1KHQA

Orthorhombic form of papain/zlfg-dam covalent complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two polymorphs of a covalent complex between papain and a diazomethylketone inhibitor
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Papain
total genus 73
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1khqA00
1PPOA 3S3QA 2DZZA 3H6SA 4I07A 1U9WA 3O0UA 4YYRA 2H7JA 3HHAA 3CBJA 1NQCA 1F2CA 1ME3A 2DZYA 1YT7A 8PCHA 2E01A 1AYWA 1PPDA 4YV8A 4CZWA 1TL9A 1EWMA 5CHVA 2FT2A 1CJLA 2B1NA 3E1ZB 2O6XA 4DMYA 2BDZA 3H8BA 1NB5A 1EF7A 3HHIA 1HUCB 1CS8A 4FJCA 1XKGA 3BOWA 4MZOA 4X6IA 2AUXA 2PREA 4AXLA 2G7YA 3MHHA 1CPJA 1PXVA 2AIMA 4BPVA 1SP4B 2Y6EA 3OF8A 1K3BB 2DCDA 2ACTA 2FO5A 2AUZA 2ARYA 4QH6A 1KXRA 1CTEA 1ITOA 2C0YA 2E03A 1GMYA 3OISA 5CVMA 3IEJA 3N4CA 4N79A 4QRGA 2E00A 2DCCA 4X6HA 1VSNA 1PIPA 3K8UA 3S3RA 1PBHA 1VJVA 1QMYA 1F29A 1U9VA 1U9XA 3CH2X 3H89A 1NLJA 1AU2A 3P5VA 4BS6A 1TLOA 3HD3A 1NB3A 1NL6A 2R6NA 3K9MA 2NQDB 1MIRA 4CDDB 2BDLA 3I06A 3PNRA 1X9YA 4MSXA 5CVNB 5FPWA 2P86A 1AECA 1CB5A 2GHUA 4QBBA 2E02A 2Y5BA 2NQGA 1ZIVA 2G8EA 1KHQA 2DCAA 3OVXA 3KFQA 5JA7A 1KFUL 1ZCMA 3V6CA 2PADA 4YYSA 4FIPA 2XU5A 4Q8HA 1MHWA 3KSEA 2OP3A 4CDEB 5PADA 2PNSA 3BWKA 4N4ZA 2F7DA 3BC3A 4QRVA 2FYEA 2YJCA 3RVWA 3KX1A 2YJ8A 2CIOA 4P6GA 3BPMA 4PI3A 2XU1A 2DC7A 5F02A 3H7DA 4CDCB 1JQPA 4WA6A 1MDWA 2DC6A 4YYQA 2FRQA 2XU3A 5EF4A 1AIMA 4G54A 2YJ9A 3O1GA 3IOQA 4HWYA 3P5XA 1NPZA 4P6EA 1PCIA 1PE6A 1MEGA 3I3TA 3BPFA 2PBHA 1CSBB 5K16A 4I05A 1IWDA 3RVVA 3WXGA 3P5WA 1A6RA 5JH3A 3H8CA 4PP2E 2R9MA 2FUDA 1EWPA 1BQIA 2YJ2A 4XUIA 3PW3A 1AYVA 1KFXL 1QDQA 5CVOB 4CDFB 2R9FA 3IV2A 3C9EA 1THEA 3MTNA 5J94A 3BCNA 2IPPB 3F5VA 5EGWA 3CH3X 4AXMA 2AU1A 5CHTA 2HXZA 2JQGR 4I04A 1QOLA 2R9NA 3ERVA 2DCBA 3MHSA 1F2AA 4W5BA 1AU4A 1BY8A 1S4VA 1STFE 3TNXA 2P0RA 2F1GA 2HD5A 3U8EA 3OF9A 3USVA 3HWNA 2DJFB 1MS6A 2R9CA 4OELA 4YYWA 3NHEA 1PPPA 9PAPA 1Q6KA 4ZUXU 4RY2A 3IMAA 2FTDA 1EWOA 1KHPA 2CB5A 6PADA 3KKUA 2JQFR 1AU3A 1GLOA 7PCKA 2OZ2A 3V6EA 1CQDA 3F75A 3B79A 4QRXA 1BGOA 4PADA 3D6SA 4N8WA 1PPNA 4W4UA 3N3GA 1Y08A 4BQVA 1ICFA 1FH0A 5A24A 1TU6A 1DF0A 4BSQA 1POPA 1ATKA 2YJBA 4YYVA 3LFYA 3IUTA 1GCBA 3QJ3A 1GECE 3KWBX 3KWZA 1CVZA 3LXSA 1QXPA 1U5IA 4YYUA 2NQAA 2R9OA 2GFOA 1AU0A 4XR7A 3QT4A 1YVBA 4Q8GA 3M99A 2AYNA 2DC8A 2P7UA 3QSDA 1Y4HA 1BP4A 1O0EA 1PADA 2B1MA 2G6DA 2G8JA 1ME4A 1YK7A 1DEUA 2OULA 2WBFX 3GCBA 2NQIA 1U9QX 3WXEA 2VHFA 3AI8A 1EWLA 2HH5A 3N3KA 2FQ9A 1M6DA 2ATOA 4K7CA 1AYUA 3ZUAA 1F2BA 4W5CA 4MZSA 1CV8A 3OVZA 2DJGB 4FK5A 2IBIA 2AYOA 3KW9A 1MEMA 3CBKA 4DMXA 1YK8A 4PP1A 3RVXA 3P5UA 3PDFA 3PBHA 1YALA 1SNKA 4X6JA 2AVWA 2DC9A 2HHNA 3DF0A 3WXFA 4KLBA 3IHPA 4OEMA 3MORA 4YVAA 2FRAA 2VHSA 2AS8A 3K24A 2XU4A 4BS5A
chains in the Genus database with same CATH superfamily
1PPOA 3PT2A 3S3QA 1DKIA 3B21A 2DZZA 3H6SA 4I07A 4IP3A 1U9WA 3O0UA 4YYRA 2H7JA 3HHAA 3CBJA 4REZA 1NQCA 1F2CA 1ME3A 2DZYA 1YT7A 8PCHA 2E01A 1AYWA 3C0RA 1PPDA 4YV8A 4CZWA 1TL9A 1EWMA 5CHVA 2FT2A 1CJLA 2B1NA 3E1ZB 2J7QA 3TRKA 4RNAA 2O6XA 4DMYA 2BDZA 3H8BA 1NB5A 3O65A 1EF7A 3HHIA 1HUCB 4PT5A 1CS8A 2UZJA 4FJCA 1XKGA 3BOWA 3PRPA 4MZOA 4X6IA 2AUXA 2PREA 4AXLA 2G7YA 3MHHA 1CPJA 1PXVA 2AIMA 4BPVA 1SP4B 2Y6EA 3OF8A 1K3BB 2DCDA 2ACTA 2FO5A 2AUZA 2ARYA 4QH6A 1KXRA 1CTEA 1ITOA 2C0YA 2E03A 1GMYA 3PRMA 3OISA 5CVMA 3IEJA 3N4CA 4N79A 4QRGA 2E00A 2DCCA 4X6HA 1YZBA 1VSNA 1PIPA 3K8UA 3S3RA 1PBHA 1VJVA 1QMYA 1F29A 1U9VA 1U9XA 3CH2X 3H89A 1NLJA 1AU2A 4WURA 3P5VA 4BS6A 4XZXA 1TLOA 3HD3A 1NB3A 1NL6A 2R6NA 2JRIA 3K9MA 2NQDB 3MP2A 1MIRA 4CDDB 2BDLA 3I06A 3PNRA 3ZNHA 4OVZA 1X9YA 4MSXA 5CVNB 3RNVA 4P16A 2P86A 1AECA 5EZSA 5FPWA 4GUAA 1CB5A 2GHUA 4QBBA 2E02A 2Y5BA 2NQGA 1ZIVA 2G8EA 1KHQA 4HXDB 2DCAA 3OVXA 3KFQA 5JA7A 1KFUL 3MTVA 1ZCMA 3V6CA 3W31A 2PADA 4YYSA 4FIPA 2XU5A 4Q8HA 1MHWA 3KSEA 2OP3A 4CDEB 4R3DA 5PADA 2PNSA 3BWKA 4N4ZA 2F7DA 3BC3A 4QRVA 4D8EA 2FYEA 2YJCA 3RVWA 3KX1A 4BOPA 5KO3A 2YJ8A 2CIOA 4P6GA 3BPMA 4PI3A 2XU1A 2DC7A 5F02A 3H7DA 4CDCB 1JQPA 4WA6A 1MDWA 2DC6A 4YYQA 3PSEA 2FRQA 4MM3B 2XU3A 5EF4A 1AIMA 2HWKA 4G54A 2YJ9A 3O1GA 3IOQA 4HWYA 3P5XA 3BY4A 1NPZA 4P6EA 1PCIA 1PE6A 2BTWA 3TMPA 4OW0A 1MEGA 3I3TA 3BPFA 4RF1A 2PBHA 1CSBB 4ZTBA 4I05A 5K16A 1IWDA 3RVVA 3WXGA 3P5WA 1A6RA 5JH3A 3H8CA 4A5UA 4PP2E 3IFUA 3BB7A 2R9MA 2FUDA 1EWPA 1PVJA 1BQIA 3E9SA 2YJ2A 4XUIA 3PW3A 1AYVA 3BBAA 1KFXL 1QDQA 5CVOB 4CDFB 2R9FA 3IV2A 3C9EA 1THEA 3MTNA 4BOSA 5J94A 3BCNA 2IPPB 3F5VA 5EGWA 5EZQA 3CH3X 4AXMA 2AU1A 5CHTA 4BOQA 2HXZA 2JQGR 4I04A 1QOLA 1UKFA 2R9NA 2JTCA 3ERVA 2DCBA 3MHSA 1F2AA 4W5BA 1AU4A 5E6JA 1BY8A 1S4VA 1STFE 3TNXA 2FE8A 4D8BA 3PHXA 2P0RA 2F1GA 2HD5A 3U8EA 3OF9A 3USVA 3HWNA 3MJ5A 2DJFB 1MS6A 2R9CA 4OELA 4YYWA 3NHEA 1PPPA 9PAPA 1Q6KA 4ZUXU 4RY2A 3IMAA 2FTDA 1EWOA 1KHPA 2CB5A 6PADA 3KKUA 2JQFR 1AU3A 4D8IA 1GLOA 4MI7A 7PCKA 2OZ2A 3V6EA 1CQDA 3F75A 3B79A 4QRXA 1BGOA 2DOSA 2BU3A 4PADA 3D6SA 4RF0A 4N8WA 1PPNA 4BOZA 4W4UA 3N3GA 1Y08A 4BQVA 3W30A 3OQCA 1ICFA 1FH0A 5A24A 1TU6A 2BTWB 1DF0A 4BSQA 1POPA 1ATKA 2YJBA 4YYVA 3LFYA 3IUTA 1GCBA 3QJ3A 1GECE 3KWBX 3KWZA 1CVZA 3LXSA 1QXPA 3PHWA 4BOUA 1U5IA 4YYUA 2NQAA 2R9OA 2AGAA 2GFOA 1AU0A 4XR7A 4M0WA 3QT4A 1YVBA 4Q8GA 3M99A 2AYNA 2DC8A 2P7UA 3QSDA 5JZEA 1Y4HA 1BP4A 1O0EA 1PADA 2B1MA 2G6DA 2G8JA 1ME4A 1YK7A 1DEUA 2OULA 2WBFX 2J7QC 3GCBA 2NQIA 2Z84A 1U9QX 3WXEA 2VHFA 3AI8A 1EWLA 2HH5A 3N3KA 2FQ9A 1M6DA 2ATOA 4K7CA 1AYUA 3ZUAA 1F2BA 4W5CA 4MZSA 1CV8A 3OVZA 2DJGB 4FK5A 2IBIA 2AYOA 3KW9A 3PHUA 1MEMA 3CBKA 4DMXA 4RKXA 4IUMA 1YK8A 4PP1A 3RVXA 4OVZB 3P5UA 3PDFA 3PBHA 1YALA 1SNKA 4X6JA 2AVWA 2DC9A 2HHNA 3DF0A 3WXFA 4KLBA 3IHPA 4OEMA 3MORA 4YVAA 2FRAA 2VHSA 2AS8A 3K24A 2XU4A 4BS5A
chains in the Genus database with same CATH topology
1PPOA 3S3QA 2DZZA 3H6SA 4I07A 1U9WA 3O0UA 4YYRA 2H7JA 3HHAA 3CBJA 1NQCA 1F2CA 1ME3A 2DZYA 1YT7A 8PCHA 2E01A 1AYWA 1PPDA 4YV8A 4CZWA 1TL9A 1EWMA 5CHVA 2FT2A 1CJLA 2B1NA 3E1ZB 2O6XA 4DMYA 2BDZA 3H8BA 1NB5A 1EF7A 3HHIA 1HUCB 4BGFA 3LTWA 1CS8A 4FJCA 1XKGA 3BOWA 4MZOA 4X6IA 2AUXA 2PREA 4AXLA 2G7YA 3MHHA 1CPJA 1PXVA 2AIMA 4BPVA 1SP4B 2Y6EA 3OF8A 1K3BB 2DCDA 2ACTA 2FO5A 2AUZA 4GUZA 2ARYA 4QH6A 1KXRA 1CTEA 1ITOA 2C0YA 2E03A 1GMYA 3OISA 5CVMA 3IEJA 1W4TA 3N4CA 4N79A 4QRGA 2E00A 2DCCA 4X6HA 1VSNA 2VFCA 1PIPA 3K8UA 3S3RA 1PBHA 1GX3A 1VJVA 1QMYA 1F29A 1U9VA 1U9XA 4B55A 3CH2X 3H89A 1NLJA 1AU2A 1E2TA 3P5VA 4BS6A 1TLOA 3HD3A 1NB3A 1NL6A 2R6NA 3K9MA 2NQDB 1MIRA 4CDDB 2BDLA 3I06A 3PNRA 4NV8A 1X9YA 4MSXA 5CVNB 5FPWA 2P86A 1AECA 1CB5A 2GHUA 4QBBA 2E02A 2Y5BA 2NQGA 1ZIVA 2G8EA 1KHQA 2DCAA 3OVXA 3KFQA 5JA7A 1KFUL 1ZCMA 3V6CA 2BSZA 2PADA 4YYSA 4C5PA 4FIPA 2XU5A 4Q8HA 1MHWA 3KSEA 2OP3A 4CDEB 5PADA 2PNSA 3BWKA 4N4ZA 2F7DA 3BC3A 4QRVA 2FYEA 2YJCA 3RVWA 3KX1A 2YJ8A 2CIOA 4P6GA 3BPMA 4PI3A 2XU1A 2DC7A 5F02A 3H7DA 4CDCB 1JQPA 4WA6A 1MDWA 2DC6A 4YYQA 2FRQA 2XU3A 5EF4A 3D9WA 1AIMA 4G54A 2YJ9A 3O1GA 3IOQA 4HWYA 3P5XA 1NPZA 4P6EA 1PCIA 1PE6A 1MEGA 3I3TA 3BPFA 2PBHA 1CSBB 4I05A 5K16A 1IWDA 3RVVA 3WXGA 3P5WA 1A6RA 5JH3A 3H8CA 4PP2E 2R9MA 2FUDA 1EWPA 1BQIA 2YJ2A 4XUIA 3PW3A 1AYVA 1KFXL 1QDQA 5CVOB 4CDFB 2R9FA 3IV2A 3C9EA 1THEA 3MTNA 5J94A 3BCNA 2IPPB 3F5VA 5EGWA 3CH3X 4AXMA 2AU1A 5CHTA 2HXZA 2JQGR 4I04A 1QOLA 2R9NA 3ERVA 2DCBA 3MHSA 1F2AA 4W5BA 1AU4A 1BY8A 1S4VA 1STFE 3TNXA 2P0RA 2F1GA 2HD5A 3U8EA 3OF9A 3USVA 3HWNA 2DJFB 1MS6A 2R9CA 4OELA 4YYWA 3NHEA 1PPPA 9PAPA 1Q6KA 4ZUXU 4RY2A 3IMAA 2FTDA 1EWOA 1KHPA 2CB5A 6PADA 3KKUA 4NV7A 2JQFR 1AU3A 1GLOA 7PCKA 2OZ2A 3V6EA 1CQDA 3F75A 3B79A 4QRXA 1BGOA 4PADA 3D6SA 4N8WA 1PPNA 4W4UA 3N3GA 1Y08A 4BQVA 1ICFA 1FH0A 5A24A 1TU6A 2VFBA 1DF0A 4BSQA 1POPA 1ATKA 2YJBA 4YYVA 3LFYA 3IUTA 1GCBA 3QJ3A 1GECE 3KWBX 3KWZA 1CVZA 3LXSA 1QXPA 1U5IA 4YYUA 2NQAA 2R9OA 2GFOA 1AU0A 4XR7A 1W5RA 3QT4A 1YVBA 4Q8GA 3M99A 2AYNA 2DC8A 2P7UA 3QSDA 1Y4HA 1BP4A 1O0EA 1PADA 2B1MA 2G6DA 2G8JA 1ME4A 1YK7A 1DEUA 2OULA 2WBFX 3GCBA 2NQIA 1U9QX 3WXEA 2VHFA 3AI8A 1EWLA 2HH5A 3N3KA 2FQ9A 1M6DA 2ATOA 4K7CA 1AYUA 3ZUAA 1F2BA 4W5CA 4MZSA 1CV8A 3OVZA 2DJGB 4FK5A 2IBIA 2AYOA 3KW9A 1MEMA 3CBKA 4DMXA 1YK8A 4PP1A 1W6FA 3RVXA 3P5UA 3PDFA 3PBHA 1YALA 1SNKA 4X6JA 2AVWA 2DC9A 2HHNA 3DF0A 3WXFA 4KLBA 3IHPA 4OEMA 3MORA 4YVAA 2FRAA 2VHSA 2AS8A 3K24A 2XU4A 4BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPO A;  3S3Q A;  2DZZ A;  3H6S A;  4I07 A;  1U9W A;  3O0U A;  4YYR A;  2H7J A;  3HHA A;  3CBJ A;  1NQC A;  1F2C A;  1ME3 A;  2DZY A;  1YT7 A;  8PCH A;  2E01 A;  1AYW A;  1PPD A;  4YV8 A;  4CZW A;  1TL9 A;  1EWM A;  5CHV A;  2FT2 A;  1CJL A;  2B1N A;  3E1Z B;  2O6X A;  4DMY A;  2BDZ A;  3H8B A;  1NB5 A;  1EF7 A;  3HHI A;  1HUC B;  1CS8 A;  4FJC A;  1XKG A;  3BOW A;  4MZO A;  4X6I A;  2AUX A;  2PRE A;  4AXL A;  2G7Y A;  3MHH A;  1CPJ A;  1PXV A;  2AIM A;  4BPV A;  1SP4 B;  2Y6E A;  3OF8 A;  1K3B B;  2DCD A;  2ACT A;  2FO5 A;  2AUZ A;  2ARY A;  4QH6 A;  1KXR A;  1CTE A;  1ITO A;  2C0Y A;  2E03 A;  1GMY A;  3OIS A;  5CVM A;  3IEJ A;  3N4C A;  4N79 A;  4QRG A;  2E00 A;  2DCC A;  4X6H A;  1VSN A;  1PIP A;  3K8U A;  3S3R A;  1PBH A;  1VJV A;  1QMY A;  1F29 A;  1U9V A;  1U9X A;  3CH2 X;  3H89 A;  1NLJ A;  1AU2 A;  3P5V A;  4BS6 A;  1TLO A;  3HD3 A;  1NB3 A;  1NL6 A;  2R6N A;  3K9M A;  2NQD B;  1MIR A;  4CDD B;  2BDL A;  3I06 A;  3PNR A;  1X9Y A;  4MSX A;  5CVN B;  5FPW A;  2P86 A;  1AEC A;  1CB5 A;  2GHU A;  4QBB A;  2E02 A;  2Y5B A;  2NQG A;  1ZIV A;  2G8E A;  1KHQ A;  2DCA A;  3OVX A;  3KFQ A;  5JA7 A;  1KFU L;  1ZCM A;  3V6C A;  2PAD A;  4YYS A;  4FIP A;  2XU5 A;  4Q8H A;  1MHW A;  3KSE A;  2OP3 A;  4CDE B;  5PAD A;  2PNS A;  3BWK A;  4N4Z A;  2F7D A;  3BC3 A;  4QRV A;  2FYE A;  2YJC A;  3RVW A;  3KX1 A;  2YJ8 A;  2CIO A;  4P6G A;  3BPM A;  4PI3 A;  2XU1 A;  2DC7 A;  5F02 A;  3H7D A;  4CDC B;  1JQP A;  4WA6 A;  1MDW A;  2DC6 A;  4YYQ A;  2FRQ A;  2XU3 A;  5EF4 A;  1AIM A;  4G54 A;  2YJ9 A;  3O1G A;  3IOQ A;  4HWY A;  3P5X A;  1NPZ A;  4P6E A;  1PCI A;  1PE6 A;  1MEG A;  3I3T A;  3BPF A;  2PBH A;  1CSB B;  5K16 A;  4I05 A;  1IWD A;  3RVV A;  3WXG A;  3P5W A;  1A6R A;  5JH3 A;  3H8C A;  4PP2 E;  2R9M A;  2FUD A;  1EWP A;  1BQI A;  2YJ2 A;  4XUI A;  3PW3 A;  1AYV A;  1KFX L;  1QDQ A;  5CVO B;  4CDF B;  2R9F A;  3IV2 A;  3C9E A;  1THE A;  3MTN A;  5J94 A;  3BCN A;  2IPP B;  3F5V A;  5EGW A;  3CH3 X;  4AXM A;  2AU1 A;  5CHT A;  2HXZ A;  2JQG R;  4I04 A;  1QOL A;  2R9N A;  3ERV A;  2DCB A;  3MHS A;  1F2A A;  4W5B A;  1AU4 A;  1BY8 A;  1S4V A;  1STF E;  3TNX A;  2P0R A;  2F1G A;  2HD5 A;  3U8E A;  3OF9 A;  3USV A;  3HWN A;  2DJF B;  1MS6 A;  2R9C A;  4OEL A;  4YYW A;  3NHE A;  1PPP A;  9PAP A;  1Q6K A;  4ZUX U;  4RY2 A;  3IMA A;  2FTD A;  1EWO A;  1KHP A;  2CB5 A;  6PAD A;  3KKU A;  2JQF R;  1AU3 A;  1GLO A;  7PCK A;  2OZ2 A;  3V6E A;  1CQD A;  3F75 A;  3B79 A;  4QRX A;  1BGO A;  4PAD A;  3D6S A;  4N8W A;  1PPN A;  4W4U A;  3N3G A;  1Y08 A;  4BQV A;  1ICF A;  1FH0 A;  5A24 A;  1TU6 A;  1DF0 A;  4BSQ A;  1POP A;  1ATK A;  2YJB A;  4YYV A;  3LFY A;  3IUT A;  1GCB A;  3QJ3 A;  1GEC E;  3KWB X;  3KWZ A;  1CVZ A;  3LXS A;  1QXP A;  1U5I A;  4YYU A;  2NQA A;  2R9O A;  2GFO A;  1AU0 A;  4XR7 A;  3QT4 A;  1YVB A;  4Q8G A;  3M99 A;  2AYN A;  2DC8 A;  2P7U A;  3QSD A;  1Y4H A;  1BP4 A;  1O0E A;  1PAD A;  2B1M A;  2G6D A;  2G8J A;  1ME4 A;  1YK7 A;  1DEU A;  2OUL A;  2WBF X;  3GCB A;  2NQI A;  1U9Q X;  3WXE A;  2VHF A;  3AI8 A;  1EWL A;  2HH5 A;  3N3K A;  2FQ9 A;  1M6D A;  2ATO A;  4K7C A;  1AYU A;  3ZUA A;  1F2B A;  4W5C A;  4MZS A;  1CV8 A;  3OVZ A;  2DJG B;  4FK5 A;  2IBI A;  2AYO A;  3KW9 A;  1MEM A;  3CBK A;  4DMX A;  1YK8 A;  4PP1 A;  3RVX A;  3P5U A;  3PDF A;  3PBH A;  1YAL A;  1SNK A;  4X6J A;  2AVW A;  2DC9 A;  2HHN A;  3DF0 A;  3WXF A;  4KLB A;  3IHP A;  4OEM A;  3MOR A;  4YVA A;  2FRA A;  2VHS A;  2AS8 A;  3K24 A;  2XU4 A;  4BS5 A; 
#chains in the Genus database with same CATH topology
 1PPO A;  3PT2 A;  3S3Q A;  1DKI A;  3B21 A;  2DZZ A;  3H6S A;  4I07 A;  4IP3 A;  1U9W A;  3O0U A;  4YYR A;  2H7J A;  3HHA A;  3CBJ A;  4REZ A;  1NQC A;  1F2C A;  1ME3 A;  2DZY A;  1YT7 A;  8PCH A;  2E01 A;  1AYW A;  3C0R A;  1PPD A;  4YV8 A;  4CZW A;  1TL9 A;  1EWM A;  5CHV A;  2FT2 A;  1CJL A;  2B1N A;  3E1Z B;  2J7Q A;  3TRK A;  4RNA A;  2O6X A;  4DMY A;  2BDZ A;  3H8B A;  1NB5 A;  3O65 A;  1EF7 A;  3HHI A;  1HUC B;  4PT5 A;  1CS8 A;  2UZJ A;  4FJC A;  1XKG A;  3BOW A;  3PRP A;  4MZO A;  4X6I A;  2AUX A;  2PRE A;  4AXL A;  2G7Y A;  3MHH A;  1CPJ A;  1PXV A;  2AIM A;  4BPV A;  1SP4 B;  2Y6E A;  3OF8 A;  1K3B B;  2DCD A;  2ACT A;  2FO5 A;  2AUZ A;  2ARY A;  4QH6 A;  1KXR A;  1CTE A;  1ITO A;  2C0Y A;  2E03 A;  1GMY A;  3PRM A;  3OIS A;  5CVM A;  3IEJ A;  3N4C A;  4N79 A;  4QRG A;  2E00 A;  2DCC A;  4X6H A;  1YZB A;  1VSN A;  1PIP A;  3K8U A;  3S3R A;  1PBH A;  1VJV A;  1QMY A;  1F29 A;  1U9V A;  1U9X A;  3CH2 X;  3H89 A;  1NLJ A;  1AU2 A;  4WUR A;  3P5V A;  4BS6 A;  4XZX A;  1TLO A;  3HD3 A;  1NB3 A;  1NL6 A;  2R6N A;  2JRI A;  3K9M A;  2NQD B;  3MP2 A;  1MIR A;  4CDD B;  2BDL A;  3I06 A;  3PNR A;  3ZNH A;  4OVZ A;  1X9Y A;  4MSX A;  5CVN B;  3RNV A;  4P16 A;  2P86 A;  1AEC A;  5EZS A;  5FPW A;  4GUA A;  1CB5 A;  2GHU A;  4QBB A;  2E02 A;  2Y5B A;  2NQG A;  1ZIV A;  2G8E A;  1KHQ A;  4HXD B;  2DCA A;  3OVX A;  3KFQ A;  5JA7 A;  1KFU L;  3MTV A;  1ZCM A;  3V6C A;  3W31 A;  2PAD A;  4YYS A;  4FIP A;  2XU5 A;  4Q8H A;  1MHW A;  3KSE A;  2OP3 A;  4CDE B;  4R3D A;  5PAD A;  2PNS A;  3BWK A;  4N4Z A;  2F7D A;  3BC3 A;  4QRV A;  4D8E A;  2FYE A;  2YJC A;  3RVW A;  3KX1 A;  4BOP A;  5KO3 A;  2YJ8 A;  2CIO A;  4P6G A;  3BPM A;  4PI3 A;  2XU1 A;  2DC7 A;  5F02 A;  3H7D A;  4CDC B;  1JQP A;  4WA6 A;  1MDW A;  2DC6 A;  4YYQ A;  3PSE A;  2FRQ A;  4MM3 B;  2XU3 A;  5EF4 A;  1AIM A;  2HWK A;  4G54 A;  2YJ9 A;  3O1G A;  3IOQ A;  4HWY A;  3P5X A;  3BY4 A;  1NPZ A;  4P6E A;  1PCI A;  1PE6 A;  2BTW A;  3TMP A;  4OW0 A;  1MEG A;  3I3T A;  3BPF A;  4RF1 A;  2PBH A;  1CSB B;  4ZTB A;  4I05 A;  5K16 A;  1IWD A;  3RVV A;  3WXG A;  3P5W A;  1A6R A;  5JH3 A;  3H8C A;  4A5U A;  4PP2 E;  3IFU A;  3BB7 A;  2R9M A;  2FUD A;  1EWP A;  1PVJ A;  1BQI A;  3E9S A;  2YJ2 A;  4XUI A;  3PW3 A;  1AYV A;  3BBA A;  1KFX L;  1QDQ A;  5CVO B;  4CDF B;  2R9F A;  3IV2 A;  3C9E A;  1THE A;  3MTN A;  4BOS A;  5J94 A;  3BCN A;  2IPP B;  3F5V A;  5EGW A;  5EZQ A;  3CH3 X;  4AXM A;  2AU1 A;  5CHT A;  4BOQ A;  2HXZ A;  2JQG R;  4I04 A;  1QOL A;  1UKF A;  2R9N A;  2JTC A;  3ERV A;  2DCB A;  3MHS A;  1F2A A;  4W5B A;  1AU4 A;  5E6J A;  1BY8 A;  1S4V A;  1STF E;  3TNX A;  2FE8 A;  4D8B A;  3PHX A;  2P0R A;  2F1G A;  2HD5 A;  3U8E A;  3OF9 A;  3USV A;  3HWN A;  3MJ5 A;  2DJF B;  1MS6 A;  2R9C A;  4OEL A;  4YYW A;  3NHE A;  1PPP A;  9PAP A;  1Q6K A;  4ZUX U;  4RY2 A;  3IMA A;  2FTD A;  1EWO A;  1KHP A;  2CB5 A;  6PAD A;  3KKU A;  2JQF R;  1AU3 A;  4D8I A;  1GLO A;  4MI7 A;  7PCK A;  2OZ2 A;  3V6E A;  1CQD A;  3F75 A;  3B79 A;  4QRX A;  1BGO A;  2DOS A;  2BU3 A;  4PAD A;  3D6S A;  4RF0 A;  4N8W A;  1PPN A;  4BOZ A;  4W4U A;  3N3G A;  1Y08 A;  4BQV A;  3W30 A;  3OQC A;  1ICF A;  1FH0 A;  5A24 A;  1TU6 A;  2BTW B;  1DF0 A;  4BSQ A;  1POP A;  1ATK A;  2YJB A;  4YYV A;  3LFY A;  3IUT A;  1GCB A;  3QJ3 A;  1GEC E;  3KWB X;  3KWZ A;  1CVZ A;  3LXS A;  1QXP A;  3PHW A;  4BOU A;  1U5I A;  4YYU A;  2NQA A;  2R9O A;  2AGA A;  2GFO A;  1AU0 A;  4XR7 A;  4M0W A;  3QT4 A;  1YVB A;  4Q8G A;  3M99 A;  2AYN A;  2DC8 A;  2P7U A;  3QSD A;  5JZE A;  1Y4H A;  1BP4 A;  1O0E A;  1PAD A;  2B1M A;  2G6D A;  2G8J A;  1ME4 A;  1YK7 A;  1DEU A;  2OUL A;  2WBF X;  2J7Q C;  3GCB A;  2NQI A;  2Z84 A;  1U9Q X;  3WXE A;  2VHF A;  3AI8 A;  1EWL A;  2HH5 A;  3N3K A;  2FQ9 A;  1M6D A;  2ATO A;  4K7C A;  1AYU A;  3ZUA A;  1F2B A;  4W5C A;  4MZS A;  1CV8 A;  3OVZ A;  2DJG B;  4FK5 A;  2IBI A;  2AYO A;  3KW9 A;  3PHU A;  1MEM A;  3CBK A;  4DMX A;  4RKX A;  4IUM A;  1YK8 A;  4PP1 A;  3RVX A;  4OVZ B;  3P5U A;  3PDF A;  3PBH A;  1YAL A;  1SNK A;  4X6J A;  2AVW A;  2DC9 A;  2HHN A;  3DF0 A;  3WXF A;  4KLB A;  3IHP A;  4OEM A;  3MOR A;  4YVA A;  2FRA A;  2VHS A;  2AS8 A;  3K24 A;  2XU4 A;  4BS5 A; 
#chains in the Genus database with same CATH homology
 1PPO A;  3S3Q A;  2DZZ A;  3H6S A;  4I07 A;  1U9W A;  3O0U A;  4YYR A;  2H7J A;  3HHA A;  3CBJ A;  1NQC A;  1F2C A;  1ME3 A;  2DZY A;  1YT7 A;  8PCH A;  2E01 A;  1AYW A;  1PPD A;  4YV8 A;  4CZW A;  1TL9 A;  1EWM A;  5CHV A;  2FT2 A;  1CJL A;  2B1N A;  3E1Z B;  2O6X A;  4DMY A;  2BDZ A;  3H8B A;  1NB5 A;  1EF7 A;  3HHI A;  1HUC B;  4BGF A;  3LTW A;  1CS8 A;  4FJC A;  1XKG A;  3BOW A;  4MZO A;  4X6I A;  2AUX A;  2PRE A;  4AXL A;  2G7Y A;  3MHH A;  1CPJ A;  1PXV A;  2AIM A;  4BPV A;  1SP4 B;  2Y6E A;  3OF8 A;  1K3B B;  2DCD A;  2ACT A;  2FO5 A;  2AUZ A;  4GUZ A;  2ARY A;  4QH6 A;  1KXR A;  1CTE A;  1ITO A;  2C0Y A;  2E03 A;  1GMY A;  3OIS A;  5CVM A;  3IEJ A;  1W4T A;  3N4C A;  4N79 A;  4QRG A;  2E00 A;  2DCC A;  4X6H A;  1VSN A;  2VFC A;  1PIP A;  3K8U A;  3S3R A;  1PBH A;  1GX3 A;  1VJV A;  1QMY A;  1F29 A;  1U9V A;  1U9X A;  4B55 A;  3CH2 X;  3H89 A;  1NLJ A;  1AU2 A;  1E2T A;  3P5V A;  4BS6 A;  1TLO A;  3HD3 A;  1NB3 A;  1NL6 A;  2R6N A;  3K9M A;  2NQD B;  1MIR A;  4CDD B;  2BDL A;  3I06 A;  3PNR A;  4NV8 A;  1X9Y A;  4MSX A;  5CVN B;  5FPW A;  2P86 A;  1AEC A;  1CB5 A;  2GHU A;  4QBB A;  2E02 A;  2Y5B A;  2NQG A;  1ZIV A;  2G8E A;  1KHQ A;  2DCA A;  3OVX A;  3KFQ A;  5JA7 A;  1KFU L;  1ZCM A;  3V6C A;  2BSZ A;  2PAD A;  4YYS A;  4C5P A;  4FIP A;  2XU5 A;  4Q8H A;  1MHW A;  3KSE A;  2OP3 A;  4CDE B;  5PAD A;  2PNS A;  3BWK A;  4N4Z A;  2F7D A;  3BC3 A;  4QRV A;  2FYE A;  2YJC A;  3RVW A;  3KX1 A;  2YJ8 A;  2CIO A;  4P6G A;  3BPM A;  4PI3 A;  2XU1 A;  2DC7 A;  5F02 A;  3H7D A;  4CDC B;  1JQP A;  4WA6 A;  1MDW A;  2DC6 A;  4YYQ A;  2FRQ A;  2XU3 A;  5EF4 A;  3D9W A;  1AIM A;  4G54 A;  2YJ9 A;  3O1G A;  3IOQ A;  4HWY A;  3P5X A;  1NPZ A;  4P6E A;  1PCI A;  1PE6 A;  1MEG A;  3I3T A;  3BPF A;  2PBH A;  1CSB B;  4I05 A;  5K16 A;  1IWD A;  3RVV A;  3WXG A;  3P5W A;  1A6R A;  5JH3 A;  3H8C A;  4PP2 E;  2R9M A;  2FUD A;  1EWP A;  1BQI A;  2YJ2 A;  4XUI A;  3PW3 A;  1AYV A;  1KFX L;  1QDQ A;  5CVO B;  4CDF B;  2R9F A;  3IV2 A;  3C9E A;  1THE A;  3MTN A;  5J94 A;  3BCN A;  2IPP B;  3F5V A;  5EGW A;  3CH3 X;  4AXM A;  2AU1 A;  5CHT A;  2HXZ A;  2JQG R;  4I04 A;  1QOL A;  2R9N A;  3ERV A;  2DCB A;  3MHS A;  1F2A A;  4W5B A;  1AU4 A;  1BY8 A;  1S4V A;  1STF E;  3TNX A;  2P0R A;  2F1G A;  2HD5 A;  3U8E A;  3OF9 A;  3USV A;  3HWN A;  2DJF B;  1MS6 A;  2R9C A;  4OEL A;  4YYW A;  3NHE A;  1PPP A;  9PAP A;  1Q6K A;  4ZUX U;  4RY2 A;  3IMA A;  2FTD A;  1EWO A;  1KHP A;  2CB5 A;  6PAD A;  3KKU A;  4NV7 A;  2JQF R;  1AU3 A;  1GLO A;  7PCK A;  2OZ2 A;  3V6E A;  1CQD A;  3F75 A;  3B79 A;  4QRX A;  1BGO A;  4PAD A;  3D6S A;  4N8W A;  1PPN A;  4W4U A;  3N3G A;  1Y08 A;  4BQV A;  1ICF A;  1FH0 A;  5A24 A;  1TU6 A;  2VFB A;  1DF0 A;  4BSQ A;  1POP A;  1ATK A;  2YJB A;  4YYV A;  3LFY A;  3IUT A;  1GCB A;  3QJ3 A;  1GEC E;  3KWB X;  3KWZ A;  1CVZ A;  3LXS A;  1QXP A;  1U5I A;  4YYU A;  2NQA A;  2R9O A;  2GFO A;  1AU0 A;  4XR7 A;  1W5R A;  3QT4 A;  1YVB A;  4Q8G A;  3M99 A;  2AYN A;  2DC8 A;  2P7U A;  3QSD A;  1Y4H A;  1BP4 A;  1O0E A;  1PAD A;  2B1M A;  2G6D A;  2G8J A;  1ME4 A;  1YK7 A;  1DEU A;  2OUL A;  2WBF X;  3GCB A;  2NQI A;  1U9Q X;  3WXE A;  2VHF A;  3AI8 A;  1EWL A;  2HH5 A;  3N3K A;  2FQ9 A;  1M6D A;  2ATO A;  4K7C A;  1AYU A;  3ZUA A;  1F2B A;  4W5C A;  4MZS A;  1CV8 A;  3OVZ A;  2DJG B;  4FK5 A;  2IBI A;  2AYO A;  3KW9 A;  1MEM A;  3CBK A;  4DMX A;  1YK8 A;  4PP1 A;  1W6F A;  3RVX A;  3P5U A;  3PDF A;  3PBH A;  1YAL A;  1SNK A;  4X6J A;  2AVW A;  2DC9 A;  2HHN A;  3DF0 A;  3WXF A;  4KLB A;  3IHP A;  4OEM A;  3MOR A;  4YVA A;  2FRA A;  2VHS A;  2AS8 A;  3K24 A;  2XU4 A;  4BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...