2AYOA

Structure of usp14 bound to ubquitin aldehyde
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
386
structure length
355
Chain Sequence
ASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
total genus 66
structure length 355
sequence length 386
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ayoA00
5A24A 1U9XA 3I3TA 4N79A 7PCKA 1Y4HA 4N8WA 1Q6KA 4I04A 3H7DA 3RVWA 2XU4A 4MZOA 3K8UA 4YVAA 2DJGB 1F29A 1KFXL 2GHUA 4N4ZA 4FJCA 4ZUXU 3BOWA 3MTNA 2HD5A 2FRQA 1ME3A 1CVZA 4QRXA 4BS6A 1GCBA 1CV8A 1PADA 4I07A 2FYEA 2AIMA 1CQDA 1F2BA 1ICFA 2FTDA 3E1ZB 2AYNA 1FH0A 4DMXA 5PADA 2PREA 3H6SA 3QSDA 8PCHA 4KLBA 1VSNA 4BPVA 1DF0A 3IEJA 2OULA 2AS8A 3WXFA 1PPNA 5CVMA 2YJ9A 2DC7A 1AYWA 1AYVA 2CB5A 4W4UA 2E03A 2OP3A 1PBHA 4YYWA 1KHPA 3P5VA 1NB3A 1POPA 3U8EA 1MEGA 2JQGR 2DCDA 4K7CA 1AU3A 1QXPA 3ZUAA 3OF8A 4X6JA 4BQVA 3PBHA 2NQDB 1BY8A 1DEUA 1MIRA 3KFQA 1QMYA 3F5VA 3NHEA 4FK5A 2DCCA 1EF7A 5EGWA 1PPDA 4YYVA 1F2CA 2DZZA 4YYQA 2NQAA 3S3RA 1ZIVA 1QDQA 1U9QX 1GLOA 3F75A 1NL6A 4OELA 5K16A 1YK8A 1NPZA 3KX1A 3BCNA 1YVBA 2E00A 3PW3A 4HWYA 4MZSA 5CHVA 1Y08A 3CBKA 4WA6A 5EF4A 2AU1A 4QRGA 1HUCB 4Q8GA 1F2AA 1PE6A 4W5CA 1TU6A 3USVA 9PAPA 2H7JA 1X9YA 1CSBB 2DCBA 4XUIA 2FQ9A 4YYUA 1U5IA 5J94A 3WXGA 4Q8HA 4YV8A 2R9MA 3D6SA 4W5BA 2NQGA 1MEMA 2ACTA 2B1MA 2XU3A 2P0RA 4OEMA 2HHNA 2AUZA 2F7DA 1PPPA 3N3KA 5CVOB 1CJLA 2DC6A 2XU1A 3HD3A 3BPFA 3DF0A 3OF9A 1BQIA 3IOQA 1STFE 4XR7A 3N3GA 3RVXA 3KWBX 4PP1A 2C0YA 3KW9A 3HWNA 1ATKA 3P5UA 1EWPA 1ZCMA 1YK7A 4AXLA 4AXMA 4RY2A 2VHSA 2DZYA 2FO5A 3OVXA 2P7UA 1U9VA 2FT2A 4DMYA 3IMAA 2R9NA 1PIPA 3ERVA 2G8EA 1A6RA 1AU2A 5JH3A 1BP4A 1KFUL 3MHHA 3HHIA 1JQPA 1QOLA 4P6EA 2YJ8A 3BPMA 1KHQA 3O0UA 2YJCA 4QBBA 4CDCB 2P86A 1AYUA 3HHAA 1PXVA 3WXEA 2YJBA 3LFYA 3K24A 4PI3A 1EWOA 3TNXA 4MSXA 1CS8A 1THEA 3BWKA 6PADA 2BDLA 2PBHA 2DCAA 5FPWA 1NQCA 3QJ3A 3KSEA 2Y6EA 3M99A 2F1GA 3PDFA 2ATOA 3MORA 3CH3X 2PADA 2GFOA 4CDEB 2YJ2A 2IBIA 3KKUA 1MDWA 2R6NA 2FUDA 1GMYA 3V6CA 3IV2A 1AIMA 1AU0A 4I05A 2JQFR 1MS6A 2O6XA 1XKGA 1NB5A 2IPPB 2AYOA 4PP2E 1O0EA 2PNSA 3OVZA 3KWZA 2DC8A 2NQIA 3K9MA 2DC9A 4QH6A 2R9FA 2G7YA 4P6GA 2R9CA 3AI8A 2CIOA 2BDZA 2AUXA 4YYRA 3P5XA 1K3BB 4YYSA 3I06A 1TLOA 2FRAA 3PNRA 5JA7A 1NLJA 3H8CA 1M6DA 1EWMA 4BSQA 2XU5A 2DJFB 4G54A 1YT7A 2R9OA 2E02A 1AU4A 3CH2X 3OISA 3BC3A 3O1GA 1IWDA 1VJVA 3IUTA 4X6HA 3C9EA 1CTEA 1PCIA 3QT4A 3GCBA 5CVNB 4CDDB 2HH5A 3CBJA 4QRVA 5F02A 3V6EA 5CHTA 4CDFB 3IHPA 3RVVA 1ITOA 1SNKA 2E01A 2G8JA 3S3QA 2HXZA 1GECE 3MHSA 1MHWA 4X6IA 4BS5A 1CPJA 3H8BA 3LXSA 1TL9A 4PADA 1KXRA 3P5WA 1S4VA 1AECA 2ARYA 1CB5A 1U9WA 1ME4A 2G6DA 2VHFA 1SP4B 2WBFX 3B79A 1PPOA 3H89A 1BGOA 2Y5BA 3N4CA 2B1NA 1YALA 4CZWA 1EWLA 2AVWA 4FIPA 2OZ2A
chains in the Genus database with same CATH superfamily
5A24A 4M0WA 1U9XA 3I3TA 3W31A 4N79A 7PCKA 1Y4HA 4N8WA 1Q6KA 4I04A 3H7DA 3RVWA 2XU4A 4P16A 4MZOA 3K8UA 4YVAA 2DJGB 1F29A 1KFXL 2GHUA 4N4ZA 3ZNHA 5JZEA 4FJCA 4ZUXU 3BOWA 3MTNA 2HD5A 3O65A 2FRQA 1ME3A 1CVZA 4QRXA 4BS6A 3OQCA 1GCBA 1CV8A 1PADA 4I07A 2FYEA 2AIMA 1CQDA 1F2BA 1ICFA 2FTDA 3E1ZB 2AYNA 1FH0A 2Z84A 4DMXA 5PADA 2PREA 3H6SA 3QSDA 8PCHA 4KLBA 1VSNA 4BPVA 1DF0A 4BOSA 3TMPA 3IEJA 4R3DA 2OULA 2AS8A 3WXFA 1PPNA 5CVMA 2YJ9A 1YZBA 2DC7A 4RF1A 1AYWA 1AYVA 2CB5A 4W4UA 2E03A 2OP3A 1PBHA 4YYWA 1KHPA 3P5VA 1NB3A 1POPA 1MEGA 2JQGR 3U8EA 2DCDA 4K7CA 1AU3A 1QXPA 3ZUAA 3OF8A 4X6JA 4OVZB 4BQVA 3PBHA 2BU3A 2NQDB 1BY8A 1DEUA 1MIRA 3KFQA 1QMYA 3F5VA 3NHEA 3PHXA 4FK5A 4RNAA 2BTWB 2DCCA 4BOZA 1EF7A 5EGWA 1PPDA 4YYVA 1F2CA 2DZZA 4YYQA 2NQAA 3S3RA 1ZIVA 3W30A 1QDQA 1U9QX 1GLOA 3F75A 1NL6A 4OELA 5K16A 1YK8A 1NPZA 3KX1A 3BCNA 1YVBA 2E00A 3PW3A 4HWYA 4MZSA 5CHVA 3TRKA 4A5UA 1Y08A 3CBKA 4BOQA 4WA6A 5EF4A 2AU1A 4QRGA 1HUCB 4Q8GA 1F2AA 1PE6A 4W5CA 1TU6A 3USVA 9PAPA 2H7JA 2BTWA 4PT5A 1X9YA 1CSBB 2DCBA 3PRPA 2JTCA 2FQ9A 4XUIA 4YYUA 1U5IA 5J94A 3WXGA 4Q8HA 3MTVA 4D8BA 4YV8A 2R9MA 3D6SA 4W5BA 4OW0A 2NQGA 1MEMA 2ACTA 2B1MA 2XU3A 3BBAA 2P0RA 4OEMA 2HHNA 2AUZA 2F7DA 1PPPA 3N3KA 5CVOB 1CJLA 2DC6A 3C0RA 2XU1A 3HD3A 3BPFA 3DF0A 3OF9A 1BQIA 3IOQA 4RF0A 1STFE 4XR7A 3N3GA 3RVXA 3KWBX 4PP1A 2C0YA 3KW9A 3HWNA 1ATKA 3P5UA 4GUAA 1EWPA 1ZCMA 1YK7A 4AXLA 4AXMA 1DKIA 4RY2A 2VHSA 2DZYA 2FO5A 3OVXA 2P7UA 1U9VA 2HWKA 2FT2A 4DMYA 3IMAA 2R9NA 1PIPA 3ERVA 2G8EA 1A6RA 1AU2A 5JH3A 1BP4A 1KFUL 4BOPA 3MHHA 3HHIA 1JQPA 4MI7A 1QOLA 4P6EA 2YJ8A 3BPMA 1KHQA 3MJ5A 3O0UA 4D8EA 2YJCA 4RKXA 4QBBA 3RNVA 4CDCB 2P86A 1AYUA 3HHAA 1PXVA 3WXEA 2YJBA 3LFYA 4IP3A 3K24A 4PI3A 1EWOA 3TNXA 2UZJA 4MSXA 3PRMA 1CS8A 1THEA 3BWKA 6PADA 2BDLA 4MM3B 5EZQA 2PBHA 2DCAA 5FPWA 2J7QC 4D8IA 1NQCA 3QJ3A 3KSEA 2Y6EA 3M99A 2F1GA 3PDFA 2ATOA 3MORA 3CH3X 4BOUA 2PADA 2GFOA 4CDEB 5EZSA 3BY4A 4REZA 2YJ2A 2IBIA 3PHWA 3E9SA 3KKUA 1MDWA 2R6NA 2FUDA 3MP2A 1PVJA 1GMYA 3V6CA 3IV2A 1AIMA 1AU0A 3B21A 4I05A 4OVZA 2JQFR 1MS6A 2O6XA 1XKGA 1NB5A 2IPPB 2AYOA 2JRIA 4PP2E 1O0EA 2PNSA 3OVZA 3KWZA 2DC8A 1UKFA 2NQIA 3K9MA 2DC9A 4QH6A 2R9FA 2G7YA 4P6GA 2R9CA 3AI8A 2CIOA 2BDZA 2AUXA 4YYRA 3P5XA 1K3BB 4YYSA 4WURA 3I06A 2AGAA 4HXDB 1TLOA 2FRAA 3PSEA 3PNRA 5JA7A 1NLJA 3PT2A 3H8CA 1M6DA 1EWMA 4BSQA 2XU5A 2DJFB 4G54A 1YT7A 2R9OA 2E02A 1AU4A 3PHUA 2FE8A 3CH2X 3OISA 3BC3A 3O1GA 3IFUA 1IWDA 1VJVA 3IUTA 4X6HA 4XZXA 3C9EA 1CTEA 1PCIA 3QT4A 3GCBA 5CVNB 4CDDB 2HH5A 3CBJA 4QRVA 5F02A 3V6EA 5CHTA 4CDFB 3IHPA 3RVVA 1ITOA 1SNKA 2E01A 2G8JA 3S3QA 2HXZA 1GECE 3MHSA 5E6JA 1MHWA 4X6IA 4BS5A 1CPJA 4ZTBA 3H8BA 3LXSA 1TL9A 4PADA 1KXRA 3P5WA 1S4VA 1AECA 2ARYA 1CB5A 5KO3A 1U9WA 4IUMA 1ME4A 2J7QA 2G6DA 2VHFA 3BB7A 1SP4B 2WBFX 3B79A 1PPOA 3H89A 1BGOA 2Y5BA 3N4CA 2B1NA 1YALA 4CZWA 1EWLA 2AVWA 4FIPA 2DOSA 2OZ2A
chains in the Genus database with same CATH topology
5A24A 1U9XA 3I3TA 4N79A 7PCKA 1Y4HA 4N8WA 1Q6KA 4I04A 3H7DA 3RVWA 2XU4A 4MZOA 3K8UA 4YVAA 2DJGB 1F29A 1KFXL 2GHUA 4N4ZA 4FJCA 4ZUXU 3BOWA 3MTNA 2HD5A 2FRQA 1ME3A 1CVZA 4QRXA 4BS6A 1GCBA 1CV8A 1PADA 4I07A 2FYEA 2AIMA 1CQDA 1F2BA 1ICFA 2FTDA 3E1ZB 2AYNA 1FH0A 4DMXA 5PADA 2PREA 3H6SA 3QSDA 8PCHA 4KLBA 1VSNA 4BPVA 1DF0A 3IEJA 2OULA 2AS8A 3WXFA 1PPNA 5CVMA 2YJ9A 2DC7A 1AYWA 1AYVA 2CB5A 4W4UA 2E03A 2OP3A 1PBHA 4YYWA 1KHPA 3P5VA 1NB3A 1POPA 1MEGA 2JQGR 3U8EA 2DCDA 4K7CA 1AU3A 1QXPA 3ZUAA 3OF8A 4X6JA 4BQVA 3PBHA 2NQDB 1BY8A 1DEUA 1MIRA 3KFQA 1QMYA 3F5VA 3NHEA 4FK5A 2DCCA 1EF7A 5EGWA 1PPDA 4YYVA 1F2CA 2DZZA 4YYQA 2NQAA 3S3RA 1ZIVA 1QDQA 1U9QX 1GLOA 3F75A 1NL6A 4OELA 2VFBA 3D9WA 5K16A 1W5RA 1YK8A 1NPZA 3KX1A 3BCNA 1YVBA 2E00A 3PW3A 4HWYA 4MZSA 5CHVA 1Y08A 3CBKA 4WA6A 5EF4A 2AU1A 4QRGA 1HUCB 4Q8GA 1F2AA 1PE6A 4W5CA 1TU6A 3USVA 9PAPA 2H7JA 1X9YA 1CSBB 2DCBA 4XUIA 2FQ9A 4YYUA 1U5IA 5J94A 3WXGA 4Q8HA 4YV8A 2R9MA 3D6SA 4W5BA 2NQGA 1MEMA 2ACTA 4B55A 2B1MA 2XU3A 2P0RA 4OEMA 2HHNA 2AUZA 2F7DA 1PPPA 3N3KA 5CVOB 1CJLA 2DC6A 2XU1A 3HD3A 3BPFA 3DF0A 3OF9A 1BQIA 3IOQA 1STFE 4XR7A 3N3GA 3RVXA 3KWBX 4PP1A 2C0YA 3KW9A 3HWNA 3LTWA 1ATKA 3P5UA 1EWPA 1ZCMA 1YK7A 4AXLA 4AXMA 4RY2A 2VHSA 2DZYA 2FO5A 3OVXA 2P7UA 1U9VA 2FT2A 4DMYA 3IMAA 2R9NA 1PIPA 3ERVA 2G8EA 1A6RA 1AU2A 5JH3A 1BP4A 1KFUL 3MHHA 3HHIA 1JQPA 1QOLA 4P6EA 2YJ8A 3BPMA 1KHQA 3O0UA 1W6FA 2YJCA 4QBBA 4CDCB 2P86A 1AYUA 3HHAA 1PXVA 3WXEA 2YJBA 3LFYA 3K24A 4PI3A 1EWOA 3TNXA 4MSXA 4GUZA 1CS8A 1THEA 3BWKA 6PADA 2BDLA 2PBHA 2DCAA 5FPWA 1NQCA 3QJ3A 3KSEA 2Y6EA 3M99A 2F1GA 3PDFA 2ATOA 3MORA 3CH3X 2PADA 2GFOA 4CDEB 2YJ2A 2IBIA 3KKUA 1MDWA 4NV7A 2VFCA 2R6NA 2FUDA 1GMYA 3V6CA 3IV2A 1AIMA 1AU0A 4I05A 2JQFR 1MS6A 2O6XA 1XKGA 1NB5A 2IPPB 2AYOA 4PP2E 1O0EA 2PNSA 3OVZA 3KWZA 2DC8A 2NQIA 3K9MA 2DC9A 4QH6A 2R9FA 2G7YA 4P6GA 2R9CA 3AI8A 2CIOA 2BDZA 2AUXA 4YYRA 3P5XA 1K3BB 4YYSA 3I06A 1GX3A 1TLOA 2FRAA 3PNRA 5JA7A 1NLJA 3H8CA 1M6DA 1EWMA 4BSQA 2XU5A 2DJFB 4G54A 1YT7A 2R9OA 2E02A 1AU4A 3CH2X 3OISA 3BC3A 3O1GA 1IWDA 1VJVA 3IUTA 4X6HA 4NV8A 3C9EA 1CTEA 1PCIA 3QT4A 3GCBA 5CVNB 4CDDB 2HH5A 3CBJA 4QRVA 5F02A 3V6EA 5CHTA 4CDFB 3IHPA 3RVVA 1ITOA 1SNKA 2E01A 2G8JA 3S3QA 2HXZA 1GECE 3MHSA 1MHWA 4X6IA 4BS5A 1E2TA 1CPJA 3H8BA 3LXSA 1TL9A 4PADA 1KXRA 3P5WA 1S4VA 1AECA 2ARYA 1CB5A 1U9WA 1ME4A 2G6DA 2VHFA 1SP4B 2WBFX 3B79A 1PPOA 3H89A 1BGOA 2Y5BA 3N4CA 4BGFA 2B1NA 1YALA 1W4TA 4CZWA 1EWLA 4C5PA 2AVWA 2BSZA 4FIPA 2OZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A24 A;  1U9X A;  3I3T A;  4N79 A;  7PCK A;  1Y4H A;  4N8W A;  1Q6K A;  4I04 A;  3H7D A;  3RVW A;  2XU4 A;  4MZO A;  3K8U A;  4YVA A;  2DJG B;  1F29 A;  1KFX L;  2GHU A;  4N4Z A;  4FJC A;  4ZUX U;  3BOW A;  3MTN A;  2HD5 A;  2FRQ A;  1ME3 A;  1CVZ A;  4QRX A;  4BS6 A;  1GCB A;  1CV8 A;  1PAD A;  4I07 A;  2FYE A;  2AIM A;  1CQD A;  1F2B A;  1ICF A;  2FTD A;  3E1Z B;  2AYN A;  1FH0 A;  4DMX A;  5PAD A;  2PRE A;  3H6S A;  3QSD A;  8PCH A;  4KLB A;  1VSN A;  4BPV A;  1DF0 A;  3IEJ A;  2OUL A;  2AS8 A;  3WXF A;  1PPN A;  5CVM A;  2YJ9 A;  2DC7 A;  1AYW A;  1AYV A;  2CB5 A;  4W4U A;  2E03 A;  2OP3 A;  1PBH A;  4YYW A;  1KHP A;  3P5V A;  1NB3 A;  1POP A;  3U8E A;  1MEG A;  2JQG R;  2DCD A;  4K7C A;  1AU3 A;  1QXP A;  3ZUA A;  3OF8 A;  4X6J A;  4BQV A;  3PBH A;  2NQD B;  1BY8 A;  1DEU A;  1MIR A;  3KFQ A;  1QMY A;  3F5V A;  3NHE A;  4FK5 A;  2DCC A;  1EF7 A;  5EGW A;  1PPD A;  4YYV A;  1F2C A;  2DZZ A;  4YYQ A;  2NQA A;  3S3R A;  1ZIV A;  1QDQ A;  1U9Q X;  1GLO A;  3F75 A;  1NL6 A;  4OEL A;  5K16 A;  1YK8 A;  1NPZ A;  3KX1 A;  3BCN A;  1YVB A;  2E00 A;  3PW3 A;  4HWY A;  4MZS A;  5CHV A;  1Y08 A;  3CBK A;  4WA6 A;  5EF4 A;  2AU1 A;  4QRG A;  1HUC B;  4Q8G A;  1F2A A;  1PE6 A;  4W5C A;  1TU6 A;  3USV A;  9PAP A;  2H7J A;  1X9Y A;  1CSB B;  2DCB A;  4XUI A;  2FQ9 A;  4YYU A;  1U5I A;  5J94 A;  3WXG A;  4Q8H A;  4YV8 A;  2R9M A;  3D6S A;  4W5B A;  2NQG A;  1MEM A;  2ACT A;  2B1M A;  2XU3 A;  2P0R A;  4OEM A;  2HHN A;  2AUZ A;  2F7D A;  1PPP A;  3N3K A;  5CVO B;  1CJL A;  2DC6 A;  2XU1 A;  3HD3 A;  3BPF A;  3DF0 A;  3OF9 A;  1BQI A;  3IOQ A;  1STF E;  4XR7 A;  3N3G A;  3RVX A;  3KWB X;  4PP1 A;  2C0Y A;  3KW9 A;  3HWN A;  1ATK A;  3P5U A;  1EWP A;  1ZCM A;  1YK7 A;  4AXL A;  4AXM A;  4RY2 A;  2VHS A;  2DZY A;  2FO5 A;  3OVX A;  2P7U A;  1U9V A;  2FT2 A;  4DMY A;  3IMA A;  2R9N A;  1PIP A;  3ERV A;  2G8E A;  1A6R A;  1AU2 A;  5JH3 A;  1BP4 A;  1KFU L;  3MHH A;  3HHI A;  1JQP A;  1QOL A;  4P6E A;  2YJ8 A;  3BPM A;  1KHQ A;  3O0U A;  2YJC A;  4QBB A;  4CDC B;  2P86 A;  1AYU A;  3HHA A;  1PXV A;  3WXE A;  2YJB A;  3LFY A;  3K24 A;  4PI3 A;  1EWO A;  3TNX A;  4MSX A;  1CS8 A;  1THE A;  3BWK A;  6PAD A;  2BDL A;  2PBH A;  2DCA A;  5FPW A;  1NQC A;  3QJ3 A;  3KSE A;  2Y6E A;  3M99 A;  2F1G A;  3PDF A;  2ATO A;  3MOR A;  3CH3 X;  2PAD A;  2GFO A;  4CDE B;  2YJ2 A;  2IBI A;  3KKU A;  1MDW A;  2R6N A;  2FUD A;  1GMY A;  3V6C A;  3IV2 A;  1AIM A;  1AU0 A;  4I05 A;  2JQF R;  1MS6 A;  2O6X A;  1XKG A;  1NB5 A;  2IPP B;  2AYO A;  4PP2 E;  1O0E A;  2PNS A;  3OVZ A;  3KWZ A;  2DC8 A;  2NQI A;  3K9M A;  2DC9 A;  4QH6 A;  2R9F A;  2G7Y A;  4P6G A;  2R9C A;  3AI8 A;  2CIO A;  2BDZ A;  2AUX A;  4YYR A;  3P5X A;  1K3B B;  4YYS A;  3I06 A;  1TLO A;  2FRA A;  3PNR A;  5JA7 A;  1NLJ A;  3H8C A;  1M6D A;  1EWM A;  4BSQ A;  2XU5 A;  2DJF B;  4G54 A;  1YT7 A;  2R9O A;  2E02 A;  1AU4 A;  3CH2 X;  3OIS A;  3BC3 A;  3O1G A;  1IWD A;  1VJV A;  3IUT A;  4X6H A;  3C9E A;  1CTE A;  1PCI A;  3QT4 A;  3GCB A;  5CVN B;  4CDD B;  2HH5 A;  3CBJ A;  4QRV A;  5F02 A;  3V6E A;  5CHT A;  4CDF B;  3IHP A;  3RVV A;  1ITO A;  1SNK A;  2E01 A;  2G8J A;  3S3Q A;  2HXZ A;  1GEC E;  3MHS A;  1MHW A;  4X6I A;  4BS5 A;  1CPJ A;  3H8B A;  3LXS A;  1TL9 A;  4PAD A;  1KXR A;  3P5W A;  1S4V A;  1AEC A;  2ARY A;  1CB5 A;  1U9W A;  1ME4 A;  2G6D A;  2VHF A;  1SP4 B;  2WBF X;  3B79 A;  1PPO A;  3H89 A;  1BGO A;  2Y5B A;  3N4C A;  2B1N A;  1YAL A;  4CZW A;  1EWL A;  2AVW A;  4FIP A;  2OZ2 A; 
#chains in the Genus database with same CATH topology
 5A24 A;  4M0W A;  1U9X A;  3I3T A;  3W31 A;  4N79 A;  7PCK A;  1Y4H A;  4N8W A;  1Q6K A;  4I04 A;  3H7D A;  3RVW A;  2XU4 A;  4P16 A;  4MZO A;  3K8U A;  4YVA A;  2DJG B;  1F29 A;  1KFX L;  2GHU A;  4N4Z A;  3ZNH A;  5JZE A;  4FJC A;  4ZUX U;  3BOW A;  3MTN A;  2HD5 A;  3O65 A;  2FRQ A;  1ME3 A;  1CVZ A;  4QRX A;  4BS6 A;  3OQC A;  1GCB A;  1CV8 A;  1PAD A;  4I07 A;  2FYE A;  2AIM A;  1CQD A;  1F2B A;  1ICF A;  2FTD A;  3E1Z B;  2AYN A;  1FH0 A;  2Z84 A;  4DMX A;  5PAD A;  2PRE A;  3H6S A;  3QSD A;  8PCH A;  4KLB A;  1VSN A;  4BPV A;  1DF0 A;  4BOS A;  3TMP A;  3IEJ A;  4R3D A;  2OUL A;  2AS8 A;  3WXF A;  1PPN A;  5CVM A;  2YJ9 A;  1YZB A;  2DC7 A;  4RF1 A;  1AYW A;  1AYV A;  2CB5 A;  4W4U A;  2E03 A;  2OP3 A;  1PBH A;  4YYW A;  1KHP A;  3P5V A;  1NB3 A;  1POP A;  1MEG A;  2JQG R;  3U8E A;  2DCD A;  4K7C A;  1AU3 A;  1QXP A;  3ZUA A;  3OF8 A;  4X6J A;  4OVZ B;  4BQV A;  3PBH A;  2BU3 A;  2NQD B;  1BY8 A;  1DEU A;  1MIR A;  3KFQ A;  1QMY A;  3F5V A;  3NHE A;  3PHX A;  4FK5 A;  4RNA A;  2BTW B;  2DCC A;  4BOZ A;  1EF7 A;  5EGW A;  1PPD A;  4YYV A;  1F2C A;  2DZZ A;  4YYQ A;  2NQA A;  3S3R A;  1ZIV A;  3W30 A;  1QDQ A;  1U9Q X;  1GLO A;  3F75 A;  1NL6 A;  4OEL A;  5K16 A;  1YK8 A;  1NPZ A;  3KX1 A;  3BCN A;  1YVB A;  2E00 A;  3PW3 A;  4HWY A;  4MZS A;  5CHV A;  3TRK A;  4A5U A;  1Y08 A;  3CBK A;  4BOQ A;  4WA6 A;  5EF4 A;  2AU1 A;  4QRG A;  1HUC B;  4Q8G A;  1F2A A;  1PE6 A;  4W5C A;  1TU6 A;  3USV A;  9PAP A;  2H7J A;  2BTW A;  4PT5 A;  1X9Y A;  1CSB B;  2DCB A;  3PRP A;  2JTC A;  2FQ9 A;  4XUI A;  4YYU A;  1U5I A;  5J94 A;  3WXG A;  4Q8H A;  3MTV A;  4D8B A;  4YV8 A;  2R9M A;  3D6S A;  4W5B A;  4OW0 A;  2NQG A;  1MEM A;  2ACT A;  2B1M A;  2XU3 A;  3BBA A;  2P0R A;  4OEM A;  2HHN A;  2AUZ A;  2F7D A;  1PPP A;  3N3K A;  5CVO B;  1CJL A;  2DC6 A;  3C0R A;  2XU1 A;  3HD3 A;  3BPF A;  3DF0 A;  3OF9 A;  1BQI A;  3IOQ A;  4RF0 A;  1STF E;  4XR7 A;  3N3G A;  3RVX A;  3KWB X;  4PP1 A;  2C0Y A;  3KW9 A;  3HWN A;  1ATK A;  3P5U A;  4GUA A;  1EWP A;  1ZCM A;  1YK7 A;  4AXL A;  4AXM A;  1DKI A;  4RY2 A;  2VHS A;  2DZY A;  2FO5 A;  3OVX A;  2P7U A;  1U9V A;  2HWK A;  2FT2 A;  4DMY A;  3IMA A;  2R9N A;  1PIP A;  3ERV A;  2G8E A;  1A6R A;  1AU2 A;  5JH3 A;  1BP4 A;  1KFU L;  4BOP A;  3MHH A;  3HHI A;  1JQP A;  4MI7 A;  1QOL A;  4P6E A;  2YJ8 A;  3BPM A;  1KHQ A;  3MJ5 A;  3O0U A;  4D8E A;  2YJC A;  4RKX A;  4QBB A;  3RNV A;  4CDC B;  2P86 A;  1AYU A;  3HHA A;  1PXV A;  3WXE A;  2YJB A;  3LFY A;  4IP3 A;  3K24 A;  4PI3 A;  1EWO A;  3TNX A;  2UZJ A;  4MSX A;  3PRM A;  1CS8 A;  1THE A;  3BWK A;  6PAD A;  2BDL A;  4MM3 B;  5EZQ A;  2PBH A;  2DCA A;  5FPW A;  2J7Q C;  4D8I A;  1NQC A;  3QJ3 A;  3KSE A;  2Y6E A;  3M99 A;  2F1G A;  3PDF A;  2ATO A;  3MOR A;  3CH3 X;  4BOU A;  2PAD A;  2GFO A;  4CDE B;  5EZS A;  3BY4 A;  4REZ A;  2YJ2 A;  2IBI A;  3PHW A;  3E9S A;  3KKU A;  1MDW A;  2R6N A;  2FUD A;  3MP2 A;  1PVJ A;  1GMY A;  3V6C A;  3IV2 A;  1AIM A;  1AU0 A;  3B21 A;  4I05 A;  4OVZ A;  2JQF R;  1MS6 A;  2O6X A;  1XKG A;  1NB5 A;  2IPP B;  2AYO A;  2JRI A;  4PP2 E;  1O0E A;  2PNS A;  3OVZ A;  3KWZ A;  2DC8 A;  1UKF A;  2NQI A;  3K9M A;  2DC9 A;  4QH6 A;  2R9F A;  2G7Y A;  4P6G A;  2R9C A;  3AI8 A;  2CIO A;  2BDZ A;  2AUX A;  4YYR A;  3P5X A;  1K3B B;  4YYS A;  4WUR A;  3I06 A;  2AGA A;  4HXD B;  1TLO A;  2FRA A;  3PSE A;  3PNR A;  5JA7 A;  1NLJ A;  3PT2 A;  3H8C A;  1M6D A;  1EWM A;  4BSQ A;  2XU5 A;  2DJF B;  4G54 A;  1YT7 A;  2R9O A;  2E02 A;  1AU4 A;  3PHU A;  2FE8 A;  3CH2 X;  3OIS A;  3BC3 A;  3O1G A;  3IFU A;  1IWD A;  1VJV A;  3IUT A;  4X6H A;  4XZX A;  3C9E A;  1CTE A;  1PCI A;  3QT4 A;  3GCB A;  5CVN B;  4CDD B;  2HH5 A;  3CBJ A;  4QRV A;  5F02 A;  3V6E A;  5CHT A;  4CDF B;  3IHP A;  3RVV A;  1ITO A;  1SNK A;  2E01 A;  2G8J A;  3S3Q A;  2HXZ A;  1GEC E;  3MHS A;  5E6J A;  1MHW A;  4X6I A;  4BS5 A;  1CPJ A;  4ZTB A;  3H8B A;  3LXS A;  1TL9 A;  4PAD A;  1KXR A;  3P5W A;  1S4V A;  1AEC A;  2ARY A;  1CB5 A;  5KO3 A;  1U9W A;  4IUM A;  1ME4 A;  2J7Q A;  2G6D A;  2VHF A;  3BB7 A;  1SP4 B;  2WBF X;  3B79 A;  1PPO A;  3H89 A;  1BGO A;  2Y5B A;  3N4C A;  2B1N A;  1YAL A;  4CZW A;  1EWL A;  2AVW A;  4FIP A;  2DOS A;  2OZ2 A; 
#chains in the Genus database with same CATH homology
 5A24 A;  1U9X A;  3I3T A;  4N79 A;  7PCK A;  1Y4H A;  4N8W A;  1Q6K A;  4I04 A;  3H7D A;  3RVW A;  2XU4 A;  4MZO A;  3K8U A;  4YVA A;  2DJG B;  1F29 A;  1KFX L;  2GHU A;  4N4Z A;  4FJC A;  4ZUX U;  3BOW A;  3MTN A;  2HD5 A;  2FRQ A;  1ME3 A;  1CVZ A;  4QRX A;  4BS6 A;  1GCB A;  1CV8 A;  1PAD A;  4I07 A;  2FYE A;  2AIM A;  1CQD A;  1F2B A;  1ICF A;  2FTD A;  3E1Z B;  2AYN A;  1FH0 A;  4DMX A;  5PAD A;  2PRE A;  3H6S A;  3QSD A;  8PCH A;  4KLB A;  1VSN A;  4BPV A;  1DF0 A;  3IEJ A;  2OUL A;  2AS8 A;  3WXF A;  1PPN A;  5CVM A;  2YJ9 A;  2DC7 A;  1AYW A;  1AYV A;  2CB5 A;  4W4U A;  2E03 A;  2OP3 A;  1PBH A;  4YYW A;  1KHP A;  3P5V A;  1NB3 A;  1POP A;  1MEG A;  2JQG R;  3U8E A;  2DCD A;  4K7C A;  1AU3 A;  1QXP A;  3ZUA A;  3OF8 A;  4X6J A;  4BQV A;  3PBH A;  2NQD B;  1BY8 A;  1DEU A;  1MIR A;  3KFQ A;  1QMY A;  3F5V A;  3NHE A;  4FK5 A;  2DCC A;  1EF7 A;  5EGW A;  1PPD A;  4YYV A;  1F2C A;  2DZZ A;  4YYQ A;  2NQA A;  3S3R A;  1ZIV A;  1QDQ A;  1U9Q X;  1GLO A;  3F75 A;  1NL6 A;  4OEL A;  2VFB A;  3D9W A;  5K16 A;  1W5R A;  1YK8 A;  1NPZ A;  3KX1 A;  3BCN A;  1YVB A;  2E00 A;  3PW3 A;  4HWY A;  4MZS A;  5CHV A;  1Y08 A;  3CBK A;  4WA6 A;  5EF4 A;  2AU1 A;  4QRG A;  1HUC B;  4Q8G A;  1F2A A;  1PE6 A;  4W5C A;  1TU6 A;  3USV A;  9PAP A;  2H7J A;  1X9Y A;  1CSB B;  2DCB A;  4XUI A;  2FQ9 A;  4YYU A;  1U5I A;  5J94 A;  3WXG A;  4Q8H A;  4YV8 A;  2R9M A;  3D6S A;  4W5B A;  2NQG A;  1MEM A;  2ACT A;  4B55 A;  2B1M A;  2XU3 A;  2P0R A;  4OEM A;  2HHN A;  2AUZ A;  2F7D A;  1PPP A;  3N3K A;  5CVO B;  1CJL A;  2DC6 A;  2XU1 A;  3HD3 A;  3BPF A;  3DF0 A;  3OF9 A;  1BQI A;  3IOQ A;  1STF E;  4XR7 A;  3N3G A;  3RVX A;  3KWB X;  4PP1 A;  2C0Y A;  3KW9 A;  3HWN A;  3LTW A;  1ATK A;  3P5U A;  1EWP A;  1ZCM A;  1YK7 A;  4AXL A;  4AXM A;  4RY2 A;  2VHS A;  2DZY A;  2FO5 A;  3OVX A;  2P7U A;  1U9V A;  2FT2 A;  4DMY A;  3IMA A;  2R9N A;  1PIP A;  3ERV A;  2G8E A;  1A6R A;  1AU2 A;  5JH3 A;  1BP4 A;  1KFU L;  3MHH A;  3HHI A;  1JQP A;  1QOL A;  4P6E A;  2YJ8 A;  3BPM A;  1KHQ A;  3O0U A;  1W6F A;  2YJC A;  4QBB A;  4CDC B;  2P86 A;  1AYU A;  3HHA A;  1PXV A;  3WXE A;  2YJB A;  3LFY A;  3K24 A;  4PI3 A;  1EWO A;  3TNX A;  4MSX A;  4GUZ A;  1CS8 A;  1THE A;  3BWK A;  6PAD A;  2BDL A;  2PBH A;  2DCA A;  5FPW A;  1NQC A;  3QJ3 A;  3KSE A;  2Y6E A;  3M99 A;  2F1G A;  3PDF A;  2ATO A;  3MOR A;  3CH3 X;  2PAD A;  2GFO A;  4CDE B;  2YJ2 A;  2IBI A;  3KKU A;  1MDW A;  4NV7 A;  2VFC A;  2R6N A;  2FUD A;  1GMY A;  3V6C A;  3IV2 A;  1AIM A;  1AU0 A;  4I05 A;  2JQF R;  1MS6 A;  2O6X A;  1XKG A;  1NB5 A;  2IPP B;  2AYO A;  4PP2 E;  1O0E A;  2PNS A;  3OVZ A;  3KWZ A;  2DC8 A;  2NQI A;  3K9M A;  2DC9 A;  4QH6 A;  2R9F A;  2G7Y A;  4P6G A;  2R9C A;  3AI8 A;  2CIO A;  2BDZ A;  2AUX A;  4YYR A;  3P5X A;  1K3B B;  4YYS A;  3I06 A;  1GX3 A;  1TLO A;  2FRA A;  3PNR A;  5JA7 A;  1NLJ A;  3H8C A;  1M6D A;  1EWM A;  4BSQ A;  2XU5 A;  2DJF B;  4G54 A;  1YT7 A;  2R9O A;  2E02 A;  1AU4 A;  3CH2 X;  3OIS A;  3BC3 A;  3O1G A;  1IWD A;  1VJV A;  3IUT A;  4X6H A;  4NV8 A;  3C9E A;  1CTE A;  1PCI A;  3QT4 A;  3GCB A;  5CVN B;  4CDD B;  2HH5 A;  3CBJ A;  4QRV A;  5F02 A;  3V6E A;  5CHT A;  4CDF B;  3IHP A;  3RVV A;  1ITO A;  1SNK A;  2E01 A;  2G8J A;  3S3Q A;  2HXZ A;  1GEC E;  3MHS A;  1MHW A;  4X6I A;  4BS5 A;  1E2T A;  1CPJ A;  3H8B A;  3LXS A;  1TL9 A;  4PAD A;  1KXR A;  3P5W A;  1S4V A;  1AEC A;  2ARY A;  1CB5 A;  1U9W A;  1ME4 A;  2G6D A;  2VHF A;  1SP4 B;  2WBF X;  3B79 A;  1PPO A;  3H89 A;  1BGO A;  2Y5B A;  3N4C A;  4BGF A;  2B1N A;  1YAL A;  1W4T A;  4CZW A;  1EWL A;  4C5P A;  2AVW A;  2BSZ A;  4FIP A;  2OZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...