A;  2NQA A;  3BWK A;  3PW3 A;  4I05 A;  1YVB A;  3LFY A;  4I04 A;  3CBK A;  3F5V A;  2FRA A;  1SP4 B;  1ZCM A;  3BOW A;  1YAL A;  4FIP A;  1BY8 A;  1O0E A;  3MHH A;  4BS6 A;  4P6E A;  1BGO A;  4G54 A;  1AU2 A;  2AU1 A;  2PAD A;  1M6D A;  4YYQ A;  1GMY A;  3ZUA A;  1Y4H A;  2DZY A;  2DJF B;  5CHV A;  1CVZ A;  4K7C A;  2GFO A;  2YJ8 A;  3I3T A;  3MTN A;  1NL6 A;  3KFQ A;  5CVN B;  1PPN A;  4OEM A;  4OEL A;  5CVO B;  3OVX A;  5JA7 A;  1NPZ A;  4C5P A;  1AIM A;  1U9V A;  2F1G A;  4YYU A;  4GUZ A;  1GLO A;  2BDL A;  1NLJ A;  3RVV A;  3QSD A;  2R9N A;  1F2A A;  2HH5 A;  2NQD B;  3H89 A;  2DC9 A;  1MS6 A;  2GHU A;  3HD3 A;  1AEC A;  3O0U A;  4DMY A;  3QJ3 A;  2DCD A;  1AYV A;  1PPO A;  3K9M A;  1YK8 A;  2FUD A;  2E00 A;  3QT4 A;  1EWP A;  1TLO A;  3WXF A;  2AUX A;  8PCH A;  2B1N A;  4Q8H A;  3N3K A;  2E03 A;  2DJG B;  1PCI A;  4BPV A;  1DEU A;  2P7U A;  3BPM A;  2IBI A;  3HHI A;  3P5W A;  4CDC B;  2NQG A;  9PAP A;  2E01 A;  1KFU L;  3I06 A;  2AYN A;  1MEM A;  4DMX A;  3U8E A;  1YT7 A;  2P0R A;  4PP2 E;  2DC8 A;  1QMY A;  3S3R A;  1IWD A;  1GEC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...