1KHQA

Orthorhombic form of papain/zlfg-dam covalent complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
publication title Two polymorphs of a covalent complex between papain and a diazomethylketone inhibitor
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 73
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1khqA00
3HHAA 1F2BA 1ME4A 4X6JA 3KKUA 4YV8A 1F2AA 1U9XA 7PCKA 3OVZA 2XU1A 5CHVA 4MZOA 1CV8A 5CVMA 1PXVA 2DJGB 3K9MA 1NL6A 4CDEB 5CVNB 1EWMA 4YYRA 4BSQA 1SP4B 2VHFA 3K8UA 1Q6KA 1MDWA 2JQFR 4QH6A 2GFOA 2IPPB 3I3TA 3IHPA 3K24A 3OF9A 3H89A 1HUCB 1PIPA 3C9EA 3HHIA 2CB5A 3D6SA 1PPOA 3E1ZB 5CHTA 1ATKA 1PPNA 2FT2A 3N3KA 3MORA 2AYNA 1ME3A 5FPWA 6PADA 1EF7A 3TNXA 2H7JA 2FYEA 4AXMA 2FQ9A 3RVWA 2DCDA 1VSNA 4ZUXU 1JQPA 1YT7A 3BCNA 1S4VA 3P5UA 1DF0A 4OELA 2NQAA 4BS5A 4YYSA 3BWKA 2G8EA 1AU4A 2E00A 2Y5BA 4K7CA 4YYWA 4FK5A 4W4UA 3IV2A 1Y4HA 4QRGA 4OEMA 3OVXA 1F2CA 2JQGR 5JH3A 2ACTA 1IWDA 2FTDA 3QSDA 3MTNA 1MEGA 3MHSA 2DC7A 1NB5A 3NHEA 2OP3A 3BC3A 2AIMA 1U9WA 1AU3A 5K16A 2DZYA 2VHSA 4DMXA 4P6GA 1KFXL 3O1GA 3KFQA 2XU5A 1QOLA 1ZIVA 1YVBA 1YK8A 1NQCA 2XU3A 1MIRA 2P86A 1TL9A 2BDZA 1TU6A 1XKGA 4QRVA 1KHPA 3PW3A 1CJLA 2AYOA 3CBKA 1U9QX 1NPZA 2NQDB 9PAPA 2Y6EA 2G8JA 2DCCA 1POPA 5A24A 2WBFX 2NQIA 1EWOA 3KX1A 4YVAA 4I05A 1BY8A 1EWLA 2IBIA 2G7YA 5F02A 2P7UA 3BOWA 4X6IA 4PI3A 4W5BA 2P0RA 1YK7A 2YJBA 3DF0A 1M6DA 2AUXA 3H8BA 3CH2X 1STFE 3P5VA 4YYVA 3S3QA 1U9VA 4QRXA 3S3RA 4PP2E 1O0EA 3PDFA 4CDCB 1CPJA 2GHUA 3AI8A 4Q8HA 3HWNA 3N4CA 3B79A 3PBHA 2G6DA 1PCIA 3H7DA 4BS6A 2PBHA 2AUZA 1YALA 3BPFA 2YJ9A 4CDDB 3M99A 2E01A 2CIOA 4RY2A 1CSBB 2OULA 1BP4A 2B1MA 2PNSA 4CDFB 1THEA 3KSEA 3QJ3A 1QDQA 1NB3A 2DCAA 3IOQA 3QT4A 3V6CA 1A6RA 3P5WA 4YYQA 2DC8A 1F29A 5J94A 4MZSA 2HD5A 1K3BB 1KXRA 3H6SA 4PADA 3USVA 4FIPA 2C0YA 4BQVA 1MHWA 1AYUA 4W5CA 5PADA 4FJCA 2R9CA 3F75A 1CVZA 3WXFA 1AU2A 3KWZA 3O0UA 4YYUA 1EWPA 1PE6A 1AYWA 2E02A 1AIMA 1FH0A 4I07A 1MS6A 2F7DA 1PBHA 2R9MA 3ZUAA 4XR7A 1CB5A 1QMYA 1BGOA 8PCHA 1AU0A 1Y08A 1NLJA 1CTEA 2PREA 1ICFA 3GCBA 1PADA 3U8EA 1KHQA 2B1NA 1BQIA 1GLOA 2ATOA 1CQDA 1KFUL 1ZCMA 1TLOA 4G54A 4BPVA 4N8WA 3IUTA 1SNKA 3ERVA 4MSXA 3KWBX 1GMYA 3WXEA 1QXPA 3LFYA 3P5XA 4DMYA 1ITOA 1MEMA 1U5IA 3LXSA 4HWYA 4WA6A 3OISA 3IEJA 2YJCA 3OF8A 3F5VA 3V6EA 5EGWA 1AYVA 4XUIA 2OZ2A 4I04A 2ARYA 3CBJA 4N4ZA 1VJVA 3H8CA 2FRAA 2R9OA 4CZWA 1CS8A 2AS8A 2PADA 4P6EA 3RVXA 2R9FA 1GCBA 1PPPA 4AXLA 2BDLA 2E03A 2R6NA 2AU1A 3HD3A 4QBBA 1PPDA 2DCBA 3MHHA 2FO5A 1GECE 3IMAA 2HXZA 2FUDA 2HH5A 3WXGA 4KLBA 3I06A 1DEUA 2AVWA 3RVVA 3N3GA 3CH3X 2F1GA 3PNRA 2YJ2A 1AECA 2YJ8A 2XU4A 2DJFB 4PP1A 4X6HA 2DC6A 2R9NA 3KW9A 2DZZA 5CVOB 2NQGA 3BPMA 5EF4A 2O6XA 2FRQA 4N79A 2DC9A 1X9YA 2HHNA 4Q8GA 5JA7A
chains in the Genus database with same CATH superfamily
3HHAA 1F2BA 5KO3A 1ME4A 4X6JA 3KKUA 4YV8A 1F2AA 1U9XA 7PCKA 3OVZA 2XU1A 5CHVA 4MZOA 4D8IA 4RNAA 1CV8A 5CVMA 1PXVA 2DJGB 3K9MA 1NL6A 4CDEB 5CVNB 1EWMA 4YYRA 4BSQA 1SP4B 2VHFA 4RF1A 3K8UA 1Q6KA 1MDWA 2JQFR 4QH6A 2GFOA 2IPPB 3I3TA 3O65A 3IHPA 3K24A 3OF9A 3H89A 1HUCB 1PIPA 3C9EA 3HHIA 2CB5A 3D6SA 3PHUA 3BB7A 1PPOA 2HWKA 3B21A 3E1ZB 4BOZA 5CHTA 3RNVA 1ATKA 1PPNA 2FT2A 3N3KA 3MORA 2AYNA 1ME3A 5FPWA 6PADA 1EF7A 1UKFA 4RF0A 3TNXA 2BU3A 2H7JA 2FYEA 3PHXA 4AXMA 2FQ9A 3RVWA 2DCDA 1VSNA 4ZUXU 1JQPA 1YT7A 3BCNA 1S4VA 3P5UA 1DF0A 4OELA 2NQAA 4BS5A 4YYSA 3BWKA 4D8BA 2G8EA 1AU4A 2E00A 2Y5BA 4K7CA 4ZTBA 4YYWA 4FK5A 4W4UA 3IV2A 1Y4HA 4QRGA 4OEMA 3OVXA 1F2CA 2JQGR 5JH3A 2ACTA 1IWDA 2FTDA 3QSDA 3MTNA 1MEGA 3MHSA 2DC7A 3W31A 1NB5A 3NHEA 2OP3A 3BC3A 2AIMA 1U9WA 1AU3A 4PT5A 5K16A 2DZYA 2VHSA 4DMXA 4P6GA 1KFXL 3O1GA 3KFQA 4MI7A 2XU5A 2JRIA 1QOLA 1ZIVA 1YVBA 1YK8A 1NQCA 3BY4A 3TMPA 2XU3A 1MIRA 4MM3B 2P86A 1TL9A 2BDZA 1TU6A 1XKGA 4QRVA 1KHPA 3PW3A 1CJLA 2AYOA 2FE8A 3CBKA 1U9QX 1NPZA 2NQDB 4IP3A 5E6JA 9PAPA 4P16A 2Y6EA 2G8JA 2DCCA 1POPA 5A24A 2WBFX 5EZQA 2NQIA 1EWOA 3KX1A 5JZEA 4YVAA 4I05A 1BY8A 1EWLA 2IBIA 2J7QA 2G7YA 5F02A 3ZNHA 2P7UA 3BOWA 4X6IA 4PI3A 4W5BA 2P0RA 1YK7A 4A5UA 2YJBA 2BTWB 3DF0A 1M6DA 2AUXA 3H8BA 3CH2X 1STFE 3P5VA 4GUAA 4BOSA 4YYVA 3S3QA 1U9VA 4QRXA 3PRPA 3S3RA 4PP2E 1O0EA 3PDFA 4CDCB 1CPJA 2GHUA 3AI8A 3PRMA 4Q8HA 3HWNA 3N4CA 3B79A 3PBHA 2G6DA 1YZBA 1PCIA 3H7DA 4BS6A 3PSEA 2PBHA 2AUZA 1YALA 3BPFA 2YJ9A 4CDDB 3M99A 2AGAA 2E01A 2CIOA 4RY2A 1CSBB 1PVJA 2OULA 1BP4A 2B1MA 2PNSA 4CDFB 1THEA 3KSEA 4D8EA 3QJ3A 1QDQA 1NB3A 2BTWA 2DCAA 3IOQA 3QT4A 3V6CA 1A6RA 3P5WA 4YYQA 2DC8A 1F29A 5J94A 3C0RA 4MZSA 2HD5A 1K3BB 1KXRA 3H6SA 4PADA 4RKXA 3USVA 4FIPA 2C0YA 4BQVA 1MHWA 1AYUA 4W5CA 5PADA 4FJCA 2R9CA 3F75A 1CVZA 3WXFA 1AU2A 3KWZA 3O0UA 4YYUA 1EWPA 1PE6A 1AYWA 2E02A 1AIMA 1FH0A 4HXDB 4I07A 1MS6A 2F7DA 4OW0A 2J7QC 1PBHA 2R9MA 3ZUAA 4XR7A 1CB5A 1QMYA 1BGOA 8PCHA 1AU0A 3MP2A 5EZSA 4M0WA 4IUMA 2DOSA 1Y08A 1NLJA 4OVZB 1CTEA 2PREA 3E9SA 1ICFA 3GCBA 1PADA 3U8EA 1KHQA 2B1NA 1BQIA 1GLOA 2ATOA 1CQDA 1KFUL 1ZCMA 1TLOA 4G54A 4BPVA 3PT2A 4N8WA 3IUTA 1SNKA 3ERVA 4MSXA 3KWBX 1GMYA 3WXEA 1QXPA 3LFYA 3P5XA 4DMYA 1ITOA 1MEMA 1U5IA 3LXSA 4HWYA 4WA6A 3W30A 3OISA 3IEJA 2YJCA 3OF8A 3F5VA 4WURA 3V6EA 5EGWA 4REZA 1AYVA 4XUIA 2OZ2A 4I04A 2ARYA 3IFUA 3CBJA 4N4ZA 1VJVA 3H8CA 2FRAA 4R3DA 2R9OA 4BOUA 2UZJA 3MJ5A 4CZWA 1CS8A 2AS8A 2PADA 4P6EA 3RVXA 2R9FA 1GCBA 1PPPA 4AXLA 2BDLA 2E03A 2R6NA 4OVZA 2AU1A 3HD3A 3OQCA 4QBBA 1PPDA 2DCBA 3MHHA 3MTVA 2FO5A 1GECE 3IMAA 2HXZA 3TRKA 3BBAA 2FUDA 2HH5A 2Z84A 3WXGA 4BOPA 4XZXA 4KLBA 3I06A 1DEUA 2AVWA 3RVVA 3N3GA 3CH3X 2F1GA 4BOQA 3PNRA 2YJ2A 1AECA 2YJ8A 2XU4A 1DKIA 2DJFB 4PP1A 4X6HA 2JTCA 2DC6A 2R9NA 3KW9A 2DZZA 5CVOB 2NQGA 3BPMA 5EF4A 2O6XA 2FRQA 4N79A 2DC9A 1X9YA 3PHWA 2HHNA 4Q8GA 5JA7A
chains in the Genus database with same CATH topology
1E2TA 3HHAA 1F2BA 1ME4A 4X6JA 3KKUA 4YV8A 1F2AA 1U9XA 7PCKA 3OVZA 2XU1A 5CHVA 4MZOA 1CV8A 5CVMA 1PXVA 2DJGB 3K9MA 1NL6A 4CDEB 5CVNB 1EWMA 4YYRA 4BSQA 1SP4B 2VHFA 3K8UA 1Q6KA 1MDWA 2JQFR 4QH6A 2GFOA 2IPPB 3I3TA 3IHPA 3K24A 3OF9A 3H89A 1HUCB 1PIPA 3C9EA 3HHIA 2CB5A 3D6SA 1PPOA 3E1ZB 5CHTA 1ATKA 1PPNA 2FT2A 3N3KA 3MORA 2AYNA 1ME3A 5FPWA 6PADA 1EF7A 3TNXA 2H7JA 2FYEA 4AXMA 2FQ9A 3RVWA 2DCDA 1VSNA 4ZUXU 1JQPA 1YT7A 3BCNA 1S4VA 3P5UA 1DF0A 4OELA 2NQAA 4BS5A 4YYSA 3BWKA 2G8EA 1AU4A 2E00A 2Y5BA 4K7CA 4YYWA 4FK5A 4W4UA 3IV2A 1Y4HA 4QRGA 3LTWA 4OEMA 3OVXA 1F2CA 2JQGR 5JH3A 2ACTA 1IWDA 2FTDA 3QSDA 3MTNA 1MEGA 3MHSA 2DC7A 1NB5A 3NHEA 2OP3A 3BC3A 2AIMA 1U9WA 1AU3A 5K16A 2DZYA 2VHSA 4DMXA 4P6GA 1KFXL 4GUZA 3O1GA 3KFQA 1W5RA 2XU5A 1QOLA 1ZIVA 1YVBA 1YK8A 1NQCA 2XU3A 1MIRA 2P86A 1TL9A 2BDZA 1TU6A 1XKGA 4QRVA 1KHPA 3PW3A 1CJLA 2VFCA 2AYOA 4NV8A 3CBKA 1U9QX 1NPZA 2NQDB 9PAPA 2Y6EA 2G8JA 2DCCA 1POPA 5A24A 2WBFX 2NQIA 1EWOA 3KX1A 4YVAA 4I05A 1BY8A 1EWLA 2IBIA 2G7YA 5F02A 2P7UA 3BOWA 4X6IA 4PI3A 4W5BA 4B55A 2P0RA 1YK7A 2YJBA 3DF0A 1M6DA 2AUXA 3H8BA 3CH2X 1STFE 3P5VA 4YYVA 3S3QA 1U9VA 4QRXA 3S3RA 4PP2E 1O0EA 1W6FA 3PDFA 4CDCB 1CPJA 2GHUA 3AI8A 4Q8HA 3HWNA 3N4CA 3B79A 3PBHA 2G6DA 1PCIA 3H7DA 4BS6A 2PBHA 2VFBA 2AUZA 1YALA 3BPFA 2YJ9A 4CDDB 3M99A 2E01A 2CIOA 4RY2A 1CSBB 2OULA 1BP4A 2B1MA 2BSZA 2PNSA 4CDFB 1THEA 3KSEA 3QJ3A 1QDQA 1NB3A 2DCAA 3D9WA 3IOQA 3QT4A 4NV7A 3V6CA 1A6RA 3P5WA 4YYQA 2DC8A 1F29A 5J94A 4MZSA 2HD5A 1K3BB 1KXRA 3H6SA 1W4TA 4PADA 3USVA 4FIPA 2C0YA 4BQVA 1MHWA 1AYUA 4W5CA 5PADA 4FJCA 2R9CA 3F75A 1CVZA 3WXFA 1AU2A 3KWZA 3O0UA 4YYUA 1EWPA 1PE6A 1AYWA 2E02A 1AIMA 1FH0A 4I07A 1MS6A 2F7DA 1PBHA 2R9MA 3ZUAA 4XR7A 1CB5A 1QMYA 1BGOA 8PCHA 1AU0A 1Y08A 1NLJA 1CTEA 2PREA 1ICFA 3GCBA 1PADA 3U8EA 1KHQA 2B1NA 1BQIA 1GLOA 2ATOA 1CQDA 1KFUL 1ZCMA 1TLOA 4G54A 4BPVA 4N8WA 3IUTA 1SNKA 3ERVA 4MSXA 3KWBX 1GMYA 1GX3A 3WXEA 1QXPA 3LFYA 3P5XA 4DMYA 1ITOA 1MEMA 1U5IA 3LXSA 4HWYA 4WA6A 3OISA 3IEJA 2YJCA 3OF8A 3F5VA 3V6EA 5EGWA 1AYVA 4XUIA 2OZ2A 4I04A 2ARYA 3CBJA 4N4ZA 1VJVA 3H8CA 2FRAA 2R9OA 4CZWA 1CS8A 2AS8A 2PADA 4P6EA 3RVXA 2R9FA 1GCBA 1PPPA 4AXLA 4BGFA 2BDLA 2E03A 2R6NA 2AU1A 3HD3A 4QBBA 1PPDA 2DCBA 3MHHA 2FO5A 1GECE 3IMAA 2HXZA 2FUDA 2HH5A 3WXGA 4KLBA 3I06A 1DEUA 2AVWA 3RVVA 3N3GA 3CH3X 2F1GA 3PNRA 2YJ2A 1AECA 2YJ8A 2XU4A 2DJFB 4PP1A 4X6HA 4C5PA 2DC6A 2R9NA 3KW9A 2DZZA 5CVOB 2NQGA 3BPMA 5EF4A 2O6XA 2FRQA 4N79A 2DC9A 1X9YA 2HHNA 4Q8GA 5JA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHA A;  1F2B A;  1ME4 A;  4X6J A;  3KKU A;  4YV8 A;  1F2A A;  1U9X A;  7PCK A;  3OVZ A;  2XU1 A;  5CHV A;  4MZO A;  1CV8 A;  5CVM A;  1PXV A;  2DJG B;  3K9M A;  1NL6 A;  4CDE B;  5CVN B;  1EWM A;  4YYR A;  4BSQ A;  1SP4 B;  2VHF A;  3K8U A;  1Q6K A;  1MDW A;  2JQF R;  4QH6 A;  2GFO A;  2IPP B;  3I3T A;  3IHP A;  3K24 A;  3OF9 A;  3H89 A;  1HUC B;  1PIP A;  3C9E A;  3HHI A;  2CB5 A;  3D6S A;  1PPO A;  3E1Z B;  5CHT A;  1ATK A;  1PPN A;  2FT2 A;  3N3K A;  3MOR A;  2AYN A;  1ME3 A;  5FPW A;  6PAD A;  1EF7 A;  3TNX A;  2H7J A;  2FYE A;  4AXM A;  2FQ9 A;  3RVW A;  2DCD A;  1VSN A;  4ZUX U;  1JQP A;  1YT7 A;  3BCN A;  1S4V A;  3P5U A;  1DF0 A;  4OEL A;  2NQA A;  4BS5 A;  4YYS A;  3BWK A;  2G8E A;  1AU4 A;  2E00 A;  2Y5B A;  4K7C A;  4YYW A;  4FK5 A;  4W4U A;  3IV2 A;  1Y4H A;  4QRG A;  4OEM A;  3OVX A;  1F2C A;  2JQG R;  5JH3 A;  2ACT A;  1IWD A;  2FTD A;  3QSD A;  3MTN A;  1MEG A;  3MHS A;  2DC7 A;  1NB5 A;  3NHE A;  2OP3 A;  3BC3 A;  2AIM A;  1U9W A;  1AU3 A;  5K16 A;  2DZY A;  2VHS A;  4DMX A;  4P6G A;  1KFX L;  3O1G A;  3KFQ A;  2XU5 A;  1QOL A;  1ZIV A;  1YVB A;  1YK8 A;  1NQC A;  2XU3 A;  1MIR A;  2P86 A;  1TL9 A;  2BDZ A;  1TU6 A;  1XKG A;  4QRV A;  1KHP A;  3PW3 A;  1CJL A;  2AYO A;  3CBK A;  1U9Q X;  1NPZ A;  2NQD B;  9PAP A;  2Y6E A;  2G8J A;  2DCC A;  1POP A;  5A24 A;  2WBF X;  2NQI A;  1EWO A;  3KX1 A;  4YVA A;  4I05 A;  1BY8 A;  1EWL A;  2IBI A;  2G7Y A;  5F02 A;  2P7U A;  3BOW A;  4X6I A;  4PI3 A;  4W5B A;  2P0R A;  1YK7 A;  2YJB A;  3DF0 A;  1M6D A;  2AUX A;  3H8B A;  3CH2 X;  1STF E;  3P5V A;  4YYV A;  3S3Q A;  1U9V A;  4QRX A;  3S3R A;  4PP2 E;  1O0E A;  3PDF A;  4CDC B;  1CPJ A;  2GHU A;  3AI8 A;  4Q8H A;  3HWN A;  3N4C A;  3B79 A;  3PBH A;  2G6D A;  1PCI A;  3H7D A;  4BS6 A;  2PBH A;  2AUZ A;  1YAL A;  3BPF A;  2YJ9 A;  4CDD B;  3M99 A;  2E01 A;  2CIO A;  4RY2 A;  1CSB B;  2OUL A;  1BP4 A;  2B1M A;  2PNS A;  4CDF B;  1THE A;  3KSE A;  3QJ3 A;  1QDQ A;  1NB3 A;  2DCA A;  3IOQ A;  3QT4 A;  3V6C A;  1A6R A;  3P5W A;  4YYQ A;  2DC8 A;  1F29 A;  5J94 A;  4MZS A;  2HD5 A;  1K3B B;  1KXR A;  3H6S A;  4PAD A;  3USV A;  4FIP A;  2C0Y A;  4BQV A;  1MHW A;  1AYU A;  4W5C A;  5PAD A;  4FJC A;  2R9C A;  3F75 A;  1CVZ A;  3WXF A;  1AU2 A;  3KWZ A;  3O0U A;  4YYU A;  1EWP A;  1PE6 A;  1AYW A;  2E02 A;  1AIM A;  1FH0 A;  4I07 A;  1MS6 A;  2F7D A;  1PBH A;  2R9M A;  3ZUA A;  4XR7 A;  1CB5 A;  1QMY A;  1BGO A;  8PCH A;  1AU0 A;  1Y08 A;  1NLJ A;  1CTE A;  2PRE A;  1ICF A;  3GCB A;  1PAD A;  3U8E A;  1KHQ A;  2B1N A;  1BQI A;  1GLO A;  2ATO A;  1CQD A;  1KFU L;  1ZCM A;  1TLO A;  4G54 A;  4BPV A;  4N8W A;  3IUT A;  1SNK A;  3ERV A;  4MSX A;  3KWB X;  1GMY A;  3WXE A;  1QXP A;  3LFY A;  3P5X A;  4DMY A;  1ITO A;  1MEM A;  1U5I A;  3LXS A;  4HWY A;  4WA6 A;  3OIS A;  3IEJ A;  2YJC A;  3OF8 A;  3F5V A;  3V6E A;  5EGW A;  1AYV A;  4XUI A;  2OZ2 A;  4I04 A;  2ARY A;  3CBJ A;  4N4Z A;  1VJV A;  3H8C A;  2FRA A;  2R9O A;  4CZW A;  1CS8 A;  2AS8 A;  2PAD A;  4P6E A;  3RVX A;  2R9F A;  1GCB A;  1PPP A;  4AXL A;  2BDL A;  2E03 A;  2R6N A;  2AU1 A;  3HD3 A;  4QBB A;  1PPD A;  2DCB A;  3MHH A;  2FO5 A;  1GEC E;  3IMA A;  2HXZ A;  2FUD A;  2HH5 A;  3WXG A;  4KLB A;  3I06 A;  1DEU A;  2AVW A;  3RVV A;  3N3G A;  3CH3 X;  2F1G A;  3PNR A;  2YJ2 A;  1AEC A;  2YJ8 A;  2XU4 A;  2DJF B;  4PP1 A;  4X6H A;  2DC6 A;  2R9N A;  3KW9 A;  2DZZ A;  5CVO B;  2NQG A;  3BPM A;  5EF4 A;  2O6X A;  2FRQ A;  4N79 A;  2DC9 A;  1X9Y A;  2HHN A;  4Q8G A;  5JA7 A; 
#chains in the Genus database with same CATH topology
 3HHA A;  1F2B A;  5KO3 A;  1ME4 A;  4X6J A;  3KKU A;  4YV8 A;  1F2A A;  1U9X A;  7PCK A;  3OVZ A;  2XU1 A;  5CHV A;  4MZO A;  4D8I A;  4RNA A;  1CV8 A;  5CVM A;  1PXV A;  2DJG B;  3K9M A;  1NL6 A;  4CDE B;  5CVN B;  1EWM A;  4YYR A;  4BSQ A;  1SP4 B;  2VHF A;  4RF1 A;  3K8U A;  1Q6K A;  1MDW A;  2JQF R;  4QH6 A;  2GFO A;  2IPP B;  3I3T A;  3O65 A;  3IHP A;  3K24 A;  3OF9 A;  3H89 A;  1HUC B;  1PIP A;  3C9E A;  3HHI A;  2CB5 A;  3D6S A;  3PHU A;  3BB7 A;  1PPO A;  2HWK A;  3B21 A;  3E1Z B;  4BOZ A;  5CHT A;  3RNV A;  1ATK A;  1PPN A;  2FT2 A;  3N3K A;  3MOR A;  2AYN A;  1ME3 A;  5FPW A;  6PAD A;  1EF7 A;  1UKF A;  4RF0 A;  3TNX A;  2BU3 A;  2H7J A;  2FYE A;  3PHX A;  4AXM A;  2FQ9 A;  3RVW A;  2DCD A;  1VSN A;  4ZUX U;  1JQP A;  1YT7 A;  3BCN A;  1S4V A;  3P5U A;  1DF0 A;  4OEL A;  2NQA A;  4BS5 A;  4YYS A;  3BWK A;  4D8B A;  2G8E A;  1AU4 A;  2E00 A;  2Y5B A;  4K7C A;  4ZTB A;  4YYW A;  4FK5 A;  4W4U A;  3IV2 A;  1Y4H A;  4QRG A;  4OEM A;  3OVX A;  1F2C A;  2JQG R;  5JH3 A;  2ACT A;  1IWD A;  2FTD A;  3QSD A;  3MTN A;  1MEG A;  3MHS A;  2DC7 A;  3W31 A;  1NB5 A;  3NHE A;  2OP3 A;  3BC3 A;  2AIM A;  1U9W A;  1AU3 A;  4PT5 A;  5K16 A;  2DZY A;  2VHS A;  4DMX A;  4P6G A;  1KFX L;  3O1G A;  3KFQ A;  4MI7 A;  2XU5 A;  2JRI A;  1QOL A;  1ZIV A;  1YVB A;  1YK8 A;  1NQC A;  3BY4 A;  3TMP A;  2XU3 A;  1MIR A;  4MM3 B;  2P86 A;  1TL9 A;  2BDZ A;  1TU6 A;  1XKG A;  4QRV A;  1KHP A;  3PW3 A;  1CJL A;  2AYO A;  2FE8 A;  3CBK A;  1U9Q X;  1NPZ A;  2NQD B;  4IP3 A;  5E6J A;  9PAP A;  4P16 A;  2Y6E A;  2G8J A;  2DCC A;  1POP A;  5A24 A;  2WBF X;  5EZQ A;  2NQI A;  1EWO A;  3KX1 A;  5JZE A;  4YVA A;  4I05 A;  1BY8 A;  1EWL A;  2IBI A;  2J7Q A;  2G7Y A;  5F02 A;  3ZNH A;  2P7U A;  3BOW A;  4X6I A;  4PI3 A;  4W5B A;  2P0R A;  1YK7 A;  4A5U A;  2YJB A;  2BTW B;  3DF0 A;  1M6D A;  2AUX A;  3H8B A;  3CH2 X;  1STF E;  3P5V A;  4GUA A;  4BOS A;  4YYV A;  3S3Q A;  1U9V A;  4QRX A;  3PRP A;  3S3R A;  4PP2 E;  1O0E A;  3PDF A;  4CDC B;  1CPJ A;  2GHU A;  3AI8 A;  3PRM A;  4Q8H A;  3HWN A;  3N4C A;  3B79 A;  3PBH A;  2G6D A;  1YZB A;  1PCI A;  3H7D A;  4BS6 A;  3PSE A;  2PBH A;  2AUZ A;  1YAL A;  3BPF A;  2YJ9 A;  4CDD B;  3M99 A;  2AGA A;  2E01 A;  2CIO A;  4RY2 A;  1CSB B;  1PVJ A;  2OUL A;  1BP4 A;  2B1M A;  2PNS A;  4CDF B;  1THE A;  3KSE A;  4D8E A;  3QJ3 A;  1QDQ A;  1NB3 A;  2BTW A;  2DCA A;  3IOQ A;  3QT4 A;  3V6C A;  1A6R A;  3P5W A;  4YYQ A;  2DC8 A;  1F29 A;  5J94 A;  3C0R A;  4MZS A;  2HD5 A;  1K3B B;  1KXR A;  3H6S A;  4PAD A;  4RKX A;  3USV A;  4FIP A;  2C0Y A;  4BQV A;  1MHW A;  1AYU A;  4W5C A;  5PAD A;  4FJC A;  2R9C A;  3F75 A;  1CVZ A;  3WXF A;  1AU2 A;  3KWZ A;  3O0U A;  4YYU A;  1EWP A;  1PE6 A;  1AYW A;  2E02 A;  1AIM A;  1FH0 A;  4HXD B;  4I07 A;  1MS6 A;  2F7D A;  4OW0 A;  2J7Q C;  1PBH A;  2R9M A;  3ZUA A;  4XR7 A;  1CB5 A;  1QMY A;  1BGO A;  8PCH A;  1AU0 A;  3MP2 A;  5EZS A;  4M0W A;  4IUM A;  2DOS A;  1Y08 A;  1NLJ A;  4OVZ B;  1CTE A;  2PRE A;  3E9S A;  1ICF A;  3GCB A;  1PAD A;  3U8E A;  1KHQ A;  2B1N A;  1BQI A;  1GLO A;  2ATO A;  1CQD A;  1KFU L;  1ZCM A;  1TLO A;  4G54 A;  4BPV A;  3PT2 A;  4N8W A;  3IUT A;  1SNK A;  3ERV A;  4MSX A;  3KWB X;  1GMY A;  3WXE A;  1QXP A;  3LFY A;  3P5X A;  4DMY A;  1ITO A;  1MEM A;  1U5I A;  3LXS A;  4HWY A;  4WA6 A;  3W30 A;  3OIS A;  3IEJ A;  2YJC A;  3OF8 A;  3F5V A;  4WUR A;  3V6E A;  5EGW A;  4REZ A;  1AYV A;  4XUI A;  2OZ2 A;  4I04 A;  2ARY A;  3IFU A;  3CBJ A;  4N4Z A;  1VJV A;  3H8C A;  2FRA A;  4R3D A;  2R9O A;  4BOU A;  2UZJ A;  3MJ5 A;  4CZW A;  1CS8 A;  2AS8 A;  2PAD A;  4P6E A;  3RVX A;  2R9F A;  1GCB A;  1PPP A;  4AXL A;  2BDL A;  2E03 A;  2R6N A;  4OVZ A;  2AU1 A;  3HD3 A;  3OQC A;  4QBB A;  1PPD A;  2DCB A;  3MHH A;  3MTV A;  2FO5 A;  1GEC E;  3IMA A;  2HXZ A;  3TRK A;  3BBA A;  2FUD A;  2HH5 A;  2Z84 A;  3WXG A;  4BOP A;  4XZX A;  4KLB A;  3I06 A;  1DEU A;  2AVW A;  3RVV A;  3N3G A;  3CH3 X;  2F1G A;  4BOQ A;  3PNR A;  2YJ2 A;  1AEC A;  2YJ8 A;  2XU4 A;  1DKI A;  2DJF B;  4PP1 A;  4X6H A;  2JTC A;  2DC6 A;  2R9N A;  3KW9 A;  2DZZ A;  5CVO B;  2NQG A;  3BPM A;  5EF4 A;  2O6X A;  2FRQ A;  4N79 A;  2DC9 A;  1X9Y A;  3PHW A;  2HHN A;  4Q8G A;  5JA7 A; 
#chains in the Genus database with same CATH homology
 1E2T A;  3HHA A;  1F2B A;  1ME4 A;  4X6J A;  3KKU A;  4YV8 A;  1F2A A;  1U9X A;  7PCK A;  3OVZ A;  2XU1 A;  5CHV A;  4MZO A;  1CV8 A;  5CVM A;  1PXV A;  2DJG B;  3K9M A;  1NL6 A;  4CDE B;  5CVN B;  1EWM A;  4YYR A;  4BSQ A;  1SP4 B;  2VHF A;  3K8U A;  1Q6K A;  1MDW A;  2JQF R;  4QH6 A;  2GFO A;  2IPP B;  3I3T A;  3IHP A;  3K24 A;  3OF9 A;  3H89 A;  1HUC B;  1PIP A;  3C9E A;  3HHI A;  2CB5 A;  3D6S A;  1PPO A;  3E1Z B;  5CHT A;  1ATK A;  1PPN A;  2FT2 A;  3N3K A;  3MOR A;  2AYN A;  1ME3 A;  5FPW A;  6PAD A;  1EF7 A;  3TNX A;  2H7J A;  2FYE A;  4AXM A;  2FQ9 A;  3RVW A;  2DCD A;  1VSN A;  4ZUX U;  1JQP A;  1YT7 A;  3BCN A;  1S4V A;  3P5U A;  1DF0 A;  4OEL A;  2NQA A;  4BS5 A;  4YYS A;  3BWK A;  2G8E A;  1AU4 A;  2E00 A;  2Y5B A;  4K7C A;  4YYW A;  4FK5 A;  4W4U A;  3IV2 A;  1Y4H A;  4QRG A;  3LTW A;  4OEM A;  3OVX A;  1F2C A;  2JQG R;  5JH3 A;  2ACT A;  1IWD A;  2FTD A;  3QSD A;  3MTN A;  1MEG A;  3MHS A;  2DC7 A;  1NB5 A;  3NHE A;  2OP3 A;  3BC3 A;  2AIM A;  1U9W A;  1AU3 A;  5K16 A;  2DZY A;  2VHS A;  4DMX A;  4P6G A;  1KFX L;  4GUZ A;  3O1G A;  3KFQ A;  1W5R A;  2XU5 A;  1QOL A;  1ZIV A;  1YVB A;  1YK8 A;  1NQC A;  2XU3 A;  1MIR A;  2P86 A;  1TL9 A;  2BDZ A;  1TU6 A;  1XKG A;  4QRV A;  1KHP A;  3PW3 A;  1CJL A;  2VFC A;  2AYO A;  4NV8 A;  3CBK A;  1U9Q X;  1NPZ A;  2NQD B;  9PAP A;  2Y6E A;  2G8J A;  2DCC A;  1POP A;  5A24 A;  2WBF X;  2NQI A;  1EWO A;  3KX1 A;  4YVA A;  4I05 A;  1BY8 A;  1EWL A;  2IBI A;  2G7Y A;  5F02 A;  2P7U A;  3BOW A;  4X6I A;  4PI3 A;  4W5B A;  4B55 A;  2P0R A;  1YK7 A;  2YJB A;  3DF0 A;  1M6D A;  2AUX A;  3H8B A;  3CH2 X;  1STF E;  3P5V A;  4YYV A;  3S3Q A;  1U9V A;  4QRX A;  3S3R A;  4PP2 E;  1O0E A;  1W6F A;  3PDF A;  4CDC B;  1CPJ A;  2GHU A;  3AI8 A;  4Q8H A;  3HWN A;  3N4C A;  3B79 A;  3PBH A;  2G6D A;  1PCI A;  3H7D A;  4BS6 A;  2PBH A;  2VFB A;  2AUZ A;  1YAL A;  3BPF A;  2YJ9 A;  4CDD B;  3M99 A;  2E01 A;  2CIO A;  4RY2 A;  1CSB B;  2OUL A;  1BP4 A;  2B1M A;  2BSZ A;  2PNS A;  4CDF B;  1THE A;  3KSE A;  3QJ3 A;  1QDQ A;  1NB3 A;  2DCA A;  3D9W A;  3IOQ A;  3QT4 A;  4NV7 A;  3V6C A;  1A6R A;  3P5W A;  4YYQ A;  2DC8 A;  1F29 A;  5J94 A;  4MZS A;  2HD5 A;  1K3B B;  1KXR A;  3H6S A;  1W4T A;  4PAD A;  3USV A;  4FIP A;  2C0Y A;  4BQV A;  1MHW A;  1AYU A;  4W5C A;  5PAD A;  4FJC A;  2R9C A;  3F75 A;  1CVZ A;  3WXF A;  1AU2 A;  3KWZ A;  3O0U A;  4YYU A;  1EWP A;  1PE6 A;  1AYW A;  2E02 A;  1AIM A;  1FH0 A;  4I07 A;  1MS6 A;  2F7D A;  1PBH A;  2R9M A;  3ZUA A;  4XR7 A;  1CB5 A;  1QMY A;  1BGO A;  8PCH A;  1AU0 A;  1Y08 A;  1NLJ A;  1CTE A;  2PRE A;  1ICF A;  3GCB A;  1PAD A;  3U8E A;  1KHQ A;  2B1N A;  1BQI A;  1GLO A;  2ATO A;  1CQD A;  1KFU L;  1ZCM A;  1TLO A;  4G54 A;  4BPV A;  4N8W A;  3IUT A;  1SNK A;  3ERV A;  4MSX A;  3KWB X;  1GMY A;  1GX3 A;  3WXE A;  1QXP A;  3LFY A;  3P5X A;  4DMY A;  1ITO A;  1MEM A;  1U5I A;  3LXS A;  4HWY A;  4WA6 A;  3OIS A;  3IEJ A;  2YJC A;  3OF8 A;  3F5V A;  3V6E A;  5EGW A;  1AYV A;  4XUI A;  2OZ2 A;  4I04 A;  2ARY A;  3CBJ A;  4N4Z A;  1VJV A;  3H8C A;  2FRA A;  2R9O A;  4CZW A;  1CS8 A;  2AS8 A;  2PAD A;  4P6E A;  3RVX A;  2R9F A;  1GCB A;  1PPP A;  4AXL A;  4BGF A;  2BDL A;  2E03 A;  2R6N A;  2AU1 A;  3HD3 A;  4QBB A;  1PPD A;  2DCB A;  3MHH A;  2FO5 A;  1GEC E;  3IMA A;  2HXZ A;  2FUD A;  2HH5 A;  3WXG A;  4KLB A;  3I06 A;  1DEU A;  2AVW A;  3RVV A;  3N3G A;  3CH3 X;  2F1G A;  3PNR A;  2YJ2 A;  1AEC A;  2YJ8 A;  2XU4 A;  2DJF B;  4PP1 A;  4X6H A;  4C5P A;  2DC6 A;  2R9N A;  3KW9 A;  2DZZ A;  5CVO B;  2NQG A;  3BPM A;  5EF4 A;  2O6X A;  2FRQ A;  4N79 A;  2DC9 A;  1X9Y A;  2HHN A;  4Q8G A;  5JA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...