1KHQA

Orthorhombic form of papain/zlfg-dam covalent complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
publication title Two polymorphs of a covalent complex between papain and a diazomethylketone inhibitor
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 73
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1khqA00
3V6CA 3U8EA 2HHNA 1BP4A 2Y6EA 3P5VA 1BGOA 3MHHA 2DJGB 5EGWA 1F2AA 2GHUA 2OZ2A 5EF4A 4CDCB 2G8EA 2C0YA 1GLOA 1PPNA 1GMYA 2YJCA 1X9YA 4YYWA 3IUTA 4N4ZA 2HH5A 2Y5BA 4DMXA 2WBFX 1CTEA 3K9MA 2AU1A 1CPJA 4OELA 2DCCA 4WA6A 2ACTA 1MEGA 4HWYA 1FH0A 2CIOA 3RVVA 2PNSA 2OP3A 2DZZA 4RY2A 1JQPA 1YK7A 1K3BB 2NQAA 2NQIA 1TL9A 1STFE 1TU6A 3F75A 1ZCMA 2YJBA 3BPFA 4BQVA 5K16A 2FRAA 2DZYA 2G7YA 1AECA 3C9EA 1DF0A 4I04A 1U9QX 1NLJA 4QBBA 4Q8GA 1CQDA 1U9VA 2DC7A 5JH3A 3OISA 3H8BA 1NQCA 2DC8A 1AU2A 1PIPA 3KWBX 3ERVA 2DCDA 2AYOA 2XU4A 2O6XA 1PXVA 3H6SA 3P5UA 4DMYA 1AU0A 1EWLA 2IBIA 2B1MA 4PI3A 3IHPA 4X6HA 1VJVA 1NB3A 5CVMA 3QJ3A 2JQGR 4YV8A 3CH3X 3KSEA 2DCAA 2HXZA 1GCBA 1A6RA 3LFYA 4PP1A 4ZUXU 4K7CA 1QMYA 3MHSA 1U9XA 2FUDA 2AIMA 3O1GA 3AI8A 1NB5A 4CDFB 3HWNA 3MTNA 3BCNA 3N3GA 1YT7A 4XR7A 1CVZA 1ITOA 3O0UA 4N79A 5CHTA 1PPPA 3OF9A 3P5WA 3RVXA 2PREA 3HHIA 5A24A 1BQIA 3NHEA 4I07A 2YJ9A 4CDEB 2R9NA 2AYNA 2FO5A 2PBHA 4YVAA 2YJ2A 4QRVA 1ICFA 7PCKA 1EF7A 2ARYA 3D6SA 2ATOA 2E03A 1AYWA 4MZSA 6PADA 1Q6KA 1MIRA 4W4UA 2CB5A 2E02A 1CV8A 3BC3A 4I05A 2DC9A 1EWOA 1QXPA 2DJFB 3WXFA 1KFXL 1THEA 1YALA 4MZOA 3F5VA 3BOWA 3RVWA 1ATKA 1ME3A 4AXMA 2AUZA 4MSXA 1PBHA 2NQGA 3GCBA 1BY8A 4X6JA 4XUIA 3M99A 2VHFA 3H7DA 1VSNA 3I06A 4QRGA 1AU4A 1KHQA 2XU3A 5J94A 4YYQA 4BSQA 1O0EA 3P5XA 4G54A 1QDQA 1M6DA 1F2BA 3KW9A 3H89A 1AIMA 3ZUAA 1ME4A 4W5BA 3B79A 3PNRA 2JQFR 2R9CA 1EWPA 2OULA 1NL6A 1KHPA 1PPDA 1Y08A 3S3QA 3OF8A 2BDLA 1KFUL 4P6EA 4QH6A 1MEMA 3IV2A 2XU1A 2P0RA 4OEMA 3HD3A 2FT2A 2F1GA 4Q8HA 1CS8A 3QT4A 2IPPB 3S3RA 3K24A 3V6EA 4BS6A 3IMAA 3I3TA 4N8WA 5CVOB 1S4VA 2F7DA 1EWMA 3CBKA 1IWDA 3OVZA 4YYSA 5F02A 3BPMA 1CB5A 2XU5A 1MS6A 4BS5A 1U9WA 3N4CA 2VHSA 4PP2E 4YYRA 2AVWA 4CDDB 3KFQA 2FRQA 3PBHA 1AU3A 2FYEA 2GFOA 1PPOA 2HD5A 4CZWA 1Y4HA 3IOQA 2AUXA 3DF0A 3MORA 4QRXA 3PDFA 4W5CA 9PAPA 1QOLA 3KX1A 1CJLA 1NPZA 1DEUA 1KXRA 2AS8A 3N3KA 3OVXA 5CHVA 2G6DA 4YYUA 1F2CA 1XKGA 4KLBA 2P86A 4BPVA 3WXEA 3QSDA 2B1NA 2R9OA 2E01A 1PADA 5PADA 5JA7A 1YK8A 1AYUA 2G8JA 3USVA 1HUCB 1TLOA 4AXLA 1MHWA 1SNKA 2DCBA 2FQ9A 4FIPA 3K8UA 2P7UA 3CBJA 1AYVA 3TNXA 2R9FA 3BWKA 3PW3A 1PCIA 5FPWA 3H8CA 1YVBA 3IEJA 3CH2X 1SP4B 4YYVA 1GECE 1POPA 2FTDA 1PE6A 2H7JA 3KKUA 1CSBB 3E1ZB 8PCHA 4FK5A 3LXSA 1MDWA 5CVNB 2DC6A 3WXGA 2PADA 1ZIVA 3KWZA 1F29A 2BDZA 2E00A 2NQDB 3HHAA 4X6IA 4FJCA 1U5IA 2R9MA 4PADA 4P6GA 2YJ8A 2R6NA
chains in the Genus database with same CATH superfamily
3V6CA 3U8EA 2HHNA 1BP4A 2Y6EA 3P5VA 1BGOA 3MHHA 2DJGB 2JRIA 2AGAA 5EGWA 1F2AA 4BOZA 2GHUA 2OZ2A 5EF4A 4CDCB 4MI7A 2G8EA 2C0YA 1UKFA 1GLOA 1PPNA 1GMYA 2YJCA 1X9YA 1YZBA 4YYWA 3IUTA 4N4ZA 2HH5A 2Y5BA 4DMXA 2WBFX 1CTEA 3K9MA 2AU1A 1CPJA 4GUAA 4OELA 2DCCA 4BOSA 4WA6A 2ACTA 1MEGA 4HWYA 1FH0A 2CIOA 4D8BA 3RVVA 2PNSA 5EZQA 2OP3A 2DZZA 4RY2A 1JQPA 1YK7A 1K3BB 3W30A 2NQAA 2NQIA 1TL9A 1STFE 1TU6A 3F75A 3MTVA 1ZCMA 2YJBA 3BPFA 4BQVA 5K16A 2FRAA 2DZYA 2G7YA 4RF1A 1AECA 3C9EA 1DF0A 4I04A 3BB7A 1U9QX 1NLJA 4QBBA 4Q8GA 1CQDA 1U9VA 2DC7A 5JH3A 3OISA 3H8BA 1NQCA 2DC8A 4D8EA 1AU2A 1PIPA 3KWBX 3ERVA 2DCDA 2AYOA 2XU4A 2BU3A 2O6XA 1PXVA 2JTCA 3H6SA 3P5UA 4DMYA 1AU0A 1EWLA 2BTWB 2J7QC 2IBIA 2B1MA 4PI3A 3IHPA 4X6HA 1VJVA 1NB3A 5CVMA 3QJ3A 2JQGR 4YV8A 3CH3X 3KSEA 2DCAA 4M0WA 2HXZA 2Z84A 1GCBA 1A6RA 3C0RA 3LFYA 4PP1A 4ZUXU 4K7CA 1QMYA 2BTWA 3MHSA 1U9XA 2FUDA 3MJ5A 2AIMA 3O1GA 3AI8A 1NB5A 4CDFB 3HWNA 3MTNA 3BCNA 3N3GA 1YT7A 3B21A 4XR7A 1CVZA 1ITOA 3O0UA 4N79A 5CHTA 1PPPA 3OF9A 3P5WA 3RVXA 2PREA 3HHIA 5A24A 1BQIA 3NHEA 4I07A 4HXDB 2YJ9A 4CDEB 2R9NA 2AYNA 2FO5A 2PBHA 4YVAA 2YJ2A 4QRVA 1ICFA 7PCKA 1EF7A 2ARYA 3D6SA 2ATOA 2E03A 3PHXA 1AYWA 4MZSA 3ZNHA 6PADA 3PRMA 1Q6KA 1MIRA 4W4UA 2CB5A 2E02A 1CV8A 2DOSA 3BC3A 4I05A 2DC9A 1EWOA 4PT5A 1QXPA 2DJFB 3WXFA 1KFXL 1THEA 1YALA 4MZOA 3F5VA 3TMPA 3BOWA 3RVWA 1ATKA 1ME3A 4AXMA 2AUZA 4OVZB 4MSXA 1PBHA 2NQGA 3GCBA 1BY8A 4X6JA 4XUIA 3M99A 2VHFA 4R3DA 3W31A 3E9SA 3H7DA 1VSNA 3I06A 4QRGA 1AU4A 1KHQA 2XU3A 3OQCA 5J94A 4YYQA 4BSQA 1O0EA 4ZTBA 3P5XA 4G54A 1QDQA 1M6DA 1F2BA 3KW9A 3H89A 1AIMA 3MP2A 3ZUAA 1ME4A 4W5BA 3BY4A 3IFUA 3B79A 3PNRA 2JQFR 2R9CA 1EWPA 2OULA 1NL6A 1KHPA 1PPDA 1Y08A 3S3QA 3OF8A 2BDLA 1KFUL 4OW0A 4P6EA 4QH6A 1MEMA 3IV2A 2XU1A 2HWKA 2P0RA 4OEMA 3HD3A 4BOQA 2FT2A 4BOUA 2F1GA 4Q8HA 1CS8A 3QT4A 2IPPB 3S3RA 3K24A 3V6EA 4BS6A 3IMAA 3I3TA 4N8WA 5CVOB 1S4VA 2F7DA 1EWMA 3CBKA 1IWDA 3OVZA 4YYSA 4WURA 5F02A 3BPMA 1CB5A 2XU5A 1MS6A 4XZXA 4BS5A 1U9WA 3N4CA 2VHSA 4PP2E 4YYRA 2AVWA 4CDDB 3KFQA 2FRQA 3PBHA 1AU3A 2FYEA 4BOPA 2GFOA 1PPOA 2HD5A 4CZWA 1Y4HA 3IOQA 2AUXA 3DF0A 3MORA 3PHWA 4QRXA 3PDFA 4W5CA 2UZJA 2FE8A 2J7QA 3PHUA 9PAPA 1QOLA 3KX1A 1CJLA 1NPZA 3PSEA 4IP3A 1DEUA 1KXRA 2AS8A 3N3KA 3OVXA 4RF0A 5CHVA 5KO3A 2G6DA 4YYUA 1F2CA 3O65A 1XKGA 4KLBA 2P86A 1PVJA 4BPVA 3WXEA 3QSDA 2B1NA 3TRKA 2R9OA 2E01A 1PADA 5PADA 5EZSA 5JA7A 1YK8A 1AYUA 2G8JA 3USVA 5E6JA 4RKXA 1HUCB 1TLOA 4OVZA 4AXLA 1MHWA 1SNKA 2DCBA 2FQ9A 4FIPA 3K8UA 1DKIA 2P7UA 3CBJA 1AYVA 3TNXA 2R9FA 3BWKA 3PW3A 1PCIA 5FPWA 3H8CA 1YVBA 4MM3B 4D8IA 4IUMA 3IEJA 3PRPA 3CH2X 1SP4B 4YYVA 1GECE 1POPA 2FTDA 1PE6A 2H7JA 3KKUA 1CSBB 3E1ZB 4RNAA 8PCHA 3RNVA 4FK5A 3LXSA 1MDWA 5CVNB 2DC6A 3PT2A 5JZEA 3WXGA 2PADA 1ZIVA 4REZA 3BBAA 4A5UA 3KWZA 1F29A 2BDZA 2E00A 2NQDB 3HHAA 4X6IA 4FJCA 1U5IA 4P16A 2R9MA 4PADA 4P6GA 2YJ8A 2R6NA
chains in the Genus database with same CATH topology
3V6CA 3U8EA 2HHNA 1BP4A 2Y6EA 3P5VA 1BGOA 3MHHA 2DJGB 5EGWA 1F2AA 2GHUA 2OZ2A 5EF4A 4CDCB 2G8EA 2C0YA 1GLOA 1PPNA 1GMYA 2YJCA 1X9YA 4YYWA 3IUTA 4N4ZA 2HH5A 2Y5BA 4DMXA 2WBFX 1CTEA 3K9MA 2AU1A 1CPJA 1W6FA 4OELA 2DCCA 4WA6A 2ACTA 1MEGA 4HWYA 1FH0A 2CIOA 3RVVA 2PNSA 2OP3A 2DZZA 4RY2A 1JQPA 1YK7A 1K3BB 2NQAA 2NQIA 1TL9A 1STFE 1TU6A 3F75A 1ZCMA 2YJBA 3BPFA 4BQVA 5K16A 2FRAA 2DZYA 3LTWA 2VFCA 2G7YA 1AECA 3C9EA 1DF0A 4I04A 1U9QX 1NLJA 4QBBA 4Q8GA 1CQDA 1U9VA 2DC7A 5JH3A 3OISA 3H8BA 1NQCA 2DC8A 1AU2A 1PIPA 3KWBX 1E2TA 3ERVA 2DCDA 2AYOA 2XU4A 2O6XA 1PXVA 3H6SA 3P5UA 4DMYA 1AU0A 1EWLA 2IBIA 2B1MA 4PI3A 3IHPA 4X6HA 1VJVA 1NB3A 5CVMA 3QJ3A 2JQGR 4YV8A 3CH3X 3KSEA 2DCAA 2HXZA 1GCBA 1A6RA 3LFYA 4PP1A 4ZUXU 4K7CA 1QMYA 3MHSA 1U9XA 2FUDA 2AIMA 3O1GA 3AI8A 1NB5A 4CDFB 3HWNA 3MTNA 3BCNA 3N3GA 1YT7A 4XR7A 1CVZA 1ITOA 3O0UA 4N79A 5CHTA 1PPPA 3OF9A 3P5WA 3RVXA 2PREA 3HHIA 5A24A 1BQIA 3NHEA 4I07A 2YJ9A 4CDEB 2R9NA 2AYNA 2FO5A 2PBHA 4YVAA 2YJ2A 4QRVA 1ICFA 7PCKA 1EF7A 2ARYA 3D6SA 2ATOA 2E03A 1AYWA 4MZSA 6PADA 1Q6KA 1MIRA 4W4UA 2CB5A 2E02A 1CV8A 3BC3A 4I05A 2DC9A 1EWOA 1QXPA 2DJFB 3WXFA 1KFXL 1THEA 2BSZA 1YALA 4MZOA 3F5VA 4BGFA 3BOWA 3RVWA 1ATKA 1ME3A 4AXMA 2AUZA 4MSXA 1PBHA 2NQGA 3GCBA 1BY8A 4X6JA 4XUIA 3M99A 2VHFA 3H7DA 1VSNA 3I06A 4QRGA 1AU4A 1KHQA 2XU3A 5J94A 4YYQA 4BSQA 1O0EA 3P5XA 4G54A 1QDQA 1M6DA 1F2BA 3KW9A 4GUZA 3H89A 1AIMA 3ZUAA 1ME4A 4W5BA 3B79A 3PNRA 2JQFR 2R9CA 1EWPA 2OULA 1NL6A 1KHPA 1PPDA 1Y08A 3S3QA 3OF8A 2BDLA 1KFUL 4P6EA 4QH6A 1MEMA 3IV2A 2XU1A 2P0RA 4OEMA 3HD3A 2FT2A 1W5RA 2F1GA 4Q8HA 4C5PA 1CS8A 3QT4A 2IPPB 3S3RA 3K24A 3V6EA 4BS6A 3IMAA 3I3TA 4N8WA 5CVOB 1S4VA 2F7DA 1EWMA 3CBKA 1IWDA 3OVZA 4YYSA 5F02A 3BPMA 1CB5A 2XU5A 1MS6A 4BS5A 1U9WA 3N4CA 2VHSA 4PP2E 4YYRA 2AVWA 4CDDB 1W4TA 3KFQA 2FRQA 3PBHA 1AU3A 2FYEA 2GFOA 1PPOA 4NV8A 2HD5A 4CZWA 1Y4HA 3IOQA 2AUXA 3DF0A 3MORA 4QRXA 3PDFA 4W5CA 9PAPA 1QOLA 3KX1A 1CJLA 1NPZA 4NV7A 1DEUA 1KXRA 2AS8A 3D9WA 3N3KA 3OVXA 5CHVA 2G6DA 4YYUA 1F2CA 1XKGA 4KLBA 2P86A 4BPVA 3WXEA 3QSDA 2B1NA 2R9OA 2E01A 1PADA 5PADA 4B55A 5JA7A 1YK8A 1AYUA 2G8JA 3USVA 1HUCB 1TLOA 4AXLA 1MHWA 1SNKA 2DCBA 2FQ9A 4FIPA 3K8UA 2P7UA 3CBJA 1AYVA 3TNXA 2R9FA 3BWKA 3PW3A 1PCIA 5FPWA 3H8CA 1YVBA 3IEJA 3CH2X 1SP4B 4YYVA 1GECE 1POPA 2FTDA 1PE6A 2H7JA 3KKUA 1CSBB 3E1ZB 8PCHA 4FK5A 3LXSA 1MDWA 5CVNB 2DC6A 3WXGA 2PADA 1ZIVA 3KWZA 2VFBA 1F29A 2BDZA 2E00A 2NQDB 3HHAA 4X6IA 4FJCA 1GX3A 1U5IA 2R9MA 4PADA 4P6GA 2YJ8A 2R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6C A;  3U8E A;  2HHN A;  1BP4 A;  2Y6E A;  3P5V A;  1BGO A;  3MHH A;  2DJG B;  5EGW A;  1F2A A;  2GHU A;  2OZ2 A;  5EF4 A;  4CDC B;  2G8E A;  2C0Y A;  1GLO A;  1PPN A;  1GMY A;  2YJC A;  1X9Y A;  4YYW A;  3IUT A;  4N4Z A;  2HH5 A;  2Y5B A;  4DMX A;  2WBF X;  1CTE A;  3K9M A;  2AU1 A;  1CPJ A;  4OEL A;  2DCC A;  4WA6 A;  2ACT A;  1MEG A;  4HWY A;  1FH0 A;  2CIO A;  3RVV A;  2PNS A;  2OP3 A;  2DZZ A;  4RY2 A;  1JQP A;  1YK7 A;  1K3B B;  2NQA A;  2NQI A;  1TL9 A;  1STF E;  1TU6 A;  3F75 A;  1ZCM A;  2YJB A;  3BPF A;  4BQV A;  5K16 A;  2FRA A;  2DZY A;  2G7Y A;  1AEC A;  3C9E A;  1DF0 A;  4I04 A;  1U9Q X;  1NLJ A;  4QBB A;  4Q8G A;  1CQD A;  1U9V A;  2DC7 A;  5JH3 A;  3OIS A;  3H8B A;  1NQC A;  2DC8 A;  1AU2 A;  1PIP A;  3KWB X;  3ERV A;  2DCD A;  2AYO A;  2XU4 A;  2O6X A;  1PXV A;  3H6S A;  3P5U A;  4DMY A;  1AU0 A;  1EWL A;  2IBI A;  2B1M A;  4PI3 A;  3IHP A;  4X6H A;  1VJV A;  1NB3 A;  5CVM A;  3QJ3 A;  2JQG R;  4YV8 A;  3CH3 X;  3KSE A;  2DCA A;  2HXZ A;  1GCB A;  1A6R A;  3LFY A;  4PP1 A;  4ZUX U;  4K7C A;  1QMY A;  3MHS A;  1U9X A;  2FUD A;  2AIM A;  3O1G A;  3AI8 A;  1NB5 A;  4CDF B;  3HWN A;  3MTN A;  3BCN A;  3N3G A;  1YT7 A;  4XR7 A;  1CVZ A;  1ITO A;  3O0U A;  4N79 A;  5CHT A;  1PPP A;  3OF9 A;  3P5W A;  3RVX A;  2PRE A;  3HHI A;  5A24 A;  1BQI A;  3NHE A;  4I07 A;  2YJ9 A;  4CDE B;  2R9N A;  2AYN A;  2FO5 A;  2PBH A;  4YVA A;  2YJ2 A;  4QRV A;  1ICF A;  7PCK A;  1EF7 A;  2ARY A;  3D6S A;  2ATO A;  2E03 A;  1AYW A;  4MZS A;  6PAD A;  1Q6K A;  1MIR A;  4W4U A;  2CB5 A;  2E02 A;  1CV8 A;  3BC3 A;  4I05 A;  2DC9 A;  1EWO A;  1QXP A;  2DJF B;  3WXF A;  1KFX L;  1THE A;  1YAL A;  4MZO A;  3F5V A;  3BOW A;  3RVW A;  1ATK A;  1ME3 A;  4AXM A;  2AUZ A;  4MSX A;  1PBH A;  2NQG A;  3GCB A;  1BY8 A;  4X6J A;  4XUI A;  3M99 A;  2VHF A;  3H7D A;  1VSN A;  3I06 A;  4QRG A;  1AU4 A;  1KHQ A;  2XU3 A;  5J94 A;  4YYQ A;  4BSQ A;  1O0E A;  3P5X A;  4G54 A;  1QDQ A;  1M6D A;  1F2B A;  3KW9 A;  3H89 A;  1AIM A;  3ZUA A;  1ME4 A;  4W5B A;  3B79 A;  3PNR A;  2JQF R;  2R9C A;  1EWP A;  2OUL A;  1NL6 A;  1KHP A;  1PPD A;  1Y08 A;  3S3Q A;  3OF8 A;  2BDL A;  1KFU L;  4P6E A;  4QH6 A;  1MEM A;  3IV2 A;  2XU1 A;  2P0R A;  4OEM A;  3HD3 A;  2FT2 A;  2F1G A;  4Q8H A;  1CS8 A;  3QT4 A;  2IPP B;  3S3R A;  3K24 A;  3V6E A;  4BS6 A;  3IMA A;  3I3T A;  4N8W A;  5CVO B;  1S4V A;  2F7D A;  1EWM A;  3CBK A;  1IWD A;  3OVZ A;  4YYS A;  5F02 A;  3BPM A;  1CB5 A;  2XU5 A;  1MS6 A;  4BS5 A;  1U9W A;  3N4C A;  2VHS A;  4PP2 E;  4YYR A;  2AVW A;  4CDD B;  3KFQ A;  2FRQ A;  3PBH A;  1AU3 A;  2FYE A;  2GFO A;  1PPO A;  2HD5 A;  4CZW A;  1Y4H A;  3IOQ A;  2AUX A;  3DF0 A;  3MOR A;  4QRX A;  3PDF A;  4W5C A;  9PAP A;  1QOL A;  3KX1 A;  1CJL A;  1NPZ A;  1DEU A;  1KXR A;  2AS8 A;  3N3K A;  3OVX A;  5CHV A;  2G6D A;  4YYU A;  1F2C A;  1XKG A;  4KLB A;  2P86 A;  4BPV A;  3WXE A;  3QSD A;  2B1N A;  2R9O A;  2E01 A;  1PAD A;  5PAD A;  5JA7 A;  1YK8 A;  1AYU A;  2G8J A;  3USV A;  1HUC B;  1TLO A;  4AXL A;  1MHW A;  1SNK A;  2DCB A;  2FQ9 A;  4FIP A;  3K8U A;  2P7U A;  3CBJ A;  1AYV A;  3TNX A;  2R9F A;  3BWK A;  3PW3 A;  1PCI A;  5FPW A;  3H8C A;  1YVB A;  3IEJ A;  3CH2 X;  1SP4 B;  4YYV A;  1GEC E;  1POP A;  2FTD A;  1PE6 A;  2H7J A;  3KKU A;  1CSB B;  3E1Z B;  8PCH A;  4FK5 A;  3LXS A;  1MDW A;  5CVN B;  2DC6 A;  3WXG A;  2PAD A;  1ZIV A;  3KWZ A;  1F29 A;  2BDZ A;  2E00 A;  2NQD B;  3HHA A;  4X6I A;  4FJC A;  1U5I A;  2R9M A;  4PAD A;  4P6G A;  2YJ8 A;  2R6N A; 
#chains in the Genus database with same CATH topology
 3V6C A;  3U8E A;  2HHN A;  1BP4 A;  2Y6E A;  3P5V A;  1BGO A;  3MHH A;  2DJG B;  2JRI A;  2AGA A;  5EGW A;  1F2A A;  4BOZ A;  2GHU A;  2OZ2 A;  5EF4 A;  4CDC B;  4MI7 A;  2G8E A;  2C0Y A;  1UKF A;  1GLO A;  1PPN A;  1GMY A;  2YJC A;  1X9Y A;  1YZB A;  4YYW A;  3IUT A;  4N4Z A;  2HH5 A;  2Y5B A;  4DMX A;  2WBF X;  1CTE A;  3K9M A;  2AU1 A;  1CPJ A;  4GUA A;  4OEL A;  2DCC A;  4BOS A;  4WA6 A;  2ACT A;  1MEG A;  4HWY A;  1FH0 A;  2CIO A;  4D8B A;  3RVV A;  2PNS A;  5EZQ A;  2OP3 A;  2DZZ A;  4RY2 A;  1JQP A;  1YK7 A;  1K3B B;  3W30 A;  2NQA A;  2NQI A;  1TL9 A;  1STF E;  1TU6 A;  3F75 A;  3MTV A;  1ZCM A;  2YJB A;  3BPF A;  4BQV A;  5K16 A;  2FRA A;  2DZY A;  2G7Y A;  4RF1 A;  1AEC A;  3C9E A;  1DF0 A;  4I04 A;  3BB7 A;  1U9Q X;  1NLJ A;  4QBB A;  4Q8G A;  1CQD A;  1U9V A;  2DC7 A;  5JH3 A;  3OIS A;  3H8B A;  1NQC A;  2DC8 A;  4D8E A;  1AU2 A;  1PIP A;  3KWB X;  3ERV A;  2DCD A;  2AYO A;  2XU4 A;  2BU3 A;  2O6X A;  1PXV A;  2JTC A;  3H6S A;  3P5U A;  4DMY A;  1AU0 A;  1EWL A;  2BTW B;  2J7Q C;  2IBI A;  2B1M A;  4PI3 A;  3IHP A;  4X6H A;  1VJV A;  1NB3 A;  5CVM A;  3QJ3 A;  2JQG R;  4YV8 A;  3CH3 X;  3KSE A;  2DCA A;  4M0W A;  2HXZ A;  2Z84 A;  1GCB A;  1A6R A;  3C0R A;  3LFY A;  4PP1 A;  4ZUX U;  4K7C A;  1QMY A;  2BTW A;  3MHS A;  1U9X A;  2FUD A;  3MJ5 A;  2AIM A;  3O1G A;  3AI8 A;  1NB5 A;  4CDF B;  3HWN A;  3MTN A;  3BCN A;  3N3G A;  1YT7 A;  3B21 A;  4XR7 A;  1CVZ A;  1ITO A;  3O0U A;  4N79 A;  5CHT A;  1PPP A;  3OF9 A;  3P5W A;  3RVX A;  2PRE A;  3HHI A;  5A24 A;  1BQI A;  3NHE A;  4I07 A;  4HXD B;  2YJ9 A;  4CDE B;  2R9N A;  2AYN A;  2FO5 A;  2PBH A;  4YVA A;  2YJ2 A;  4QRV A;  1ICF A;  7PCK A;  1EF7 A;  2ARY A;  3D6S A;  2ATO A;  2E03 A;  3PHX A;  1AYW A;  4MZS A;  3ZNH A;  6PAD A;  3PRM A;  1Q6K A;  1MIR A;  4W4U A;  2CB5 A;  2E02 A;  1CV8 A;  2DOS A;  3BC3 A;  4I05 A;  2DC9 A;  1EWO A;  4PT5 A;  1QXP A;  2DJF B;  3WXF A;  1KFX L;  1THE A;  1YAL A;  4MZO A;  3F5V A;  3TMP A;  3BOW A;  3RVW A;  1ATK A;  1ME3 A;  4AXM A;  2AUZ A;  4OVZ B;  4MSX A;  1PBH A;  2NQG A;  3GCB A;  1BY8 A;  4X6J A;  4XUI A;  3M99 A;  2VHF A;  4R3D A;  3W31 A;  3E9S A;  3H7D A;  1VSN A;  3I06 A;  4QRG A;  1AU4 A;  1KHQ A;  2XU3 A;  3OQC A;  5J94 A;  4YYQ A;  4BSQ A;  1O0E A;  4ZTB A;  3P5X A;  4G54 A;  1QDQ A;  1M6D A;  1F2B A;  3KW9 A;  3H89 A;  1AIM A;  3MP2 A;  3ZUA A;  1ME4 A;  4W5B A;  3BY4 A;  3IFU A;  3B79 A;  3PNR A;  2JQF R;  2R9C A;  1EWP A;  2OUL A;  1NL6 A;  1KHP A;  1PPD A;  1Y08 A;  3S3Q A;  3OF8 A;  2BDL A;  1KFU L;  4OW0 A;  4P6E A;  4QH6 A;  1MEM A;  3IV2 A;  2XU1 A;  2HWK A;  2P0R A;  4OEM A;  3HD3 A;  4BOQ A;  2FT2 A;  4BOU A;  2F1G A;  4Q8H A;  1CS8 A;  3QT4 A;  2IPP B;  3S3R A;  3K24 A;  3V6E A;  4BS6 A;  3IMA A;  3I3T A;  4N8W A;  5CVO B;  1S4V A;  2F7D A;  1EWM A;  3CBK A;  1IWD A;  3OVZ A;  4YYS A;  4WUR A;  5F02 A;  3BPM A;  1CB5 A;  2XU5 A;  1MS6 A;  4XZX A;  4BS5 A;  1U9W A;  3N4C A;  2VHS A;  4PP2 E;  4YYR A;  2AVW A;  4CDD B;  3KFQ A;  2FRQ A;  3PBH A;  1AU3 A;  2FYE A;  4BOP A;  2GFO A;  1PPO A;  2HD5 A;  4CZW A;  1Y4H A;  3IOQ A;  2AUX A;  3DF0 A;  3MOR A;  3PHW A;  4QRX A;  3PDF A;  4W5C A;  2UZJ A;  2FE8 A;  2J7Q A;  3PHU A;  9PAP A;  1QOL A;  3KX1 A;  1CJL A;  1NPZ A;  3PSE A;  4IP3 A;  1DEU A;  1KXR A;  2AS8 A;  3N3K A;  3OVX A;  4RF0 A;  5CHV A;  5KO3 A;  2G6D A;  4YYU A;  1F2C A;  3O65 A;  1XKG A;  4KLB A;  2P86 A;  1PVJ A;  4BPV A;  3WXE A;  3QSD A;  2B1N A;  3TRK A;  2R9O A;  2E01 A;  1PAD A;  5PAD A;  5EZS A;  5JA7 A;  1YK8 A;  1AYU A;  2G8J A;  3USV A;  5E6J A;  4RKX A;  1HUC B;  1TLO A;  4OVZ A;  4AXL A;  1MHW A;  1SNK A;  2DCB A;  2FQ9 A;  4FIP A;  3K8U A;  1DKI A;  2P7U A;  3CBJ A;  1AYV A;  3TNX A;  2R9F A;  3BWK A;  3PW3 A;  1PCI A;  5FPW A;  3H8C A;  1YVB A;  4MM3 B;  4D8I A;  4IUM A;  3IEJ A;  3PRP A;  3CH2 X;  1SP4 B;  4YYV A;  1GEC E;  1POP A;  2FTD A;  1PE6 A;  2H7J A;  3KKU A;  1CSB B;  3E1Z B;  4RNA A;  8PCH A;  3RNV A;  4FK5 A;  3LXS A;  1MDW A;  5CVN B;  2DC6 A;  3PT2 A;  5JZE A;  3WXG A;  2PAD A;  1ZIV A;  4REZ A;  3BBA A;  4A5U A;  3KWZ A;  1F29 A;  2BDZ A;  2E00 A;  2NQD B;  3HHA A;  4X6I A;  4FJC A;  1U5I A;  4P16 A;  2R9M A;  4PAD A;  4P6G A;  2YJ8 A;  2R6N A; 
#chains in the Genus database with same CATH homology
 3V6C A;  3U8E A;  2HHN A;  1BP4 A;  2Y6E A;  3P5V A;  1BGO A;  3MHH A;  2DJG B;  5EGW A;  1F2A A;  2GHU A;  2OZ2 A;  5EF4 A;  4CDC B;  2G8E A;  2C0Y A;  1GLO A;  1PPN A;  1GMY A;  2YJC A;  1X9Y A;  4YYW A;  3IUT A;  4N4Z A;  2HH5 A;  2Y5B A;  4DMX A;  2WBF X;  1CTE A;  3K9M A;  2AU1 A;  1CPJ A;  1W6F A;  4OEL A;  2DCC A;  4WA6 A;  2ACT A;  1MEG A;  4HWY A;  1FH0 A;  2CIO A;  3RVV A;  2PNS A;  2OP3 A;  2DZZ A;  4RY2 A;  1JQP A;  1YK7 A;  1K3B B;  2NQA A;  2NQI A;  1TL9 A;  1STF E;  1TU6 A;  3F75 A;  1ZCM A;  2YJB A;  3BPF A;  4BQV A;  5K16 A;  2FRA A;  2DZY A;  3LTW A;  2VFC A;  2G7Y A;  1AEC A;  3C9E A;  1DF0 A;  4I04 A;  1U9Q X;  1NLJ A;  4QBB A;  4Q8G A;  1CQD A;  1U9V A;  2DC7 A;  5JH3 A;  3OIS A;  3H8B A;  1NQC A;  2DC8 A;  1AU2 A;  1PIP A;  3KWB X;  1E2T A;  3ERV A;  2DCD A;  2AYO A;  2XU4 A;  2O6X A;  1PXV A;  3H6S A;  3P5U A;  4DMY A;  1AU0 A;  1EWL A;  2IBI A;  2B1M A;  4PI3 A;  3IHP A;  4X6H A;  1VJV A;  1NB3 A;  5CVM A;  3QJ3 A;  2JQG R;  4YV8 A;  3CH3 X;  3KSE A;  2DCA A;  2HXZ A;  1GCB A;  1A6R A;  3LFY A;  4PP1 A;  4ZUX U;  4K7C A;  1QMY A;  3MHS A;  1U9X A;  2FUD A;  2AIM A;  3O1G A;  3AI8 A;  1NB5 A;  4CDF B;  3HWN A;  3MTN A;  3BCN A;  3N3G A;  1YT7 A;  4XR7 A;  1CVZ A;  1ITO A;  3O0U A;  4N79 A;  5CHT A;  1PPP A;  3OF9 A;  3P5W A;  3RVX A;  2PRE A;  3HHI A;  5A24 A;  1BQI A;  3NHE A;  4I07 A;  2YJ9 A;  4CDE B;  2R9N A;  2AYN A;  2FO5 A;  2PBH A;  4YVA A;  2YJ2 A;  4QRV A;  1ICF A;  7PCK A;  1EF7 A;  2ARY A;  3D6S A;  2ATO A;  2E03 A;  1AYW A;  4MZS A;  6PAD A;  1Q6K A;  1MIR A;  4W4U A;  2CB5 A;  2E02 A;  1CV8 A;  3BC3 A;  4I05 A;  2DC9 A;  1EWO A;  1QXP A;  2DJF B;  3WXF A;  1KFX L;  1THE A;  2BSZ A;  1YAL A;  4MZO A;  3F5V A;  4BGF A;  3BOW A;  3RVW A;  1ATK A;  1ME3 A;  4AXM A;  2AUZ A;  4MSX A;  1PBH A;  2NQG A;  3GCB A;  1BY8 A;  4X6J A;  4XUI A;  3M99 A;  2VHF A;  3H7D A;  1VSN A;  3I06 A;  4QRG A;  1AU4 A;  1KHQ A;  2XU3 A;  5J94 A;  4YYQ A;  4BSQ A;  1O0E A;  3P5X A;  4G54 A;  1QDQ A;  1M6D A;  1F2B A;  3KW9 A;  4GUZ A;  3H89 A;  1AIM A;  3ZUA A;  1ME4 A;  4W5B A;  3B79 A;  3PNR A;  2JQF R;  2R9C A;  1EWP A;  2OUL A;  1NL6 A;  1KHP A;  1PPD A;  1Y08 A;  3S3Q A;  3OF8 A;  2BDL A;  1KFU L;  4P6E A;  4QH6 A;  1MEM A;  3IV2 A;  2XU1 A;  2P0R A;  4OEM A;  3HD3 A;  2FT2 A;  1W5R A;  2F1G A;  4Q8H A;  4C5P A;  1CS8 A;  3QT4 A;  2IPP B;  3S3R A;  3K24 A;  3V6E A;  4BS6 A;  3IMA A;  3I3T A;  4N8W A;  5CVO B;  1S4V A;  2F7D A;  1EWM A;  3CBK A;  1IWD A;  3OVZ A;  4YYS A;  5F02 A;  3BPM A;  1CB5 A;  2XU5 A;  1MS6 A;  4BS5 A;  1U9W A;  3N4C A;  2VHS A;  4PP2 E;  4YYR A;  2AVW A;  4CDD B;  1W4T A;  3KFQ A;  2FRQ A;  3PBH A;  1AU3 A;  2FYE A;  2GFO A;  1PPO A;  4NV8 A;  2HD5 A;  4CZW A;  1Y4H A;  3IOQ A;  2AUX A;  3DF0 A;  3MOR A;  4QRX A;  3PDF A;  4W5C A;  9PAP A;  1QOL A;  3KX1 A;  1CJL A;  1NPZ A;  4NV7 A;  1DEU A;  1KXR A;  2AS8 A;  3D9W A;  3N3K A;  3OVX A;  5CHV A;  2G6D A;  4YYU A;  1F2C A;  1XKG A;  4KLB A;  2P86 A;  4BPV A;  3WXE A;  3QSD A;  2B1N A;  2R9O A;  2E01 A;  1PAD A;  5PAD A;  4B55 A;  5JA7 A;  1YK8 A;  1AYU A;  2G8J A;  3USV A;  1HUC B;  1TLO A;  4AXL A;  1MHW A;  1SNK A;  2DCB A;  2FQ9 A;  4FIP A;  3K8U A;  2P7U A;  3CBJ A;  1AYV A;  3TNX A;  2R9F A;  3BWK A;  3PW3 A;  1PCI A;  5FPW A;  3H8C A;  1YVB A;  3IEJ A;  3CH2 X;  1SP4 B;  4YYV A;  1GEC E;  1POP A;  2FTD A;  1PE6 A;  2H7J A;  3KKU A;  1CSB B;  3E1Z B;  8PCH A;  4FK5 A;  3LXS A;  1MDW A;  5CVN B;  2DC6 A;  3WXG A;  2PAD A;  1ZIV A;  3KWZ A;  2VFB A;  1F29 A;  2BDZ A;  2E00 A;  2NQD B;  3HHA A;  4X6I A;  4FJC A;  1GX3 A;  1U5I A;  2R9M A;  4PAD A;  4P6G A;  2YJ8 A;  2R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...