1KHQA

Orthorhombic form of papain/zlfg-dam covalent complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two polymorphs of a covalent complex between papain and a diazomethylketone inhibitor
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Papain
total genus 73
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1khqA00
1PE6A 2YJ8A 2DJFB 4PI3A 4CZWA 5CVOB 1KHPA 1XKGA 3IEJA 1EWLA 4WA6A 4OEMA 4RY2A 2R9MA 3H7DA 4G54A 2WBFX 1YK8A 3U8EA 2R9NA 1VJVA 1VSNA 1ZCMA 4XUIA 1HUCB 3BPMA 4MZSA 2YJ2A 3I06A 5CHTA 4BS6A 3F5VA 1KXRA 4CDDB 2XU4A 3IMAA 3V6EA 3K24A 2AYNA 3KKUA 3RVWA 1AU2A 3QT4A 4N79A 4K7CA 1F2AA 3KFQA 2E02A 3K8UA 3I3TA 3IOQA 3RVXA 1YT7A 4W5CA 2E00A 1TU6A 1MIRA 3KX1A 1AU0A 1F2CA 1O0EA 3H89A 2CIOA 1U9XA 4FIPA 2YJCA 2R9OA 3CH2X 1CTEA 7PCKA 1NB5A 2DCAA 4PP1A 2B1NA 2AIMA 3KWZA 3N3GA 1AIMA 3B79A 2Y6EA 3C9EA 3ERVA 2AYOA 2OULA 3OF9A 4DMYA 2HH5A 2FO5A 2FRAA 4DMXA 2OZ2A 2R6NA 3HHAA 4I04A 2PADA 2YJBA 1POPA 4MSXA 1MS6A 2G7YA 1NB3A 4KLBA 3LXSA 3OISA 1PXVA 2FRQA 1DF0A 1PCIA 3P5UA 1BQIA 3CBKA 1F2BA 2O6XA 1AYWA 2FTDA 1YVBA 2XU1A 2PBHA 1AU4A 3HWNA 3CH3X 4Q8HA 1CVZA 3P5WA 1GCBA 4QRGA 4QBBA 2DC9A 3KW9A 1BP4A 1CJLA 1KFXL 1S4VA 4QRXA 1PIPA 3PNRA 3BWKA 1TLOA 3LFYA 4BQVA 2DC8A 2DZZA 3MHHA 3NHEA 2XU3A 3K9MA 4CDFB 2NQIA 4YYVA 2AU1A 2G8JA 4YYRA 4P6EA 4ZUXU 2HD5A 2AUXA 1CB5A 4X6IA 1ME4A 4N4ZA 1AYUA 2ARYA 2NQAA 3D6SA 3KWBX 2NQGA 1EF7A 3P5VA 2IPPB 1AECA 4XR7A 1BY8A 4CDCB 2H7JA 3PBHA 2DC7A 2GHUA 2IBIA 1EWPA 2OP3A 5EGWA 3V6CA 2C0YA 2E01A 2DCBA 3WXGA 3MORA 1CV8A 2DJGB 4FJCA 5J94A 3USVA 3M99A 3TNXA 4QH6A 1QDQA 3HD3A 1U9VA 2ATOA 2BDLA 4W5BA 2E03A 4P6GA 1TL9A 3KSEA 1PADA 2P0RA 3E1ZB 3H8CA 1PPOA 4YYQA 1GLOA 1ATKA 4AXMA 1THEA 1AYVA 1F29A 3IUTA 1FH0A 4CDEB 3IV2A 2Y5BA 2DCDA 2R9CA 6PADA 2FYEA 1PBHA 5CHVA 4YYSA 2F1GA 1STFE 1NL6A 1A6RA 3DF0A 2HXZA 1GECE 3CBJA 1BGOA 4I07A 1KFUL 1DEUA 3H6SA 4Q8GA 2B1MA 1CQDA 1MDWA 3QJ3A 3WXFA 1SP4B 1U5IA 4MZOA 2XU5A 2R9FA 1QXPA 1PPPA 3IHPA 2FQ9A 1IWDA 2JQGR 3O1GA 5FPWA 1EWMA 1GMYA 3N4CA 2F7DA 8PCHA 4FK5A 4YV8A 2VHFA 4BSQA 2DCCA 1QMYA 3OVZA 4OELA 1JQPA 4X6HA 4PP2E 1PPDA 3S3RA 2GFOA 1CS8A 4HWYA 3RVVA 3AI8A 1CPJA 2AS8A 3WXEA 1MEMA 3H8BA 2DC6A 1MHWA 4YYWA 5JA7A 5F02A 3BC3A 1YK7A 1K3BB 1Y4HA 3HHIA 2PREA 5JH3A 1YALA 1KHQA 2FT2A 4AXLA 3MTNA 1NQCA 4BPVA 1MEGA 4N8WA 3OF8A 4YVAA 1ITOA 1SNKA 3PW3A 2P7UA 9PAPA 1AU3A 2DZYA 2PNSA 3O0UA 2CB5A 2HHNA 3QSDA 1Q6KA 3BOWA 3BCNA 3S3QA 1ZIVA 1ME3A 2FUDA 5CVNB 1CSBB 1U9WA 3P5XA 4BS5A 4PADA 1NPZA 2AVWA 4QRVA 2AUZA 3MHSA 1M6DA 5PADA 1U9QX 5A24A 1EWOA 1QOLA 2VHSA 3N3KA 3BPFA 3OVXA 1ICFA 4X6JA 1X9YA 3ZUAA 5EF4A 3GCBA 4I05A 2YJ9A 5CVMA 2JQFR 2NQDB 2G6DA 5K16A 3F75A 1Y08A 1PPNA 2G8EA 2ACTA 4W4UA 2BDZA 1NLJA 4YYUA 3PDFA 2P86A
chains in the Genus database with same CATH superfamily
2J7QA 1PE6A 2YJ8A 2DJFB 4PI3A 4CZWA 5CVOB 1KHPA 1XKGA 2HWKA 3IEJA 1EWLA 4OEMA 4P16A 4WA6A 4RY2A 2R9MA 3H7DA 4G54A 2WBFX 1YK8A 3U8EA 2R9NA 1VJVA 1VSNA 1ZCMA 4XUIA 1HUCB 3BPMA 4MZSA 2YJ2A 3I06A 5CHTA 1DKIA 4BS6A 2BU3A 3BB7A 3F5VA 1KXRA 4CDDB 2XU4A 3IMAA 3V6EA 3K24A 4BOZA 2AYNA 3KKUA 3RVWA 2UZJA 1AU2A 3QT4A 4N79A 4BOUA 1UKFA 4K7CA 1F2AA 3KFQA 2E02A 3K8UA 3I3TA 3IOQA 3RVXA 1YT7A 4W5CA 2E00A 5EZQA 1TU6A 1MIRA 3KX1A 1AU0A 1F2CA 4IP3A 1O0EA 3H89A 2CIOA 1U9XA 4OVZA 4FIPA 2YJCA 2R9OA 3CH2X 1CTEA 7PCKA 1NB5A 2DCAA 4PP1A 2B1NA 2AGAA 2AIMA 3KWZA 3N3GA 1AIMA 3B79A 2Y6EA 3TRKA 5E6JA 3C9EA 3ERVA 2AYOA 4OVZB 4PT5A 2OULA 3OF9A 4DMYA 2HH5A 2FO5A 2FRAA 4DMXA 2OZ2A 2R6NA 3HHAA 4I04A 2PADA 2YJBA 1POPA 4MSXA 4MI7A 1MS6A 2G7YA 1NB3A 4KLBA 3LXSA 3OISA 1PXVA 2FRQA 3BY4A 1DF0A 1PCIA 3P5UA 1BQIA 3CBKA 1F2BA 2O6XA 4A5UA 1AYWA 2FTDA 4MM3B 1YVBA 2XU1A 2PBHA 1AU4A 3HWNA 3PHWA 3CH3X 4Q8HA 1CVZA 3P5WA 1GCBA 4QRGA 4QBBA 2DC9A 3KW9A 1BP4A 1CJLA 1KFXL 4RKXA 2Z84A 5KO3A 4HXDB 3PRPA 4RF0A 1S4VA 3C0RA 4QRXA 1PIPA 3PNRA 3LFYA 3BWKA 1TLOA 4BQVA 3MP2A 3MHHA 2DC8A 2DZZA 3NHEA 2XU3A 3K9MA 4CDFB 2NQIA 4YYVA 2AU1A 4R3DA 2G8JA 4YYRA 4P6EA 4ZUXU 2HD5A 2AUXA 1CB5A 4X6IA 1ME4A 4N4ZA 3D6SA 1AYUA 2ARYA 2NQAA 3KWBX 2NQGA 2BTWB 1EF7A 2BTWA 3P5VA 2IPPB 1AECA 4XR7A 1BY8A 4CDCB 2H7JA 3PBHA 2DC7A 2GHUA 2IBIA 4GUAA 1EWPA 2OP3A 5EGWA 3V6CA 2C0YA 2E01A 2DCBA 3WXGA 3MORA 1CV8A 2DJGB 4FJCA 5J94A 3USVA 3M99A 3TNXA 4QH6A 1QDQA 3HD3A 4D8BA 3W30A 1U9VA 2ATOA 2BDLA 4W5BA 2E03A 4P6GA 1TL9A 3KSEA 1PADA 2P0RA 3E1ZB 3H8CA 3RNVA 1PPOA 4YYQA 1GLOA 3W31A 3O65A 1ATKA 4AXMA 4IUMA 1THEA 1AYVA 1F29A 3IUTA 1FH0A 4CDEB 3IV2A 2Y5BA 2DCDA 2R9CA 6PADA 2FYEA 1PBHA 5CHVA 4YYSA 2F1GA 1STFE 1NL6A 1A6RA 3PT2A 4BOPA 2J7QC 3DF0A 2HXZA 1GECE 4M0WA 3CBJA 1BGOA 4I07A 1KFUL 3ZNHA 1DEUA 3H6SA 4Q8GA 2B1MA 1CQDA 1MDWA 4OW0A 3QJ3A 3WXFA 1SP4B 1U5IA 4MZOA 2XU5A 2R9FA 1QXPA 1PPPA 3IHPA 2FQ9A 1IWDA 2JQGR 3O1GA 5FPWA 1EWMA 1GMYA 3N4CA 2F7DA 8PCHA 4FK5A 2DOSA 4YV8A 2VHFA 2JRIA 4BSQA 2DCCA 1QMYA 3OVZA 3E9SA 4OELA 1JQPA 4X6HA 4PP2E 1PPDA 4D8EA 3S3RA 2GFOA 1CS8A 3TMPA 4HWYA 3RVVA 3AI8A 1CPJA 2AS8A 3WXEA 1MEMA 3H8BA 2DC6A 1MHWA 4YYWA 4REZA 1YZBA 5JA7A 5F02A 3PRMA 3OQCA 4BOQA 3BC3A 1YK7A 1K3BB 1Y4HA 3HHIA 2PREA 5JH3A 1YALA 3B21A 1KHQA 2FT2A 4WURA 5JZEA 4AXLA 3MTNA 4RF1A 1NQCA 4BOSA 4BPVA 1MEGA 4N8WA 3OF8A 4YVAA 1ITOA 1SNKA 3PW3A 2P7UA 9PAPA 1AU3A 2DZYA 2PNSA 3O0UA 2CB5A 2HHNA 3QSDA 1Q6KA 1PVJA 3BOWA 3BCNA 4XZXA 3S3QA 1ZIVA 1ME3A 2FUDA 2FE8A 3MTVA 5CVNB 1CSBB 1U9WA 3P5XA 3BBAA 4BS5A 4PADA 1NPZA 2AVWA 3IFUA 4QRVA 2AUZA 3MHSA 1M6DA 5PADA 3PHXA 3PSEA 1U9QX 4ZTBA 5A24A 3MJ5A 1EWOA 1QOLA 2VHSA 3N3KA 3BPFA 3OVXA 1ICFA 4X6JA 3PHUA 1X9YA 3ZUAA 5EF4A 3GCBA 4I05A 2YJ9A 4RNAA 2JTCA 5CVMA 4D8IA 2JQFR 2NQDB 2G6DA 5EZSA 5K16A 3F75A 1Y08A 1PPNA 2G8EA 2ACTA 4W4UA 2BDZA 1NLJA 4YYUA 3PDFA 2P86A
chains in the Genus database with same CATH topology
1PE6A 2YJ8A 2DJFB 4PI3A 4CZWA 5CVOB 1KHPA 1XKGA 3IEJA 1EWLA 4WA6A 4OEMA 4RY2A 2R9MA 3H7DA 4G54A 2WBFX 1YK8A 3U8EA 2R9NA 1VJVA 1VSNA 1ZCMA 4XUIA 1HUCB 3BPMA 4MZSA 2YJ2A 3I06A 5CHTA 4BS6A 3F5VA 1KXRA 4CDDB 2XU4A 3IMAA 3V6EA 3K24A 2AYNA 3KKUA 3RVWA 1AU2A 3QT4A 4N79A 4K7CA 4B55A 1F2AA 3KFQA 2E02A 3K8UA 3I3TA 3IOQA 3RVXA 1YT7A 4W5CA 2E00A 1TU6A 1MIRA 3KX1A 1AU0A 1F2CA 1O0EA 3H89A 2CIOA 1U9XA 4FIPA 4GUZA 2YJCA 2R9OA 3CH2X 1CTEA 7PCKA 1NB5A 2DCAA 4PP1A 2B1NA 2AIMA 3KWZA 3N3GA 1AIMA 3B79A 2Y6EA 3C9EA 3ERVA 2AYOA 4NV7A 2OULA 3OF9A 4DMYA 2HH5A 2FO5A 2FRAA 4DMXA 2OZ2A 2R6NA 3HHAA 4I04A 2PADA 2YJBA 1POPA 4MSXA 1MS6A 2G7YA 1NB3A 4KLBA 3LXSA 3OISA 1PXVA 2FRQA 1DF0A 1PCIA 3P5UA 1BQIA 3CBKA 1F2BA 2O6XA 1AYWA 2FTDA 1YVBA 2XU1A 2PBHA 1AU4A 3HWNA 3CH3X 4Q8HA 1CVZA 2VFCA 3P5WA 1GCBA 4QRGA 4QBBA 2DC9A 3KW9A 1BP4A 1CJLA 1KFXL 1S4VA 4QRXA 1PIPA 3PNRA 3BWKA 1TLOA 3LFYA 4BQVA 2DC8A 2DZZA 3MHHA 3NHEA 2XU3A 3K9MA 4CDFB 2NQIA 4YYVA 2AU1A 1W5RA 2G8JA 4YYRA 4P6EA 4ZUXU 2HD5A 2AUXA 1CB5A 4X6IA 1ME4A 4N4ZA 1AYUA 2ARYA 2NQAA 3D6SA 3KWBX 2NQGA 1EF7A 3P5VA 2IPPB 1AECA 4XR7A 1BY8A 4CDCB 2H7JA 3PBHA 2DC7A 2GHUA 2IBIA 1EWPA 2OP3A 5EGWA 3V6CA 2C0YA 2E01A 2DCBA 3WXGA 3MORA 1CV8A 2DJGB 4FJCA 5J94A 3USVA 1GX3A 3M99A 3TNXA 4QH6A 1QDQA 3HD3A 1U9VA 2ATOA 2BDLA 4W5BA 2E03A 4P6GA 1TL9A 3KSEA 1PADA 2P0RA 3E1ZB 3H8CA 1PPOA 4YYQA 1GLOA 1ATKA 4AXMA 1THEA 1AYVA 1F29A 3IUTA 1FH0A 4CDEB 4C5PA 3IV2A 2Y5BA 2DCDA 2R9CA 6PADA 2FYEA 1PBHA 5CHVA 4YYSA 2F1GA 1STFE 1NL6A 1A6RA 3DF0A 2HXZA 1GECE 3CBJA 1BGOA 4I07A 1KFUL 1DEUA 3H6SA 4Q8GA 2B1MA 1CQDA 1MDWA 3QJ3A 3WXFA 1SP4B 1U5IA 4MZOA 2XU5A 2R9FA 1QXPA 1PPPA 3IHPA 2FQ9A 1IWDA 2JQGR 3O1GA 5FPWA 1EWMA 1GMYA 3N4CA 2F7DA 8PCHA 4FK5A 4BGFA 4YV8A 2VHFA 4BSQA 2DCCA 1QMYA 3OVZA 4OELA 1JQPA 4X6HA 4PP2E 1PPDA 3S3RA 2GFOA 1CS8A 4HWYA 3RVVA 3AI8A 2VFBA 1CPJA 2AS8A 3WXEA 1MEMA 3H8BA 2DC6A 1MHWA 4YYWA 5JA7A 5F02A 3BC3A 1YK7A 1K3BB 1Y4HA 3HHIA 2PREA 5JH3A 2BSZA 1YALA 1KHQA 2FT2A 1E2TA 4AXLA 3MTNA 1NQCA 4BPVA 1MEGA 4N8WA 3OF8A 4YVAA 1ITOA 1SNKA 3PW3A 2P7UA 9PAPA 1AU3A 1W6FA 2DZYA 2PNSA 3O0UA 2CB5A 2HHNA 3QSDA 1Q6KA 3BOWA 3BCNA 4NV8A 3S3QA 1ZIVA 1ME3A 2FUDA 5CVNB 3D9WA 1CSBB 1U9WA 3P5XA 4BS5A 4PADA 1NPZA 2AVWA 4QRVA 2AUZA 3MHSA 1M6DA 5PADA 1U9QX 5A24A 1EWOA 1QOLA 2VHSA 1W4TA 3N3KA 3BPFA 3OVXA 1ICFA 4X6JA 1X9YA 3ZUAA 5EF4A 3GCBA 4I05A 2YJ9A 5CVMA 2JQFR 2NQDB 2G6DA 5K16A 3F75A 1Y08A 1PPNA 2G8EA 2ACTA 4W4UA 3LTWA 2BDZA 1NLJA 4YYUA 3PDFA 2P86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE6 A;  2YJ8 A;  2DJF B;  4PI3 A;  4CZW A;  5CVO B;  1KHP A;  1XKG A;  3IEJ A;  1EWL A;  4WA6 A;  4OEM A;  4RY2 A;  2R9M A;  3H7D A;  4G54 A;  2WBF X;  1YK8 A;  3U8E A;  2R9N A;  1VJV A;  1VSN A;  1ZCM A;  4XUI A;  1HUC B;  3BPM A;  4MZS A;  2YJ2 A;  3I06 A;  5CHT A;  4BS6 A;  3F5V A;  1KXR A;  4CDD B;  2XU4 A;  3IMA A;  3V6E A;  3K24 A;  2AYN A;  3KKU A;  3RVW A;  1AU2 A;  3QT4 A;  4N79 A;  4K7C A;  1F2A A;  3KFQ A;  2E02 A;  3K8U A;  3I3T A;  3IOQ A;  3RVX A;  1YT7 A;  4W5C A;  2E00 A;  1TU6 A;  1MIR A;  3KX1 A;  1AU0 A;  1F2C A;  1O0E A;  3H89 A;  2CIO A;  1U9X A;  4FIP A;  2YJC A;  2R9O A;  3CH2 X;  1CTE A;  7PCK A;  1NB5 A;  2DCA A;  4PP1 A;  2B1N A;  2AIM A;  3KWZ A;  3N3G A;  1AIM A;  3B79 A;  2Y6E A;  3C9E A;  3ERV A;  2AYO A;  2OUL A;  3OF9 A;  4DMY A;  2HH5 A;  2FO5 A;  2FRA A;  4DMX A;  2OZ2 A;  2R6N A;  3HHA A;  4I04 A;  2PAD A;  2YJB A;  1POP A;  4MSX A;  1MS6 A;  2G7Y A;  1NB3 A;  4KLB A;  3LXS A;  3OIS A;  1PXV A;  2FRQ A;  1DF0 A;  1PCI A;  3P5U A;  1BQI A;  3CBK A;  1F2B A;  2O6X A;  1AYW A;  2FTD A;  1YVB A;  2XU1 A;  2PBH A;  1AU4 A;  3HWN A;  3CH3 X;  4Q8H A;  1CVZ A;  3P5W A;  1GCB A;  4QRG A;  4QBB A;  2DC9 A;  3KW9 A;  1BP4 A;  1CJL A;  1KFX L;  1S4V A;  4QRX A;  1PIP A;  3PNR A;  3BWK A;  1TLO A;  3LFY A;  4BQV A;  2DC8 A;  2DZZ A;  3MHH A;  3NHE A;  2XU3 A;  3K9M A;  4CDF B;  2NQI A;  4YYV A;  2AU1 A;  2G8J A;  4YYR A;  4P6E A;  4ZUX U;  2HD5 A;  2AUX A;  1CB5 A;  4X6I A;  1ME4 A;  4N4Z A;  1AYU A;  2ARY A;  2NQA A;  3D6S A;  3KWB X;  2NQG A;  1EF7 A;  3P5V A;  2IPP B;  1AEC A;  4XR7 A;  1BY8 A;  4CDC B;  2H7J A;  3PBH A;  2DC7 A;  2GHU A;  2IBI A;  1EWP A;  2OP3 A;  5EGW A;  3V6C A;  2C0Y A;  2E01 A;  2DCB A;  3WXG A;  3MOR A;  1CV8 A;  2DJG B;  4FJC A;  5J94 A;  3USV A;  3M99 A;  3TNX A;  4QH6 A;  1QDQ A;  3HD3 A;  1U9V A;  2ATO A;  2BDL A;  4W5B A;  2E03 A;  4P6G A;  1TL9 A;  3KSE A;  1PAD A;  2P0R A;  3E1Z B;  3H8C A;  1PPO A;  4YYQ A;  1GLO A;  1ATK A;  4AXM A;  1THE A;  1AYV A;  1F29 A;  3IUT A;  1FH0 A;  4CDE B;  3IV2 A;  2Y5B A;  2DCD A;  2R9C A;  6PAD A;  2FYE A;  1PBH A;  5CHV A;  4YYS A;  2F1G A;  1STF E;  1NL6 A;  1A6R A;  3DF0 A;  2HXZ A;  1GEC E;  3CBJ A;  1BGO A;  4I07 A;  1KFU L;  1DEU A;  3H6S A;  4Q8G A;  2B1M A;  1CQD A;  1MDW A;  3QJ3 A;  3WXF A;  1SP4 B;  1U5I A;  4MZO A;  2XU5 A;  2R9F A;  1QXP A;  1PPP A;  3IHP A;  2FQ9 A;  1IWD A;  2JQG R;  3O1G A;  5FPW A;  1EWM A;  1GMY A;  3N4C A;  2F7D A;  8PCH A;  4FK5 A;  4YV8 A;  2VHF A;  4BSQ A;  2DCC A;  1QMY A;  3OVZ A;  4OEL A;  1JQP A;  4X6H A;  4PP2 E;  1PPD A;  3S3R A;  2GFO A;  1CS8 A;  4HWY A;  3RVV A;  3AI8 A;  1CPJ A;  2AS8 A;  3WXE A;  1MEM A;  3H8B A;  2DC6 A;  1MHW A;  4YYW A;  5JA7 A;  5F02 A;  3BC3 A;  1YK7 A;  1K3B B;  1Y4H A;  3HHI A;  2PRE A;  5JH3 A;  1YAL A;  1KHQ A;  2FT2 A;  4AXL A;  3MTN A;  1NQC A;  4BPV A;  1MEG A;  4N8W A;  3OF8 A;  4YVA A;  1ITO A;  1SNK A;  3PW3 A;  2P7U A;  9PAP A;  1AU3 A;  2DZY A;  2PNS A;  3O0U A;  2CB5 A;  2HHN A;  3QSD A;  1Q6K A;  3BOW A;  3BCN A;  3S3Q A;  1ZIV A;  1ME3 A;  2FUD A;  5CVN B;  1CSB B;  1U9W A;  3P5X A;  4BS5 A;  4PAD A;  1NPZ A;  2AVW A;  4QRV A;  2AUZ A;  3MHS A;  1M6D A;  5PAD A;  1U9Q X;  5A24 A;  1EWO A;  1QOL A;  2VHS A;  3N3K A;  3BPF A;  3OVX A;  1ICF A;  4X6J A;  1X9Y A;  3ZUA A;  5EF4 A;  3GCB A;  4I05 A;  2YJ9 A;  5CVM A;  2JQF R;  2NQD B;  2G6D A;  5K16 A;  3F75 A;  1Y08 A;  1PPN A;  2G8E A;  2ACT A;  4W4U A;  2BDZ A;  1NLJ A;  4YYU A;  3PDF A;  2P86 A; 
#chains in the Genus database with same CATH topology
 2J7Q A;  1PE6 A;  2YJ8 A;  2DJF B;  4PI3 A;  4CZW A;  5CVO B;  1KHP A;  1XKG A;  2HWK A;  3IEJ A;  1EWL A;  4OEM A;  4P16 A;  4WA6 A;  4RY2 A;  2R9M A;  3H7D A;  4G54 A;  2WBF X;  1YK8 A;  3U8E A;  2R9N A;  1VJV A;  1VSN A;  1ZCM A;  4XUI A;  1HUC B;  3BPM A;  4MZS A;  2YJ2 A;  3I06 A;  5CHT A;  1DKI A;  4BS6 A;  2BU3 A;  3BB7 A;  3F5V A;  1KXR A;  4CDD B;  2XU4 A;  3IMA A;  3V6E A;  3K24 A;  4BOZ A;  2AYN A;  3KKU A;  3RVW A;  2UZJ A;  1AU2 A;  3QT4 A;  4N79 A;  4BOU A;  1UKF A;  4K7C A;  1F2A A;  3KFQ A;  2E02 A;  3K8U A;  3I3T A;  3IOQ A;  3RVX A;  1YT7 A;  4W5C A;  2E00 A;  5EZQ A;  1TU6 A;  1MIR A;  3KX1 A;  1AU0 A;  1F2C A;  4IP3 A;  1O0E A;  3H89 A;  2CIO A;  1U9X A;  4OVZ A;  4FIP A;  2YJC A;  2R9O A;  3CH2 X;  1CTE A;  7PCK A;  1NB5 A;  2DCA A;  4PP1 A;  2B1N A;  2AGA A;  2AIM A;  3KWZ A;  3N3G A;  1AIM A;  3B79 A;  2Y6E A;  3TRK A;  5E6J A;  3C9E A;  3ERV A;  2AYO A;  4OVZ B;  4PT5 A;  2OUL A;  3OF9 A;  4DMY A;  2HH5 A;  2FO5 A;  2FRA A;  4DMX A;  2OZ2 A;  2R6N A;  3HHA A;  4I04 A;  2PAD A;  2YJB A;  1POP A;  4MSX A;  4MI7 A;  1MS6 A;  2G7Y A;  1NB3 A;  4KLB A;  3LXS A;  3OIS A;  1PXV A;  2FRQ A;  3BY4 A;  1DF0 A;  1PCI A;  3P5U A;  1BQI A;  3CBK A;  1F2B A;  2O6X A;  4A5U A;  1AYW A;  2FTD A;  4MM3 B;  1YVB A;  2XU1 A;  2PBH A;  1AU4 A;  3HWN A;  3PHW A;  3CH3 X;  4Q8H A;  1CVZ A;  3P5W A;  1GCB A;  4QRG A;  4QBB A;  2DC9 A;  3KW9 A;  1BP4 A;  1CJL A;  1KFX L;  4RKX A;  2Z84 A;  5KO3 A;  4HXD B;  3PRP A;  4RF0 A;  1S4V A;  3C0R A;  4QRX A;  1PIP A;  3PNR A;  3LFY A;  3BWK A;  1TLO A;  4BQV A;  3MP2 A;  3MHH A;  2DC8 A;  2DZZ A;  3NHE A;  2XU3 A;  3K9M A;  4CDF B;  2NQI A;  4YYV A;  2AU1 A;  4R3D A;  2G8J A;  4YYR A;  4P6E A;  4ZUX U;  2HD5 A;  2AUX A;  1CB5 A;  4X6I A;  1ME4 A;  4N4Z A;  3D6S A;  1AYU A;  2ARY A;  2NQA A;  3KWB X;  2NQG A;  2BTW B;  1EF7 A;  2BTW A;  3P5V A;  2IPP B;  1AEC A;  4XR7 A;  1BY8 A;  4CDC B;  2H7J A;  3PBH A;  2DC7 A;  2GHU A;  2IBI A;  4GUA A;  1EWP A;  2OP3 A;  5EGW A;  3V6C A;  2C0Y A;  2E01 A;  2DCB A;  3WXG A;  3MOR A;  1CV8 A;  2DJG B;  4FJC A;  5J94 A;  3USV A;  3M99 A;  3TNX A;  4QH6 A;  1QDQ A;  3HD3 A;  4D8B A;  3W30 A;  1U9V A;  2ATO A;  2BDL A;  4W5B A;  2E03 A;  4P6G A;  1TL9 A;  3KSE A;  1PAD A;  2P0R A;  3E1Z B;  3H8C A;  3RNV A;  1PPO A;  4YYQ A;  1GLO A;  3W31 A;  3O65 A;  1ATK A;  4AXM A;  4IUM A;  1THE A;  1AYV A;  1F29 A;  3IUT A;  1FH0 A;  4CDE B;  3IV2 A;  2Y5B A;  2DCD A;  2R9C A;  6PAD A;  2FYE A;  1PBH A;  5CHV A;  4YYS A;  2F1G A;  1STF E;  1NL6 A;  1A6R A;  3PT2 A;  4BOP A;  2J7Q C;  3DF0 A;  2HXZ A;  1GEC E;  4M0W A;  3CBJ A;  1BGO A;  4I07 A;  1KFU L;  3ZNH A;  1DEU A;  3H6S A;  4Q8G A;  2B1M A;  1CQD A;  1MDW A;  4OW0 A;  3QJ3 A;  3WXF A;  1SP4 B;  1U5I A;  4MZO A;  2XU5 A;  2R9F A;  1QXP A;  1PPP A;  3IHP A;  2FQ9 A;  1IWD A;  2JQG R;  3O1G A;  5FPW A;  1EWM A;  1GMY A;  3N4C A;  2F7D A;  8PCH A;  4FK5 A;  2DOS A;  4YV8 A;  2VHF A;  2JRI A;  4BSQ A;  2DCC A;  1QMY A;  3OVZ A;  3E9S A;  4OEL A;  1JQP A;  4X6H A;  4PP2 E;  1PPD A;  4D8E A;  3S3R A;  2GFO A;  1CS8 A;  3TMP A;  4HWY A;  3RVV A;  3AI8 A;  1CPJ A;  2AS8 A;  3WXE A;  1MEM A;  3H8B A;  2DC6 A;  1MHW A;  4YYW A;  4REZ A;  1YZB A;  5JA7 A;  5F02 A;  3PRM A;  3OQC A;  4BOQ A;  3BC3 A;  1YK7 A;  1K3B B;  1Y4H A;  3HHI A;  2PRE A;  5JH3 A;  1YAL A;  3B21 A;  1KHQ A;  2FT2 A;  4WUR A;  5JZE A;  4AXL A;  3MTN A;  4RF1 A;  1NQC A;  4BOS A;  4BPV A;  1MEG A;  4N8W A;  3OF8 A;  4YVA A;  1ITO A;  1SNK A;  3PW3 A;  2P7U A;  9PAP A;  1AU3 A;  2DZY A;  2PNS A;  3O0U A;  2CB5 A;  2HHN A;  3QSD A;  1Q6K A;  1PVJ A;  3BOW A;  3BCN A;  4XZX A;  3S3Q A;  1ZIV A;  1ME3 A;  2FUD A;  2FE8 A;  3MTV A;  5CVN B;  1CSB B;  1U9W A;  3P5X A;  3BBA A;  4BS5 A;  4PAD A;  1NPZ A;  2AVW A;  3IFU A;  4QRV A;  2AUZ A;  3MHS A;  1M6D A;  5PAD A;  3PHX A;  3PSE A;  1U9Q X;  4ZTB A;  5A24 A;  3MJ5 A;  1EWO A;  1QOL A;  2VHS A;  3N3K A;  3BPF A;  3OVX A;  1ICF A;  4X6J A;  3PHU A;  1X9Y A;  3ZUA A;  5EF4 A;  3GCB A;  4I05 A;  2YJ9 A;  4RNA A;  2JTC A;  5CVM A;  4D8I A;  2JQF R;  2NQD B;  2G6D A;  5EZS A;  5K16 A;  3F75 A;  1Y08 A;  1PPN A;  2G8E A;  2ACT A;  4W4U A;  2BDZ A;  1NLJ A;  4YYU A;  3PDF A;  2P86 A; 
#chains in the Genus database with same CATH homology
 1PE6 A;  2YJ8 A;  2DJF B;  4PI3 A;  4CZW A;  5CVO B;  1KHP A;  1XKG A;  3IEJ A;  1EWL A;  4WA6 A;  4OEM A;  4RY2 A;  2R9M A;  3H7D A;  4G54 A;  2WBF X;  1YK8 A;  3U8E A;  2R9N A;  1VJV A;  1VSN A;  1ZCM A;  4XUI A;  1HUC B;  3BPM A;  4MZS A;  2YJ2 A;  3I06 A;  5CHT A;  4BS6 A;  3F5V A;  1KXR A;  4CDD B;  2XU4 A;  3IMA A;  3V6E A;  3K24 A;  2AYN A;  3KKU A;  3RVW A;  1AU2 A;  3QT4 A;  4N79 A;  4K7C A;  4B55 A;  1F2A A;  3KFQ A;  2E02 A;  3K8U A;  3I3T A;  3IOQ A;  3RVX A;  1YT7 A;  4W5C A;  2E00 A;  1TU6 A;  1MIR A;  3KX1 A;  1AU0 A;  1F2C A;  1O0E A;  3H89 A;  2CIO A;  1U9X A;  4FIP A;  4GUZ A;  2YJC A;  2R9O A;  3CH2 X;  1CTE A;  7PCK A;  1NB5 A;  2DCA A;  4PP1 A;  2B1N A;  2AIM A;  3KWZ A;  3N3G A;  1AIM A;  3B79 A;  2Y6E A;  3C9E A;  3ERV A;  2AYO A;  4NV7 A;  2OUL A;  3OF9 A;  4DMY A;  2HH5 A;  2FO5 A;  2FRA A;  4DMX A;  2OZ2 A;  2R6N A;  3HHA A;  4I04 A;  2PAD A;  2YJB A;  1POP A;  4MSX A;  1MS6 A;  2G7Y A;  1NB3 A;  4KLB A;  3LXS A;  3OIS A;  1PXV A;  2FRQ A;  1DF0 A;  1PCI A;  3P5U A;  1BQI A;  3CBK A;  1F2B A;  2O6X A;  1AYW A;  2FTD A;  1YVB A;  2XU1 A;  2PBH A;  1AU4 A;  3HWN A;  3CH3 X;  4Q8H A;  1CVZ A;  2VFC A;  3P5W A;  1GCB A;  4QRG A;  4QBB A;  2DC9 A;  3KW9 A;  1BP4 A;  1CJL A;  1KFX L;  1S4V A;  4QRX A;  1PIP A;  3PNR A;  3BWK A;  1TLO A;  3LFY A;  4BQV A;  2DC8 A;  2DZZ A;  3MHH A;  3NHE A;  2XU3 A;  3K9M A;  4CDF B;  2NQI A;  4YYV A;  2AU1 A;  1W5R A;  2G8J A;  4YYR A;  4P6E A;  4ZUX U;  2HD5 A;  2AUX A;  1CB5 A;  4X6I A;  1ME4 A;  4N4Z A;  1AYU A;  2ARY A;  2NQA A;  3D6S A;  3KWB X;  2NQG A;  1EF7 A;  3P5V A;  2IPP B;  1AEC A;  4XR7 A;  1BY8 A;  4CDC B;  2H7J A;  3PBH A;  2DC7 A;  2GHU A;  2IBI A;  1EWP A;  2OP3 A;  5EGW A;  3V6C A;  2C0Y A;  2E01 A;  2DCB A;  3WXG A;  3MOR A;  1CV8 A;  2DJG B;  4FJC A;  5J94 A;  3USV A;  1GX3 A;  3M99 A;  3TNX A;  4QH6 A;  1QDQ A;  3HD3 A;  1U9V A;  2ATO A;  2BDL A;  4W5B A;  2E03 A;  4P6G A;  1TL9 A;  3KSE A;  1PAD A;  2P0R A;  3E1Z B;  3H8C A;  1PPO A;  4YYQ A;  1GLO A;  1ATK A;  4AXM A;  1THE A;  1AYV A;  1F29 A;  3IUT A;  1FH0 A;  4CDE B;  4C5P A;  3IV2 A;  2Y5B A;  2DCD A;  2R9C A;  6PAD A;  2FYE A;  1PBH A;  5CHV A;  4YYS A;  2F1G A;  1STF E;  1NL6 A;  1A6R A;  3DF0 A;  2HXZ A;  1GEC E;  3CBJ A;  1BGO A;  4I07 A;  1KFU L;  1DEU A;  3H6S A;  4Q8G A;  2B1M A;  1CQD A;  1MDW A;  3QJ3 A;  3WXF A;  1SP4 B;  1U5I A;  4MZO A;  2XU5 A;  2R9F A;  1QXP A;  1PPP A;  3IHP A;  2FQ9 A;  1IWD A;  2JQG R;  3O1G A;  5FPW A;  1EWM A;  1GMY A;  3N4C A;  2F7D A;  8PCH A;  4FK5 A;  4BGF A;  4YV8 A;  2VHF A;  4BSQ A;  2DCC A;  1QMY A;  3OVZ A;  4OEL A;  1JQP A;  4X6H A;  4PP2 E;  1PPD A;  3S3R A;  2GFO A;  1CS8 A;  4HWY A;  3RVV A;  3AI8 A;  2VFB A;  1CPJ A;  2AS8 A;  3WXE A;  1MEM A;  3H8B A;  2DC6 A;  1MHW A;  4YYW A;  5JA7 A;  5F02 A;  3BC3 A;  1YK7 A;  1K3B B;  1Y4H A;  3HHI A;  2PRE A;  5JH3 A;  2BSZ A;  1YAL A;  1KHQ A;  2FT2 A;  1E2T A;  4AXL A;  3MTN A;  1NQC A;  4BPV A;  1MEG A;  4N8W A;  3OF8 A;  4YVA A;  1ITO A;  1SNK A;  3PW3 A;  2P7U A;  9PAP A;  1AU3 A;  1W6F A;  2DZY A;  2PNS A;  3O0U A;  2CB5 A;  2HHN A;  3QSD A;  1Q6K A;  3BOW A;  3BCN A;  4NV8 A;  3S3Q A;  1ZIV A;  1ME3 A;  2FUD A;  5CVN B;  3D9W A;  1CSB B;  1U9W A;  3P5X A;  4BS5 A;  4PAD A;  1NPZ A;  2AVW A;  4QRV A;  2AUZ A;  3MHS A;  1M6D A;  5PAD A;  1U9Q X;  5A24 A;  1EWO A;  1QOL A;  2VHS A;  1W4T A;  3N3K A;  3BPF A;  3OVX A;  1ICF A;  4X6J A;  1X9Y A;  3ZUA A;  5EF4 A;  3GCB A;  4I05 A;  2YJ9 A;  5CVM A;  2JQF R;  2NQD B;  2G6D A;  5K16 A;  3F75 A;  1Y08 A;  1PPN A;  2G8E A;  2ACT A;  4W4U A;  3LTW A;  2BDZ A;  1NLJ A;  4YYU A;  3PDF A;  2P86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...