2AYOA

Structure of usp14 bound to ubquitin aldehyde
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
386
structure length
355
Chain Sequence
ASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 355
sequence length 386
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ayoA00
2XU1A 1Q6KA 1YVBA 1QOLA 2P0RA 2FUDA 1ATKA 3P5VA 4OEMA 4YYVA 4K7CA 4X6JA 2DC7A 3H7DA 4W5BA 3KWBX 2DZZA 3RVVA 2VHFA 1SNKA 2ACTA 3B79A 3MHHA 2JQFR 5PADA 1U9XA 4DMYA 2NQIA 2HXZA 1BP4A 3LFYA 2BDZA 4AXLA 3H8CA 2DCAA 2HHNA 3ERVA 3USVA 2DCBA 4CDCB 1JQPA 4QH6A 3OVXA 3AI8A 4BS5A 1O0EA 3OVZA 1GMYA 3S3RA 3I06A 1PPPA 3WXEA 1GCBA 5FPWA 1PPDA 3DF0A 1CS8A 4G54A 1U9WA 1NL6A 3H89A 2FYEA 3WXFA 2NQGA 1AYWA 2FRQA 3V6EA 1BGOA 1BY8A 3LXSA 5K16A 2FRAA 3PBHA 2VHSA 4PP1A 3IOQA 4KLBA 1PXVA 3HD3A 1CQDA 1NPZA 2G7YA 3D6SA 2FO5A 1AYVA 1AU4A 2OULA 1F2BA 3N4CA 2NQAA 5CVOB 4AXMA 2R9NA 4BS6A 4YVAA 2AYOA 2DCDA 4MSXA 1ICFA 4CDDB 1K3BB 3CBKA 1HUCB 1NLJA 4QRXA 3HHIA 1GECE 2R9OA 4Q8GA 1PBHA 2OZ2A 1ME4A 4YV8A 3BCNA 1KFUL 1GLOA 1F2AA 4I04A 3PNRA 4XR7A 2AYNA 2AUXA 5CVMA 5EF4A 2E03A 2E02A 1Y4HA 3RVWA 4RY2A 1YALA 3H8BA 3IUTA 4FJCA 1MEGA 2HH5A 3GCBA 2DC8A 3O0UA 4BPVA 5JA7A 3KX1A 4FK5A 3ZUAA 2GHUA 2XU4A 3KSEA 2DZYA 3IV2A 4QRVA 1ZCMA 1A6RA 2DC9A 1AU2A 1QDQA 4FIPA 4PADA 4YYRA 1M6DA 2PREA 2YJBA 3K9MA 3BPFA 2E01A 5EGWA 2WBFX 1VSNA 1ZIVA 2F1GA 3IHPA 3MORA 1AECA 1EWLA 1EWOA 3CBJA 2PNSA 1U5IA 3IEJA 4CZWA 3M99A 4QBBA 3U8EA 4N79A 4QRGA 3N3GA 2R6NA 1POPA 1EWMA 4I05A 3QSDA 4W5CA 3NHEA 1CV8A 1AYUA 4XUIA 1Y08A 2O6XA 4MZSA 1F29A 1PIPA 1AIMA 4I07A 5CHTA 2XU3A 2AVWA 2B1NA 2IPPB 3CH2X 4MZOA 1SP4B 1QXPA 4HWYA 2G8JA 1IWDA 1U9VA 9PAPA 3HWNA 1TLOA 1YT7A 3P5UA 4YYSA 1YK8A 3WXGA 2JQGR 1NQCA 2Y6EA 1DEUA 4CDEB 2ATOA 3K8UA 4X6IA 3KW9A 1NB5A 3QT4A 4DMXA 1CB5A 1MHWA 3KWZA 1BQIA 1ITOA 2B1MA 4YYQA 1EF7A 2YJ9A 5CHVA 3OISA 2F7DA 4WA6A 4N4ZA 3N3KA 1PCIA 1AU0A 4P6EA 1KHQA 1S4VA 2FT2A 2R9FA 4CDFB 1ME3A 5J94A 1MIRA 2P86A 8PCHA 3PDFA 7PCKA 1YK7A 4Q8HA 2DJFB 1MEMA 6PADA 4PI3A 2PBHA 1U9QX 2PADA 3S3QA 2AU1A 1F2CA 3E1ZB 1PPNA 2DJGB 2IBIA 2OP3A 3IMAA 4OELA 3K24A 1MS6A 4N8WA 2NQDB 4X6HA 2H7JA 2Y5BA 1CPJA 2E00A 2ARYA 3H6SA 1FH0A 4ZUXU 4BSQA 3RVXA 2XU5A 2AIMA 3MHSA 3OF9A 1PPOA 3OF8A 4P6GA 4BQVA 3KKUA 2FTDA 3TNXA 3BWKA 1PE6A 3BOWA 1KHPA 2FQ9A 2DCCA 1TU6A 2R9CA 1VJVA 2R9MA 1DF0A 1QMYA 1CTEA 1CJLA 3F75A 2YJCA 1MDWA 3KFQA 4W4UA 1TL9A 1CSBB 2CB5A 3P5XA 1XKGA 3CH3X 1PADA 3BPMA 5A24A 2C0YA 3PW3A 2AUZA 2HD5A 1THEA 5CVNB 1CVZA 3HHAA 2G6DA 3QJ3A 1X9YA 2AS8A 5JH3A 3MTNA 2DC6A 1KFXL 1NB3A 2P7UA 3V6CA 2YJ2A 3BC3A 2BDLA 3O1GA 1STFE 5F02A 2YJ8A 2CIOA 3P5WA 1EWPA 4PP2E 3F5VA 4YYUA 1KXRA 2GFOA 3I3TA 2G8EA 3C9EA 4YYWA 1AU3A
chains in the Genus database with same CATH superfamily
2XU1A 1Q6KA 1YVBA 1QOLA 2BTWB 2P0RA 2FUDA 1ATKA 3P5VA 4RKXA 4OEMA 4YYVA 4K7CA 3TRKA 4X6JA 2DC7A 3H7DA 4W5BA 3KWBX 2DZZA 3RVVA 2VHFA 1SNKA 2ACTA 3B79A 3MHHA 2JQFR 5PADA 1U9XA 4DMYA 2NQIA 2HXZA 1BP4A 3LFYA 2BDZA 4AXLA 3H8CA 2DCAA 2HHNA 3ERVA 3USVA 2DCBA 1YZBA 4CDCB 1JQPA 4QH6A 3OVXA 3AI8A 4BS5A 1O0EA 3OVZA 1GMYA 3S3RA 3I06A 1PPPA 3WXEA 1GCBA 4MI7A 5FPWA 1PPDA 3E9SA 3DF0A 1CS8A 4G54A 1U9WA 1NL6A 3H89A 2FYEA 3O65A 3WXFA 2NQGA 1AYWA 2FRQA 3V6EA 1BGOA 3MP2A 1BY8A 3LXSA 3BY4A 2BU3A 2FRAA 5K16A 4XZXA 3PBHA 4BOQA 3MTVA 2VHSA 4PP1A 2JTCA 3IOQA 4KLBA 1PXVA 3HD3A 1CQDA 1NPZA 2G7YA 3D6SA 2FO5A 1AYVA 1AU4A 2OULA 1F2BA 3N4CA 2NQAA 5CVOB 4WURA 4AXMA 4HXDB 2R9NA 4BS6A 4YVAA 2AYOA 2DCDA 4MSXA 1ICFA 4CDDB 4D8EA 3MJ5A 1K3BB 3CBKA 1HUCB 1NLJA 4QRXA 3HHIA 1GECE 2R9OA 4Q8GA 1PBHA 2OZ2A 1ME4A 3PRMA 4YV8A 3BCNA 1KFUL 1GLOA 1F2AA 4I04A 3PNRA 4XR7A 2AYNA 2AUXA 4REZA 5CVMA 5EF4A 4BOSA 3PHWA 2E03A 2E02A 3PT2A 1Y4HA 4RF0A 3RVWA 4RY2A 1YALA 3PHUA 3PHXA 3H8BA 3IUTA 4A5UA 4FJCA 5EZSA 3TMPA 1MEGA 4BOUA 2HH5A 3GCBA 5E6JA 2DC8A 3O0UA 4GUAA 4BPVA 4ZTBA 4RNAA 5JA7A 3KX1A 4FK5A 3ZUAA 2GHUA 4OVZA 2XU4A 3KSEA 2DZYA 2J7QC 3IV2A 4QRVA 1ZCMA 1A6RA 2DC9A 1AU2A 1QDQA 4RF1A 4FIPA 4PADA 4YYRA 1M6DA 2PREA 2YJBA 3K9MA 3BPFA 2Z84A 2E01A 5EGWA 2WBFX 1VSNA 1ZIVA 2F1GA 3IHPA 3MORA 1AECA 1EWLA 1EWOA 3CBJA 2PNSA 1U5IA 3IEJA 4CZWA 3M99A 4QBBA 3U8EA 4N79A 4D8IA 4QRGA 3N3GA 2R6NA 1POPA 2BTWA 1EWMA 4I05A 3QSDA 4W5CA 1DKIA 3NHEA 1CV8A 1AYUA 4XUIA 1Y08A 2O6XA 4MZSA 1F29A 1PIPA 1AIMA 4I07A 5CHTA 2XU3A 1PVJA 2AVWA 2B1NA 2IPPB 3CH2X 4MZOA 1SP4B 1QXPA 2G8JA 4HWYA 1IWDA 1U9VA 9PAPA 3HWNA 5KO3A 1TLOA 1YT7A 3P5UA 4YYSA 1YK8A 3WXGA 2JQGR 1NQCA 2HWKA 2Y6EA 2UZJA 1DEUA 4CDEB 2ATOA 5JZEA 3K8UA 4OW0A 4X6IA 3KW9A 1NB5A 2AGAA 3QT4A 4DMXA 1CB5A 1MHWA 3KWZA 4M0WA 1BQIA 1ITOA 2B1MA 4YYQA 1EF7A 2YJ9A 5CHVA 3OISA 2J7QA 2F7DA 4WA6A 4N4ZA 3N3KA 1PCIA 1AU0A 4P6EA 1KHQA 4PT5A 1S4VA 3OQCA 2FT2A 4IP3A 2R9FA 4CDFB 1ME3A 5J94A 1MIRA 2P86A 3BB7A 8PCHA 3PDFA 7PCKA 1YK7A 4Q8HA 2DJFB 1MEMA 6PADA 4PI3A 2PBHA 3RNVA 2FE8A 1U9QX 2PADA 3S3QA 2AU1A 4R3DA 3PRPA 3PSEA 1F2CA 3E1ZB 3B21A 1PPNA 2DJGB 4D8BA 1UKFA 2IBIA 2OP3A 3W30A 3IMAA 4OELA 3K24A 1MS6A 4BOPA 4N8WA 2DOSA 2NQDB 4X6HA 2H7JA 2Y5BA 1CPJA 2E00A 2ARYA 3H6SA 1FH0A 4ZUXU 4BSQA 3RVXA 2XU5A 2AIMA 3MHSA 3OF9A 1PPOA 3OF8A 4P6GA 4BQVA 3KKUA 2FTDA 3TNXA 3BWKA 1PE6A 3BOWA 3BBAA 4IUMA 1KHPA 2FQ9A 2DCCA 1TU6A 2R9CA 1VJVA 2R9MA 1DF0A 1QMYA 1CTEA 1CJLA 3F75A 2YJCA 1MDWA 3KFQA 4W4UA 1TL9A 1CSBB 2CB5A 3P5XA 3C0RA 1XKGA 3CH3X 1PADA 5EZQA 4BOZA 3BPMA 5A24A 2C0YA 4P16A 3PW3A 2AUZA 2HD5A 1THEA 5CVNB 1CVZA 3HHAA 3IFUA 2G6DA 3QJ3A 4OVZB 1X9YA 2AS8A 5JH3A 3MTNA 2DC6A 1KFXL 1NB3A 3ZNHA 2P7UA 2JRIA 2YJ2A 3BC3A 3V6CA 2BDLA 3O1GA 1STFE 5F02A 2YJ8A 2CIOA 3P5WA 1EWPA 4PP2E 3F5VA 4YYUA 1KXRA 2GFOA 3I3TA 4MM3B 2G8EA 3C9EA 4YYWA 3W31A 1AU3A
chains in the Genus database with same CATH topology
2XU1A 1GX3A 1Q6KA 1YVBA 1QOLA 2P0RA 2FUDA 1ATKA 3P5VA 4OEMA 4YYVA 4K7CA 4X6JA 2DC7A 3H7DA 4W5BA 3KWBX 2DZZA 3RVVA 2VHFA 1SNKA 2ACTA 3B79A 3MHHA 2JQFR 5PADA 1U9XA 4DMYA 2NQIA 2HXZA 1BP4A 3LFYA 2BDZA 4AXLA 3H8CA 2DCAA 2HHNA 3ERVA 3USVA 2DCBA 4CDCB 1W6FA 1JQPA 4QH6A 3OVXA 3AI8A 4BS5A 1O0EA 3OVZA 1GMYA 3S3RA 3I06A 1PPPA 3WXEA 1GCBA 5FPWA 1PPDA 3DF0A 1CS8A 4G54A 1U9WA 1NL6A 3H89A 2FYEA 3WXFA 2NQGA 1AYWA 2FRQA 3V6EA 1BGOA 1BY8A 3LXSA 5K16A 2FRAA 3PBHA 2VHSA 4PP1A 3IOQA 4KLBA 1PXVA 3HD3A 1CQDA 1NPZA 2G7YA 3D6SA 2FO5A 1AYVA 1AU4A 2OULA 1F2BA 3N4CA 2NQAA 5CVOB 4AXMA 2R9NA 4BS6A 4YVAA 2AYOA 2DCDA 4MSXA 1ICFA 4CDDB 1K3BB 4GUZA 3CBKA 1HUCB 1NLJA 4QRXA 3HHIA 1GECE 2R9OA 4Q8GA 1PBHA 2OZ2A 1ME4A 4YV8A 3BCNA 1KFUL 1GLOA 1F2AA 4I04A 3LTWA 3PNRA 4XR7A 2AYNA 2AUXA 5CVMA 5EF4A 2E03A 2E02A 1Y4HA 3RVWA 4RY2A 1YALA 3H8BA 3IUTA 4FJCA 4B55A 1MEGA 2HH5A 4NV7A 3GCBA 1W4TA 2DC8A 3O0UA 4BPVA 5JA7A 3KX1A 4FK5A 3ZUAA 2GHUA 2XU4A 3KSEA 2DZYA 3IV2A 4QRVA 1ZCMA 1A6RA 2DC9A 1AU2A 1QDQA 4FIPA 4PADA 4YYRA 1M6DA 2PREA 2YJBA 3K9MA 3BPFA 2E01A 5EGWA 2WBFX 1VSNA 1ZIVA 2F1GA 3IHPA 3MORA 1AECA 1EWLA 1EWOA 3CBJA 2PNSA 1U5IA 3IEJA 4CZWA 3M99A 4QBBA 3U8EA 4N79A 4QRGA 3N3GA 2R6NA 1POPA 1EWMA 4I05A 3QSDA 4W5CA 3NHEA 1CV8A 1AYUA 4XUIA 1Y08A 2O6XA 4MZSA 1F29A 1PIPA 1AIMA 4I07A 5CHTA 2XU3A 2AVWA 2B1NA 2IPPB 3CH2X 4MZOA 1SP4B 1QXPA 4HWYA 2G8JA 1IWDA 1U9VA 9PAPA 3HWNA 1TLOA 1YT7A 3P5UA 4YYSA 1YK8A 3WXGA 2JQGR 1NQCA 2Y6EA 2VFBA 1DEUA 4CDEB 2ATOA 3K8UA 2VFCA 4X6IA 3KW9A 1NB5A 3QT4A 4DMXA 1CB5A 1MHWA 3KWZA 1BQIA 1ITOA 2B1MA 4YYQA 1EF7A 2YJ9A 5CHVA 3OISA 4NV8A 2F7DA 4WA6A 4N4ZA 3N3KA 1PCIA 1AU0A 4P6EA 1KHQA 1S4VA 2FT2A 2R9FA 4CDFB 1ME3A 5J94A 1MIRA 2P86A 8PCHA 3PDFA 7PCKA 1YK7A 4Q8HA 2DJFB 1MEMA 6PADA 4PI3A 2PBHA 1U9QX 2PADA 3S3QA 2AU1A 1F2CA 3E1ZB 1PPNA 2DJGB 2IBIA 2OP3A 3IMAA 4OELA 3K24A 1MS6A 3D9WA 4N8WA 2NQDB 4X6HA 2H7JA 2Y5BA 4C5PA 1CPJA 2E00A 2ARYA 3H6SA 1FH0A 4ZUXU 4BSQA 3RVXA 2XU5A 2AIMA 3MHSA 3OF9A 1PPOA 3OF8A 4P6GA 4BQVA 3KKUA 2FTDA 3TNXA 3BWKA 1PE6A 3BOWA 1KHPA 2FQ9A 2DCCA 4BGFA 1TU6A 2R9CA 1VJVA 2R9MA 1DF0A 1QMYA 1CTEA 1CJLA 3F75A 2YJCA 1MDWA 3KFQA 4W4UA 1TL9A 1CSBB 2CB5A 3P5XA 1XKGA 3CH3X 1PADA 3BPMA 5A24A 2C0YA 3PW3A 2AUZA 2HD5A 1THEA 5CVNB 1CVZA 3HHAA 2G6DA 3QJ3A 1X9YA 1E2TA 2AS8A 5JH3A 3MTNA 2DC6A 1KFXL 1NB3A 2P7UA 3V6CA 2YJ2A 3BC3A 2BDLA 3O1GA 1STFE 5F02A 2YJ8A 2BSZA 2CIOA 3P5WA 1EWPA 4PP2E 3F5VA 4YYUA 1KXRA 2GFOA 3I3TA 2G8EA 3C9EA 1W5RA 4YYWA 1AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU1 A;  1Q6K A;  1YVB A;  1QOL A;  2P0R A;  2FUD A;  1ATK A;  3P5V A;  4OEM A;  4YYV A;  4K7C A;  4X6J A;  2DC7 A;  3H7D A;  4W5B A;  3KWB X;  2DZZ A;  3RVV A;  2VHF A;  1SNK A;  2ACT A;  3B79 A;  3MHH A;  2JQF R;  5PAD A;  1U9X A;  4DMY A;  2NQI A;  2HXZ A;  1BP4 A;  3LFY A;  2BDZ A;  4AXL A;  3H8C A;  2DCA A;  2HHN A;  3ERV A;  3USV A;  2DCB A;  4CDC B;  1JQP A;  4QH6 A;  3OVX A;  3AI8 A;  4BS5 A;  1O0E A;  3OVZ A;  1GMY A;  3S3R A;  3I06 A;  1PPP A;  3WXE A;  1GCB A;  5FPW A;  1PPD A;  3DF0 A;  1CS8 A;  4G54 A;  1U9W A;  1NL6 A;  3H89 A;  2FYE A;  3WXF A;  2NQG A;  1AYW A;  2FRQ A;  3V6E A;  1BGO A;  1BY8 A;  3LXS A;  5K16 A;  2FRA A;  3PBH A;  2VHS A;  4PP1 A;  3IOQ A;  4KLB A;  1PXV A;  3HD3 A;  1CQD A;  1NPZ A;  2G7Y A;  3D6S A;  2FO5 A;  1AYV A;  1AU4 A;  2OUL A;  1F2B A;  3N4C A;  2NQA A;  5CVO B;  4AXM A;  2R9N A;  4BS6 A;  4YVA A;  2AYO A;  2DCD A;  4MSX A;  1ICF A;  4CDD B;  1K3B B;  3CBK A;  1HUC B;  1NLJ A;  4QRX A;  3HHI A;  1GEC E;  2R9O A;  4Q8G A;  1PBH A;  2OZ2 A;  1ME4 A;  4YV8 A;  3BCN A;  1KFU L;  1GLO A;  1F2A A;  4I04 A;  3PNR A;  4XR7 A;  2AYN A;  2AUX A;  5CVM A;  5EF4 A;  2E03 A;  2E02 A;  1Y4H A;  3RVW A;  4RY2 A;  1YAL A;  3H8B A;  3IUT A;  4FJC A;  1MEG A;  2HH5 A;  3GCB A;  2DC8 A;  3O0U A;  4BPV A;  5JA7 A;  3KX1 A;  4FK5 A;  3ZUA A;  2GHU A;  2XU4 A;  3KSE A;  2DZY A;  3IV2 A;  4QRV A;  1ZCM A;  1A6R A;  2DC9 A;  1AU2 A;  1QDQ A;  4FIP A;  4PAD A;  4YYR A;  1M6D A;  2PRE A;  2YJB A;  3K9M A;  3BPF A;  2E01 A;  5EGW A;  2WBF X;  1VSN A;  1ZIV A;  2F1G A;  3IHP A;  3MOR A;  1AEC A;  1EWL A;  1EWO A;  3CBJ A;  2PNS A;  1U5I A;  3IEJ A;  4CZW A;  3M99 A;  4QBB A;  3U8E A;  4N79 A;  4QRG A;  3N3G A;  2R6N A;  1POP A;  1EWM A;  4I05 A;  3QSD A;  4W5C A;  3NHE A;  1CV8 A;  1AYU A;  4XUI A;  1Y08 A;  2O6X A;  4MZS A;  1F29 A;  1PIP A;  1AIM A;  4I07 A;  5CHT A;  2XU3 A;  2AVW A;  2B1N A;  2IPP B;  3CH2 X;  4MZO A;  1SP4 B;  1QXP A;  4HWY A;  2G8J A;  1IWD A;  1U9V A;  9PAP A;  3HWN A;  1TLO A;  1YT7 A;  3P5U A;  4YYS A;  1YK8 A;  3WXG A;  2JQG R;  1NQC A;  2Y6E A;  1DEU A;  4CDE B;  2ATO A;  3K8U A;  4X6I A;  3KW9 A;  1NB5 A;  3QT4 A;  4DMX A;  1CB5 A;  1MHW A;  3KWZ A;  1BQI A;  1ITO A;  2B1M A;  4YYQ A;  1EF7 A;  2YJ9 A;  5CHV A;  3OIS A;  2F7D A;  4WA6 A;  4N4Z A;  3N3K A;  1PCI A;  1AU0 A;  4P6E A;  1KHQ A;  1S4V A;  2FT2 A;  2R9F A;  4CDF B;  1ME3 A;  5J94 A;  1MIR A;  2P86 A;  8PCH A;  3PDF A;  7PCK A;  1YK7 A;  4Q8H A;  2DJF B;  1MEM A;  6PAD A;  4PI3 A;  2PBH A;  1U9Q X;  2PAD A;  3S3Q A;  2AU1 A;  1F2C A;  3E1Z B;  1PPN A;  2DJG B;  2IBI A;  2OP3 A;  3IMA A;  4OEL A;  3K24 A;  1MS6 A;  4N8W A;  2NQD B;  4X6H A;  2H7J A;  2Y5B A;  1CPJ A;  2E00 A;  2ARY A;  3H6S A;  1FH0 A;  4ZUX U;  4BSQ A;  3RVX A;  2XU5 A;  2AIM A;  3MHS A;  3OF9 A;  1PPO A;  3OF8 A;  4P6G A;  4BQV A;  3KKU A;  2FTD A;  3TNX A;  3BWK A;  1PE6 A;  3BOW A;  1KHP A;  2FQ9 A;  2DCC A;  1TU6 A;  2R9C A;  1VJV A;  2R9M A;  1DF0 A;  1QMY A;  1CTE A;  1CJL A;  3F75 A;  2YJC A;  1MDW A;  3KFQ A;  4W4U A;  1TL9 A;  1CSB B;  2CB5 A;  3P5X A;  1XKG A;  3CH3 X;  1PAD A;  3BPM A;  5A24 A;  2C0Y A;  3PW3 A;  2AUZ A;  2HD5 A;  1THE A;  5CVN B;  1CVZ A;  3HHA A;  2G6D A;  3QJ3 A;  1X9Y A;  2AS8 A;  5JH3 A;  3MTN A;  2DC6 A;  1KFX L;  1NB3 A;  2P7U A;  3V6C A;  2YJ2 A;  3BC3 A;  2BDL A;  3O1G A;  1STF E;  5F02 A;  2YJ8 A;  2CIO A;  3P5W A;  1EWP A;  4PP2 E;  3F5V A;  4YYU A;  1KXR A;  2GFO A;  3I3T A;  2G8E A;  3C9E A;  4YYW A;  1AU3 A; 
#chains in the Genus database with same CATH topology
 2XU1 A;  1Q6K A;  1YVB A;  1QOL A;  2BTW B;  2P0R A;  2FUD A;  1ATK A;  3P5V A;  4RKX A;  4OEM A;  4YYV A;  4K7C A;  3TRK A;  4X6J A;  2DC7 A;  3H7D A;  4W5B A;  3KWB X;  2DZZ A;  3RVV A;  2VHF A;  1SNK A;  2ACT A;  3B79 A;  3MHH A;  2JQF R;  5PAD A;  1U9X A;  4DMY A;  2NQI A;  2HXZ A;  1BP4 A;  3LFY A;  2BDZ A;  4AXL A;  3H8C A;  2DCA A;  2HHN A;  3ERV A;  3USV A;  2DCB A;  1YZB A;  4CDC B;  1JQP A;  4QH6 A;  3OVX A;  3AI8 A;  4BS5 A;  1O0E A;  3OVZ A;  1GMY A;  3S3R A;  3I06 A;  1PPP A;  3WXE A;  1GCB A;  4MI7 A;  5FPW A;  1PPD A;  3E9S A;  3DF0 A;  1CS8 A;  4G54 A;  1U9W A;  1NL6 A;  3H89 A;  2FYE A;  3O65 A;  3WXF A;  2NQG A;  1AYW A;  2FRQ A;  3V6E A;  1BGO A;  3MP2 A;  1BY8 A;  3LXS A;  3BY4 A;  2BU3 A;  2FRA A;  5K16 A;  4XZX A;  3PBH A;  4BOQ A;  3MTV A;  2VHS A;  4PP1 A;  2JTC A;  3IOQ A;  4KLB A;  1PXV A;  3HD3 A;  1CQD A;  1NPZ A;  2G7Y A;  3D6S A;  2FO5 A;  1AYV A;  1AU4 A;  2OUL A;  1F2B A;  3N4C A;  2NQA A;  5CVO B;  4WUR A;  4AXM A;  4HXD B;  2R9N A;  4BS6 A;  4YVA A;  2AYO A;  2DCD A;  4MSX A;  1ICF A;  4CDD B;  4D8E A;  3MJ5 A;  1K3B B;  3CBK A;  1HUC B;  1NLJ A;  4QRX A;  3HHI A;  1GEC E;  2R9O A;  4Q8G A;  1PBH A;  2OZ2 A;  1ME4 A;  3PRM A;  4YV8 A;  3BCN A;  1KFU L;  1GLO A;  1F2A A;  4I04 A;  3PNR A;  4XR7 A;  2AYN A;  2AUX A;  4REZ A;  5CVM A;  5EF4 A;  4BOS A;  3PHW A;  2E03 A;  2E02 A;  3PT2 A;  1Y4H A;  4RF0 A;  3RVW A;  4RY2 A;  1YAL A;  3PHU A;  3PHX A;  3H8B A;  3IUT A;  4A5U A;  4FJC A;  5EZS A;  3TMP A;  1MEG A;  4BOU A;  2HH5 A;  3GCB A;  5E6J A;  2DC8 A;  3O0U A;  4GUA A;  4BPV A;  4ZTB A;  4RNA A;  5JA7 A;  3KX1 A;  4FK5 A;  3ZUA A;  2GHU A;  4OVZ A;  2XU4 A;  3KSE A;  2DZY A;  2J7Q C;  3IV2 A;  4QRV A;  1ZCM A;  1A6R A;  2DC9 A;  1AU2 A;  1QDQ A;  4RF1 A;  4FIP A;  4PAD A;  4YYR A;  1M6D A;  2PRE A;  2YJB A;  3K9M A;  3BPF A;  2Z84 A;  2E01 A;  5EGW A;  2WBF X;  1VSN A;  1ZIV A;  2F1G A;  3IHP A;  3MOR A;  1AEC A;  1EWL A;  1EWO A;  3CBJ A;  2PNS A;  1U5I A;  3IEJ A;  4CZW A;  3M99 A;  4QBB A;  3U8E A;  4N79 A;  4D8I A;  4QRG A;  3N3G A;  2R6N A;  1POP A;  2BTW A;  1EWM A;  4I05 A;  3QSD A;  4W5C A;  1DKI A;  3NHE A;  1CV8 A;  1AYU A;  4XUI A;  1Y08 A;  2O6X A;  4MZS A;  1F29 A;  1PIP A;  1AIM A;  4I07 A;  5CHT A;  2XU3 A;  1PVJ A;  2AVW A;  2B1N A;  2IPP B;  3CH2 X;  4MZO A;  1SP4 B;  1QXP A;  2G8J A;  4HWY A;  1IWD A;  1U9V A;  9PAP A;  3HWN A;  5KO3 A;  1TLO A;  1YT7 A;  3P5U A;  4YYS A;  1YK8 A;  3WXG A;  2JQG R;  1NQC A;  2HWK A;  2Y6E A;  2UZJ A;  1DEU A;  4CDE B;  2ATO A;  5JZE A;  3K8U A;  4OW0 A;  4X6I A;  3KW9 A;  1NB5 A;  2AGA A;  3QT4 A;  4DMX A;  1CB5 A;  1MHW A;  3KWZ A;  4M0W A;  1BQI A;  1ITO A;  2B1M A;  4YYQ A;  1EF7 A;  2YJ9 A;  5CHV A;  3OIS A;  2J7Q A;  2F7D A;  4WA6 A;  4N4Z A;  3N3K A;  1PCI A;  1AU0 A;  4P6E A;  1KHQ A;  4PT5 A;  1S4V A;  3OQC A;  2FT2 A;  4IP3 A;  2R9F A;  4CDF B;  1ME3 A;  5J94 A;  1MIR A;  2P86 A;  3BB7 A;  8PCH A;  3PDF A;  7PCK A;  1YK7 A;  4Q8H A;  2DJF B;  1MEM A;  6PAD A;  4PI3 A;  2PBH A;  3RNV A;  2FE8 A;  1U9Q X;  2PAD A;  3S3Q A;  2AU1 A;  4R3D A;  3PRP A;  3PSE A;  1F2C A;  3E1Z B;  3B21 A;  1PPN A;  2DJG B;  4D8B A;  1UKF A;  2IBI A;  2OP3 A;  3W30 A;  3IMA A;  4OEL A;  3K24 A;  1MS6 A;  4BOP A;  4N8W A;  2DOS A;  2NQD B;  4X6H A;  2H7J A;  2Y5B A;  1CPJ A;  2E00 A;  2ARY A;  3H6S A;  1FH0 A;  4ZUX U;  4BSQ A;  3RVX A;  2XU5 A;  2AIM A;  3MHS A;  3OF9 A;  1PPO A;  3OF8 A;  4P6G A;  4BQV A;  3KKU A;  2FTD A;  3TNX A;  3BWK A;  1PE6 A;  3BOW A;  3BBA A;  4IUM A;  1KHP A;  2FQ9 A;  2DCC A;  1TU6 A;  2R9C A;  1VJV A;  2R9M A;  1DF0 A;  1QMY A;  1CTE A;  1CJL A;  3F75 A;  2YJC A;  1MDW A;  3KFQ A;  4W4U A;  1TL9 A;  1CSB B;  2CB5 A;  3P5X A;  3C0R A;  1XKG A;  3CH3 X;  1PAD A;  5EZQ A;  4BOZ A;  3BPM A;  5A24 A;  2C0Y A;  4P16 A;  3PW3 A;  2AUZ A;  2HD5 A;  1THE A;  5CVN B;  1CVZ A;  3HHA A;  3IFU A;  2G6D A;  3QJ3 A;  4OVZ B;  1X9Y A;  2AS8 A;  5JH3 A;  3MTN A;  2DC6 A;  1KFX L;  1NB3 A;  3ZNH A;  2P7U A;  2JRI A;  2YJ2 A;  3BC3 A;  3V6C A;  2BDL A;  3O1G A;  1STF E;  5F02 A;  2YJ8 A;  2CIO A;  3P5W A;  1EWP A;  4PP2 E;  3F5V A;  4YYU A;  1KXR A;  2GFO A;  3I3T A;  4MM3 B;  2G8E A;  3C9E A;  4YYW A;  3W31 A;  1AU3 A; 
#chains in the Genus database with same CATH homology
 2XU1 A;  1GX3 A;  1Q6K A;  1YVB A;  1QOL A;  2P0R A;  2FUD A;  1ATK A;  3P5V A;  4OEM A;  4YYV A;  4K7C A;  4X6J A;  2DC7 A;  3H7D A;  4W5B A;  3KWB X;  2DZZ A;  3RVV A;  2VHF A;  1SNK A;  2ACT A;  3B79 A;  3MHH A;  2JQF R;  5PAD A;  1U9X A;  4DMY A;  2NQI A;  2HXZ A;  1BP4 A;  3LFY A;  2BDZ A;  4AXL A;  3H8C A;  2DCA A;  2HHN A;  3ERV A;  3USV A;  2DCB A;  4CDC B;  1W6F A;  1JQP A;  4QH6 A;  3OVX A;  3AI8 A;  4BS5 A;  1O0E A;  3OVZ A;  1GMY A;  3S3R A;  3I06 A;  1PPP A;  3WXE A;  1GCB A;  5FPW A;  1PPD A;  3DF0 A;  1CS8 A;  4G54 A;  1U9W A;  1NL6 A;  3H89 A;  2FYE A;  3WXF A;  2NQG A;  1AYW A;  2FRQ A;  3V6E A;  1BGO A;  1BY8 A;  3LXS A;  5K16 A;  2FRA A;  3PBH A;  2VHS A;  4PP1 A;  3IOQ A;  4KLB A;  1PXV A;  3HD3 A;  1CQD A;  1NPZ A;  2G7Y A;  3D6S A;  2FO5 A;  1AYV A;  1AU4 A;  2OUL A;  1F2B A;  3N4C A;  2NQA A;  5CVO B;  4AXM A;  2R9N A;  4BS6 A;  4YVA A;  2AYO A;  2DCD A;  4MSX A;  1ICF A;  4CDD B;  1K3B B;  4GUZ A;  3CBK A;  1HUC B;  1NLJ A;  4QRX A;  3HHI A;  1GEC E;  2R9O A;  4Q8G A;  1PBH A;  2OZ2 A;  1ME4 A;  4YV8 A;  3BCN A;  1KFU L;  1GLO A;  1F2A A;  4I04 A;  3LTW A;  3PNR A;  4XR7 A;  2AYN A;  2AUX A;  5CVM A;  5EF4 A;  2E03 A;  2E02 A;  1Y4H A;  3RVW A;  4RY2 A;  1YAL A;  3H8B A;  3IUT A;  4FJC A;  4B55 A;  1MEG A;  2HH5 A;  4NV7 A;  3GCB A;  1W4T A;  2DC8 A;  3O0U A;  4BPV A;  5JA7 A;  3KX1 A;  4FK5 A;  3ZUA A;  2GHU A;  2XU4 A;  3KSE A;  2DZY A;  3IV2 A;  4QRV A;  1ZCM A;  1A6R A;  2DC9 A;  1AU2 A;  1QDQ A;  4FIP A;  4PAD A;  4YYR A;  1M6D A;  2PRE A;  2YJB A;  3K9M A;  3BPF A;  2E01 A;  5EGW A;  2WBF X;  1VSN A;  1ZIV A;  2F1G A;  3IHP A;  3MOR A;  1AEC A;  1EWL A;  1EWO A;  3CBJ A;  2PNS A;  1U5I A;  3IEJ A;  4CZW A;  3M99 A;  4QBB A;  3U8E A;  4N79 A;  4QRG A;  3N3G A;  2R6N A;  1POP A;  1EWM A;  4I05 A;  3QSD A;  4W5C A;  3NHE A;  1CV8 A;  1AYU A;  4XUI A;  1Y08 A;  2O6X A;  4MZS A;  1F29 A;  1PIP A;  1AIM A;  4I07 A;  5CHT A;  2XU3 A;  2AVW A;  2B1N A;  2IPP B;  3CH2 X;  4MZO A;  1SP4 B;  1QXP A;  4HWY A;  2G8J A;  1IWD A;  1U9V A;  9PAP A;  3HWN A;  1TLO A;  1YT7 A;  3P5U A;  4YYS A;  1YK8 A;  3WXG A;  2JQG R;  1NQC A;  2Y6E A;  2VFB A;  1DEU A;  4CDE B;  2ATO A;  3K8U A;  2VFC A;  4X6I A;  3KW9 A;  1NB5 A;  3QT4 A;  4DMX A;  1CB5 A;  1MHW A;  3KWZ A;  1BQI A;  1ITO A;  2B1M A;  4YYQ A;  1EF7 A;  2YJ9 A;  5CHV A;  3OIS A;  4NV8 A;  2F7D A;  4WA6 A;  4N4Z A;  3N3K A;  1PCI A;  1AU0 A;  4P6E A;  1KHQ A;  1S4V A;  2FT2 A;  2R9F A;  4CDF B;  1ME3 A;  5J94 A;  1MIR A;  2P86 A;  8PCH A;  3PDF A;  7PCK A;  1YK7 A;  4Q8H A;  2DJF B;  1MEM A;  6PAD A;  4PI3 A;  2PBH A;  1U9Q X;  2PAD A;  3S3Q A;  2AU1 A;  1F2C A;  3E1Z B;  1PPN A;  2DJG B;  2IBI A;  2OP3 A;  3IMA A;  4OEL A;  3K24 A;  1MS6 A;  3D9W A;  4N8W A;  2NQD B;  4X6H A;  2H7J A;  2Y5B A;  4C5P A;  1CPJ A;  2E00 A;  2ARY A;  3H6S A;  1FH0 A;  4ZUX U;  4BSQ A;  3RVX A;  2XU5 A;  2AIM A;  3MHS A;  3OF9 A;  1PPO A;  3OF8 A;  4P6G A;  4BQV A;  3KKU A;  2FTD A;  3TNX A;  3BWK A;  1PE6 A;  3BOW A;  1KHP A;  2FQ9 A;  2DCC A;  4BGF A;  1TU6 A;  2R9C A;  1VJV A;  2R9M A;  1DF0 A;  1QMY A;  1CTE A;  1CJL A;  3F75 A;  2YJC A;  1MDW A;  3KFQ A;  4W4U A;  1TL9 A;  1CSB B;  2CB5 A;  3P5X A;  1XKG A;  3CH3 X;  1PAD A;  3BPM A;  5A24 A;  2C0Y A;  3PW3 A;  2AUZ A;  2HD5 A;  1THE A;  5CVN B;  1CVZ A;  3HHA A;  2G6D A;  3QJ3 A;  1X9Y A;  1E2T A;  2AS8 A;  5JH3 A;  3MTN A;  2DC6 A;  1KFX L;  1NB3 A;  2P7U A;  3V6C A;  2YJ2 A;  3BC3 A;  2BDL A;  3O1G A;  1STF E;  5F02 A;  2YJ8 A;  2BSZ A;  2CIO A;  3P5W A;  1EWP A;  4PP2 E;  3F5V A;  4YYU A;  1KXR A;  2GFO A;  3I3T A;  2G8E A;  3C9E A;  1W5R A;  4YYW A;  1AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...