1AU2A

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent propanone inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Structure and Design of Potent and Selective Cathepsin K Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1au2A00
3MHHA 2G8JA 3H6SA 4N4ZA 4Q8GA 5JA7A 3KKUA 1ICFA 1KFUL 2Y6EA 3CH2X 1SP4B 4P6EA 2P7UA 3KFQA 1ME3A 1A6RA 1TU6A 2XU3A 3P5UA 3BC3A 4N79A 3P5VA 3H8CA 4W4UA 1FH0A 4WA6A 4BQVA 3H89A 3NHEA 5F02A 2FO5A 4PI3A 4W5CA 4W5BA 2AYNA 1DEUA 3WXGA 1KXRA 4QH6A 2HH5A 1AU3A 3BWKA 2C0YA 4MZOA 1EF7A 2AS8A 1TLOA 1YK7A 2AU1A 2IPPB 4N8WA 4X6HA 3IUTA 2CIOA 2OZ2A 4YVAA 1U9XA 4QBBA 3TNXA 2G7YA 4QRGA 2NQAA 2FYEA 4CDEB 2R6NA 4BS5A 2FUDA 1QDQA 3KSEA 3WXEA 2VHFA 2E03A 1EWMA 1PPNA 3HHAA 1F29A 2E00A 1AYUA 3BCNA 1VJVA 2DCAA 1S4VA 2PBHA 1YK8A 1K3BB 1CVZA 4G54A 4HWYA 1CPJA 2CB5A 2E01A 3OVXA 2Y5BA 4BS6A 1YALA 2R9OA 2OULA 3IV2A 4MZSA 2FRAA 1NLJA 5A24A 1BQIA 3RVVA 3K24A 3V6CA 2R9FA 3HWNA 1AYWA 1AU4A 1CJLA 2B1MA 3BPFA 2AVWA 4FK5A 1BY8A 2ARYA 2FT2A 3N4CA 5CVOB 1PXVA 2OP3A 4DMYA 2DC7A 2FRQA 1CV8A 2WBFX 4FJCA 3USVA 2DC8A 1AECA 3RVWA 4YYUA 2ACTA 1POPA 3OF8A 3B79A 2XU1A 3OVZA 1U9WA 4YYSA 3N3GA 3QSDA 3S3QA 1QMYA 4YYWA 3PW3A 4RY2A 4AXMA 1O0EA 1GCBA 4CZWA 3CBJA 4KLBA 2PREA 4CDDB 2YJ9A 4K7CA 4OELA 4YYQA 1HUCB 3KW9A 7PCKA 4XR7A 3LFYA 2VHSA 1JQPA 4X6JA 1CS8A 4PADA 9PAPA 2AIMA 3MTNA 1AU2A 3PBHA 4PP2E 2XU5A 2FTDA 1ZCMA 3P5WA 1MHWA 1THEA 2NQIA 2YJ2A 3KX1A 2IBIA 1EWOA 2AUZA 2O6XA 4YYVA 3IOQA 4I04A 1PIPA 2H7JA 1KHQA 3KWBX 3KWZA 3QT4A 1NPZA 2PNSA 3O1GA 2HXZA 2YJBA 3PDFA 1NL6A 2DCBA 3K9MA 4CDFB 2R9CA 1Y08A 1PE6A 3MHSA 3ZUAA 4BPVA 3MORA 1F2BA 2ATOA 1KHPA 1MIRA 3HHIA 1SNKA 5CHVA 3D6SA 3H8BA 2YJCA 5EGWA 4YV8A 1Q6KA 2BDZA 1MEMA 3C9EA 3F75A 1X9YA 2GFOA 1NB5A 3IMAA 2G6DA 5CVNB 4X6IA 1EWPA 5J94A 1MDWA 5PADA 3DF0A 2HD5A 2P86A 1GECE 2E02A 5FPWA 3CH3X 1YVBA 4DMXA 2DC6A 1AU0A 1MEGA 1PBHA 4MSXA 1TL9A 3HD3A 3P5XA 3RVXA 1PADA 1YT7A 3H7DA 3OF9A 2R9NA 1QXPA 1STFE 1U9QX 5JH3A 1IWDA 1AYVA 4QRVA 3WXFA 1BGOA 8PCHA 4ZUXU 1GLOA 4AXLA 3V6EA 4I07A 3LXSA 3AI8A 2B1NA 1EWLA 4PP1A 3GCBA 1ITOA 1PCIA 2JQFR 2DJFB 2P0RA 2PADA 3CBKA 3OISA 1F2CA 2DC9A 2AYOA 2F7DA 3S3RA 1BP4A 2DJGB 1F2AA 5CHTA 2DZZA 3U8EA 3M99A 1NB3A 1U5IA 3IEJA 1AIMA 1CB5A 1ME4A 1MS6A 1XKGA 3E1ZB 3PNRA 3K8UA 1PPOA 3BPMA 2DCDA 3F5VA 3ERVA 4OEMA 4BSQA 3QJ3A 6PADA 4P6GA 1PPDA 1VSNA 2YJ8A 2DZYA 3IHPA 3I06A 4XUIA 2HHNA 1CTEA 1GMYA 3N3KA 1CQDA 1ATKA 2R9MA 1DF0A 4YYRA 2GHUA 4Q8HA 5CVMA 1ZIVA 5EF4A 1M6DA 2FQ9A 2F1GA 2NQGA 1KFXL 5K16A 4FIPA 2DCCA 3BOWA 2G8EA 4I05A 4QRXA 4CDCB 1Y4HA 1QOLA 3O0UA 3I3TA 2XU4A 1NQCA 1U9VA 1CSBB 2NQDB 1PPPA 2JQGR 2BDLA 2AUXA
chains in the Genus database with same CATH superfamily
3MHHA 5JZEA 2G8JA 2AGAA 3H6SA 4N4ZA 4Q8GA 5JA7A 3KKUA 1ICFA 1KFUL 2Y6EA 3CH2X 1SP4B 4P6EA 2P7UA 2BU3A 3KFQA 1ME3A 1A6RA 1TU6A 2XU3A 3P5UA 4D8EA 3BC3A 4N79A 3P5VA 4RNAA 3H8CA 3B21A 4W4UA 1FH0A 4WA6A 4BQVA 3H89A 3NHEA 5F02A 2FO5A 4PI3A 3PRMA 4W5CA 4W5BA 2AYNA 1DEUA 3WXGA 1KXRA 4QH6A 2HH5A 1AU3A 3BWKA 2C0YA 4MZOA 1EF7A 2AS8A 1TLOA 1YK7A 2AU1A 2IPPB 4N8WA 4X6HA 3IUTA 2CIOA 4GUAA 2OZ2A 4YVAA 1U9XA 3W30A 4QBBA 3TNXA 5EZQA 2G7YA 4QRGA 2NQAA 2FYEA 2FE8A 4CDEB 2R6NA 4BS5A 1PVJA 4OW0A 3W31A 3MP2A 3MJ5A 2FUDA 1QDQA 3KSEA 3WXEA 2VHFA 2E03A 3E9SA 4XZXA 1EWMA 3TRKA 1PPNA 3HHAA 1F29A 2E00A 1AYUA 3BCNA 2JRIA 1VJVA 2PBHA 2DCAA 1S4VA 2HWKA 2BTWB 1YK8A 1K3BB 1CVZA 4G54A 4BOSA 4HWYA 1CPJA 2CB5A 2E01A 3OVXA 2Y5BA 3PHWA 4BS6A 4WURA 1YALA 2R9OA 2OULA 3IV2A 5E6JA 4MZSA 2FRAA 1NLJA 5A24A 3PSEA 1BQIA 3RVVA 4RF1A 3K24A 3V6CA 2R9FA 3HWNA 1AYWA 1AU4A 1CJLA 2B1MA 3BPFA 2AVWA 4FK5A 1BY8A 2ARYA 2FT2A 3N4CA 5CVOB 4MI7A 1PXVA 2OP3A 4DMYA 2DC7A 2FRQA 1CV8A 2BTWA 2WBFX 4FJCA 3USVA 2DC8A 1AECA 3RVWA 4YYUA 2ACTA 1POPA 3OF8A 3B79A 2XU1A 3OVZA 1U9WA 4OVZB 3N3GA 3QSDA 3S3QA 4YYSA 1QMYA 4YYWA 3PW3A 4RY2A 4AXMA 1O0EA 4BOUA 1GCBA 4CZWA 3CBJA 4KLBA 2DOSA 2Z84A 2PREA 4CDDB 2YJ9A 4K7CA 4OELA 4YYQA 1HUCB 3KW9A 7PCKA 4XR7A 3LFYA 2VHSA 1JQPA 4X6JA 3RNVA 1CS8A 4PADA 9PAPA 2AIMA 3MTNA 1AU2A 4P16A 3PBHA 4PP2E 4IUMA 2XU5A 2FTDA 1ZCMA 3P5WA 3ZNHA 1MHWA 1THEA 2NQIA 2YJ2A 3KX1A 2IBIA 2JTCA 4OVZA 1EWOA 4RF0A 4A5UA 4ZTBA 2AUZA 2O6XA 3PHXA 4R3DA 3IOQA 1PIPA 4I04A 4YYVA 2H7JA 1KHQA 3KWBX 3KWZA 3QT4A 1NPZA 2PNSA 3MTVA 3O1GA 2HXZA 2YJBA 3PDFA 1NL6A 2DCBA 3K9MA 4CDFB 2R9CA 1UKFA 1Y08A 1PE6A 3MHSA 3ZUAA 4BPVA 3MORA 1F2BA 2ATOA 1KHPA 1MIRA 3HHIA 1SNKA 5CHVA 3D6SA 3H8BA 3BY4A 4REZA 2YJCA 5EGWA 4YV8A 1Q6KA 2BDZA 1MEMA 3C9EA 3F75A 1X9YA 2GFOA 4MM3B 1NB5A 3IMAA 2G6DA 5CVNB 4X6IA 1EWPA 3OQCA 5J94A 1MDWA 4BOZA 5PADA 2J7QA 3DF0A 2HD5A 2P86A 1GECE 2E02A 5FPWA 3CH3X 1YVBA 4DMXA 2DC6A 4D8IA 1AU0A 1MEGA 1PBHA 4MSXA 1TL9A 3HD3A 3P5XA 3RVXA 1PADA 1YT7A 3IFUA 3H7DA 4M0WA 3OF9A 2R9NA 1QXPA 1STFE 1U9QX 3BB7A 5JH3A 1IWDA 1AYVA 4QRVA 3WXFA 1BGOA 8PCHA 4ZUXU 1GLOA 4AXLA 2UZJA 3V6EA 4I07A 3LXSA 4PT5A 3AI8A 2B1NA 1EWLA 4PP1A 3GCBA 1ITOA 3O65A 1PCIA 2JQFR 2DJFB 2P0RA 2PADA 3CBKA 3OISA 1F2CA 2DC9A 2AYOA 2J7QC 2F7DA 3S3RA 5EZSA 1BP4A 2DJGB 1F2AA 5CHTA 2DZZA 3U8EA 3M99A 1NB3A 4BOPA 1U5IA 3PHUA 3IEJA 4HXDB 3PT2A 1AIMA 1CB5A 1ME4A 1MS6A 1XKGA 3E1ZB 3PNRA 3K8UA 1PPOA 3BPMA 2DCDA 3F5VA 3ERVA 4OEMA 4BSQA 3QJ3A 6PADA 1DKIA 4P6GA 5KO3A 1PPDA 4IP3A 1VSNA 2YJ8A 2DZYA 3IHPA 3I06A 4XUIA 2HHNA 1CTEA 1GMYA 3N3KA 1CQDA 1ATKA 2R9MA 1DF0A 4YYRA 2GHUA 4Q8HA 5CVMA 1ZIVA 5EF4A 4RKXA 1M6DA 2FQ9A 2F1GA 3C0RA 2NQGA 1KFXL 5K16A 4FIPA 2DCCA 3BOWA 2G8EA 4I05A 4QRXA 3PRPA 4CDCB 1Y4HA 1QOLA 3BBAA 3O0UA 4BOQA 3I3TA 2XU4A 1NQCA 3TMPA 4D8BA 1U9VA 1CSBB 2NQDB 1PPPA 1YZBA 2JQGR 2BDLA 2AUXA
chains in the Genus database with same CATH topology
3MHHA 2G8JA 3H6SA 4N4ZA 4Q8GA 5JA7A 2BSZA 3KKUA 1ICFA 1KFUL 2Y6EA 3CH2X 1SP4B 4P6EA 2P7UA 3KFQA 1ME3A 1A6RA 1TU6A 2XU3A 3P5UA 3BC3A 4N79A 3P5VA 3H8CA 4W4UA 1FH0A 4WA6A 4BQVA 3H89A 3NHEA 5F02A 2FO5A 4PI3A 4W5CA 1W4TA 4W5BA 4NV8A 2AYNA 1DEUA 3WXGA 1KXRA 4QH6A 2HH5A 1AU3A 3BWKA 2C0YA 4MZOA 1EF7A 2AS8A 1TLOA 1YK7A 2AU1A 2IPPB 4N8WA 4X6HA 3IUTA 2CIOA 2OZ2A 4YVAA 1U9XA 4QBBA 3TNXA 2G7YA 4QRGA 4GUZA 2NQAA 2FYEA 4CDEB 2R6NA 4BS5A 2FUDA 1QDQA 3KSEA 3WXEA 2VHFA 2E03A 1EWMA 1PPNA 3HHAA 1F29A 2E00A 1AYUA 3BCNA 1VJVA 2DCAA 1S4VA 2PBHA 4B55A 1YK8A 1K3BB 1CVZA 4G54A 4HWYA 1CPJA 2CB5A 2E01A 3OVXA 2Y5BA 4BS6A 1YALA 2R9OA 2OULA 3IV2A 4MZSA 2FRAA 1NLJA 5A24A 1BQIA 3RVVA 3K24A 3V6CA 2R9FA 3HWNA 1AYWA 1AU4A 1CJLA 1W6FA 2B1MA 3BPFA 2AVWA 4FK5A 1BY8A 2ARYA 2FT2A 3N4CA 5CVOB 1PXVA 2OP3A 4DMYA 2DC7A 2FRQA 1CV8A 2WBFX 4FJCA 3USVA 2DC8A 1AECA 3RVWA 4YYUA 2ACTA 1POPA 3OF8A 3LTWA 3B79A 2XU1A 3OVZA 1U9WA 4YYSA 3N3GA 3QSDA 3S3QA 1QMYA 4YYWA 3PW3A 4RY2A 4AXMA 4NV7A 1O0EA 1GCBA 4CZWA 3CBJA 4KLBA 2PREA 4CDDB 2YJ9A 4K7CA 4OELA 4YYQA 1HUCB 3KW9A 1GX3A 7PCKA 4XR7A 3LFYA 2VHSA 1JQPA 4X6JA 1CS8A 4PADA 9PAPA 2AIMA 3MTNA 1AU2A 3PBHA 4PP2E 2XU5A 2FTDA 1ZCMA 3P5WA 1MHWA 1THEA 2NQIA 2YJ2A 3KX1A 2IBIA 1W5RA 1EWOA 2AUZA 2O6XA 4YYVA 3IOQA 4I04A 1PIPA 2H7JA 1KHQA 3KWBX 3KWZA 3QT4A 1NPZA 2PNSA 3O1GA 2HXZA 2YJBA 3PDFA 1NL6A 2DCBA 3K9MA 4CDFB 2R9CA 1Y08A 1PE6A 3MHSA 3ZUAA 4BPVA 3MORA 1F2BA 2ATOA 1KHPA 1MIRA 3HHIA 1SNKA 2VFCA 5CHVA 3D6SA 3H8BA 2YJCA 5EGWA 4YV8A 1Q6KA 2BDZA 1MEMA 3C9EA 3F75A 1X9YA 2GFOA 1NB5A 3IMAA 2G6DA 5CVNB 4X6IA 1EWPA 5J94A 1MDWA 5PADA 3DF0A 2HD5A 2P86A 1GECE 2E02A 5FPWA 3CH3X 1YVBA 4DMXA 2DC6A 1AU0A 1MEGA 1PBHA 4MSXA 1TL9A 3HD3A 3P5XA 3RVXA 1PADA 1YT7A 1E2TA 3H7DA 3OF9A 2R9NA 1QXPA 1STFE 1U9QX 5JH3A 1IWDA 3D9WA 1AYVA 4QRVA 3WXFA 1BGOA 8PCHA 4ZUXU 1GLOA 4AXLA 3V6EA 4I07A 3LXSA 3AI8A 2B1NA 1EWLA 4PP1A 3GCBA 1ITOA 1PCIA 2JQFR 2DJFB 2P0RA 2PADA 3CBKA 3OISA 1F2CA 2DC9A 4BGFA 2AYOA 2F7DA 3S3RA 1BP4A 2DJGB 1F2AA 5CHTA 2DZZA 3U8EA 3M99A 1NB3A 1U5IA 4C5PA 3IEJA 1AIMA 1CB5A 1ME4A 1MS6A 1XKGA 3E1ZB 3PNRA 3K8UA 1PPOA 3BPMA 2DCDA 3F5VA 3ERVA 4OEMA 4BSQA 3QJ3A 6PADA 4P6GA 1PPDA 1VSNA 2YJ8A 2DZYA 3IHPA 3I06A 4XUIA 2HHNA 1CTEA 1GMYA 3N3KA 1CQDA 1ATKA 2R9MA 1DF0A 4YYRA 2VFBA 2GHUA 4Q8HA 5CVMA 1ZIVA 5EF4A 1M6DA 2FQ9A 2F1GA 2NQGA 1KFXL 5K16A 4FIPA 2DCCA 3BOWA 2G8EA 4I05A 4QRXA 4CDCB 1Y4HA 1QOLA 3O0UA 3I3TA 2XU4A 1NQCA 1U9VA 1CSBB 2NQDB 1PPPA 2JQGR 2BDLA 2AUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  2G8J A;  3H6S A;  4N4Z A;  4Q8G A;  5JA7 A;  3KKU A;  1ICF A;  1KFU L;  2Y6E A;  3CH2 X;  1SP4 B;  4P6E A;  2P7U A;  3KFQ A;  1ME3 A;  1A6R A;  1TU6 A;  2XU3 A;  3P5U A;  3BC3 A;  4N79 A;  3P5V A;  3H8C A;  4W4U A;  1FH0 A;  4WA6 A;  4BQV A;  3H89 A;  3NHE A;  5F02 A;  2FO5 A;  4PI3 A;  4W5C A;  4W5B A;  2AYN A;  1DEU A;  3WXG A;  1KXR A;  4QH6 A;  2HH5 A;  1AU3 A;  3BWK A;  2C0Y A;  4MZO A;  1EF7 A;  2AS8 A;  1TLO A;  1YK7 A;  2AU1 A;  2IPP B;  4N8W A;  4X6H A;  3IUT A;  2CIO A;  2OZ2 A;  4YVA A;  1U9X A;  4QBB A;  3TNX A;  2G7Y A;  4QRG A;  2NQA A;  2FYE A;  4CDE B;  2R6N A;  4BS5 A;  2FUD A;  1QDQ A;  3KSE A;  3WXE A;  2VHF A;  2E03 A;  1EWM A;  1PPN A;  3HHA A;  1F29 A;  2E00 A;  1AYU A;  3BCN A;  1VJV A;  2DCA A;  1S4V A;  2PBH A;  1YK8 A;  1K3B B;  1CVZ A;  4G54 A;  4HWY A;  1CPJ A;  2CB5 A;  2E01 A;  3OVX A;  2Y5B A;  4BS6 A;  1YAL A;  2R9O A;  2OUL A;  3IV2 A;  4MZS A;  2FRA A;  1NLJ A;  5A24 A;  1BQI A;  3RVV A;  3K24 A;  3V6C A;  2R9F A;  3HWN A;  1AYW A;  1AU4 A;  1CJL A;  2B1M A;  3BPF A;  2AVW A;  4FK5 A;  1BY8 A;  2ARY A;  2FT2 A;  3N4C A;  5CVO B;  1PXV A;  2OP3 A;  4DMY A;  2DC7 A;  2FRQ A;  1CV8 A;  2WBF X;  4FJC A;  3USV A;  2DC8 A;  1AEC A;  3RVW A;  4YYU A;  2ACT A;  1POP A;  3OF8 A;  3B79 A;  2XU1 A;  3OVZ A;  1U9W A;  4YYS A;  3N3G A;  3QSD A;  3S3Q A;  1QMY A;  4YYW A;  3PW3 A;  4RY2 A;  4AXM A;  1O0E A;  1GCB A;  4CZW A;  3CBJ A;  4KLB A;  2PRE A;  4CDD B;  2YJ9 A;  4K7C A;  4OEL A;  4YYQ A;  1HUC B;  3KW9 A;  7PCK A;  4XR7 A;  3LFY A;  2VHS A;  1JQP A;  4X6J A;  1CS8 A;  4PAD A;  9PAP A;  2AIM A;  3MTN A;  1AU2 A;  3PBH A;  4PP2 E;  2XU5 A;  2FTD A;  1ZCM A;  3P5W A;  1MHW A;  1THE A;  2NQI A;  2YJ2 A;  3KX1 A;  2IBI A;  1EWO A;  2AUZ A;  2O6X A;  4YYV A;  3IOQ A;  4I04 A;  1PIP A;  2H7J A;  1KHQ A;  3KWB X;  3KWZ A;  3QT4 A;  1NPZ A;  2PNS A;  3O1G A;  2HXZ A;  2YJB A;  3PDF A;  1NL6 A;  2DCB A;  3K9M A;  4CDF B;  2R9C A;  1Y08 A;  1PE6 A;  3MHS A;  3ZUA A;  4BPV A;  3MOR A;  1F2B A;  2ATO A;  1KHP A;  1MIR A;  3HHI A;  1SNK A;  5CHV A;  3D6S A;  3H8B A;  2YJC A;  5EGW A;  4YV8 A;  1Q6K A;  2BDZ A;  1MEM A;  3C9E A;  3F75 A;  1X9Y A;  2GFO A;  1NB5 A;  3IMA A;  2G6D A;  5CVN B;  4X6I A;  1EWP A;  5J94 A;  1MDW A;  5PAD A;  3DF0 A;  2HD5 A;  2P86 A;  1GEC E;  2E02 A;  5FPW A;  3CH3 X;  1YVB A;  4DMX A;  2DC6 A;  1AU0 A;  1MEG A;  1PBH A;  4MSX A;  1TL9 A;  3HD3 A;  3P5X A;  3RVX A;  1PAD A;  1YT7 A;  3H7D A;  3OF9 A;  2R9N A;  1QXP A;  1STF E;  1U9Q X;  5JH3 A;  1IWD A;  1AYV A;  4QRV A;  3WXF A;  1BGO A;  8PCH A;  4ZUX U;  1GLO A;  4AXL A;  3V6E A;  4I07 A;  3LXS A;  3AI8 A;  2B1N A;  1EWL A;  4PP1 A;  3GCB A;  1ITO A;  1PCI A;  2JQF R;  2DJF B;  2P0R A;  2PAD A;  3CBK A;  3OIS A;  1F2C A;  2DC9 A;  2AYO A;  2F7D A;  3S3R A;  1BP4 A;  2DJG B;  1F2A A;  5CHT A;  2DZZ A;  3U8E A;  3M99 A;  1NB3 A;  1U5I A;  3IEJ A;  1AIM A;  1CB5 A;  1ME4 A;  1MS6 A;  1XKG A;  3E1Z B;  3PNR A;  3K8U A;  1PPO A;  3BPM A;  2DCD A;  3F5V A;  3ERV A;  4OEM A;  4BSQ A;  3QJ3 A;  6PAD A;  4P6G A;  1PPD A;  1VSN A;  2YJ8 A;  2DZY A;  3IHP A;  3I06 A;  4XUI A;  2HHN A;  1CTE A;  1GMY A;  3N3K A;  1CQD A;  1ATK A;  2R9M A;  1DF0 A;  4YYR A;  2GHU A;  4Q8H A;  5CVM A;  1ZIV A;  5EF4 A;  1M6D A;  2FQ9 A;  2F1G A;  2NQG A;  1KFX L;  5K16 A;  4FIP A;  2DCC A;  3BOW A;  2G8E A;  4I05 A;  4QRX A;  4CDC B;  1Y4H A;  1QOL A;  3O0U A;  3I3T A;  2XU4 A;  1NQC A;  1U9V A;  1CSB B;  2NQD B;  1PPP A;  2JQG R;  2BDL A;  2AUX A; 
#chains in the Genus database with same CATH topology
 3MHH A;  5JZE A;  2G8J A;  2AGA A;  3H6S A;  4N4Z A;  4Q8G A;  5JA7 A;  3KKU A;  1ICF A;  1KFU L;  2Y6E A;  3CH2 X;  1SP4 B;  4P6E A;  2P7U A;  2BU3 A;  3KFQ A;  1ME3 A;  1A6R A;  1TU6 A;  2XU3 A;  3P5U A;  4D8E A;  3BC3 A;  4N79 A;  3P5V A;  4RNA A;  3H8C A;  3B21 A;  4W4U A;  1FH0 A;  4WA6 A;  4BQV A;  3H89 A;  3NHE A;  5F02 A;  2FO5 A;  4PI3 A;  3PRM A;  4W5C A;  4W5B A;  2AYN A;  1DEU A;  3WXG A;  1KXR A;  4QH6 A;  2HH5 A;  1AU3 A;  3BWK A;  2C0Y A;  4MZO A;  1EF7 A;  2AS8 A;  1TLO A;  1YK7 A;  2AU1 A;  2IPP B;  4N8W A;  4X6H A;  3IUT A;  2CIO A;  4GUA A;  2OZ2 A;  4YVA A;  1U9X A;  3W30 A;  4QBB A;  3TNX A;  5EZQ A;  2G7Y A;  4QRG A;  2NQA A;  2FYE A;  2FE8 A;  4CDE B;  2R6N A;  4BS5 A;  1PVJ A;  4OW0 A;  3W31 A;  3MP2 A;  3MJ5 A;  2FUD A;  1QDQ A;  3KSE A;  3WXE A;  2VHF A;  2E03 A;  3E9S A;  4XZX A;  1EWM A;  3TRK A;  1PPN A;  3HHA A;  1F29 A;  2E00 A;  1AYU A;  3BCN A;  2JRI A;  1VJV A;  2PBH A;  2DCA A;  1S4V A;  2HWK A;  2BTW B;  1YK8 A;  1K3B B;  1CVZ A;  4G54 A;  4BOS A;  4HWY A;  1CPJ A;  2CB5 A;  2E01 A;  3OVX A;  2Y5B A;  3PHW A;  4BS6 A;  4WUR A;  1YAL A;  2R9O A;  2OUL A;  3IV2 A;  5E6J A;  4MZS A;  2FRA A;  1NLJ A;  5A24 A;  3PSE A;  1BQI A;  3RVV A;  4RF1 A;  3K24 A;  3V6C A;  2R9F A;  3HWN A;  1AYW A;  1AU4 A;  1CJL A;  2B1M A;  3BPF A;  2AVW A;  4FK5 A;  1BY8 A;  2ARY A;  2FT2 A;  3N4C A;  5CVO B;  4MI7 A;  1PXV A;  2OP3 A;  4DMY A;  2DC7 A;  2FRQ A;  1CV8 A;  2BTW A;  2WBF X;  4FJC A;  3USV A;  2DC8 A;  1AEC A;  3RVW A;  4YYU A;  2ACT A;  1POP A;  3OF8 A;  3B79 A;  2XU1 A;  3OVZ A;  1U9W A;  4OVZ B;  3N3G A;  3QSD A;  3S3Q A;  4YYS A;  1QMY A;  4YYW A;  3PW3 A;  4RY2 A;  4AXM A;  1O0E A;  4BOU A;  1GCB A;  4CZW A;  3CBJ A;  4KLB A;  2DOS A;  2Z84 A;  2PRE A;  4CDD B;  2YJ9 A;  4K7C A;  4OEL A;  4YYQ A;  1HUC B;  3KW9 A;  7PCK A;  4XR7 A;  3LFY A;  2VHS A;  1JQP A;  4X6J A;  3RNV A;  1CS8 A;  4PAD A;  9PAP A;  2AIM A;  3MTN A;  1AU2 A;  4P16 A;  3PBH A;  4PP2 E;  4IUM A;  2XU5 A;  2FTD A;  1ZCM A;  3P5W A;  3ZNH A;  1MHW A;  1THE A;  2NQI A;  2YJ2 A;  3KX1 A;  2IBI A;  2JTC A;  4OVZ A;  1EWO A;  4RF0 A;  4A5U A;  4ZTB A;  2AUZ A;  2O6X A;  3PHX A;  4R3D A;  3IOQ A;  1PIP A;  4I04 A;  4YYV A;  2H7J A;  1KHQ A;  3KWB X;  3KWZ A;  3QT4 A;  1NPZ A;  2PNS A;  3MTV A;  3O1G A;  2HXZ A;  2YJB A;  3PDF A;  1NL6 A;  2DCB A;  3K9M A;  4CDF B;  2R9C A;  1UKF A;  1Y08 A;  1PE6 A;  3MHS A;  3ZUA A;  4BPV A;  3MOR A;  1F2B A;  2ATO A;  1KHP A;  1MIR A;  3HHI A;  1SNK A;  5CHV A;  3D6S A;  3H8B A;  3BY4 A;  4REZ A;  2YJC A;  5EGW A;  4YV8 A;  1Q6K A;  2BDZ A;  1MEM A;  3C9E A;  3F75 A;  1X9Y A;  2GFO A;  4MM3 B;  1NB5 A;  3IMA A;  2G6D A;  5CVN B;  4X6I A;  1EWP A;  3OQC A;  5J94 A;  1MDW A;  4BOZ A;  5PAD A;  2J7Q A;  3DF0 A;  2HD5 A;  2P86 A;  1GEC E;  2E02 A;  5FPW A;  3CH3 X;  1YVB A;  4DMX A;  2DC6 A;  4D8I A;  1AU0 A;  1MEG A;  1PBH A;  4MSX A;  1TL9 A;  3HD3 A;  3P5X A;  3RVX A;  1PAD A;  1YT7 A;  3IFU A;  3H7D A;  4M0W A;  3OF9 A;  2R9N A;  1QXP A;  1STF E;  1U9Q X;  3BB7 A;  5JH3 A;  1IWD A;  1AYV A;  4QRV A;  3WXF A;  1BGO A;  8PCH A;  4ZUX U;  1GLO A;  4AXL A;  2UZJ A;  3V6E A;  4I07 A;  3LXS A;  4PT5 A;  3AI8 A;  2B1N A;  1EWL A;  4PP1 A;  3GCB A;  1ITO A;  3O65 A;  1PCI A;  2JQF R;  2DJF B;  2P0R A;  2PAD A;  3CBK A;  3OIS A;  1F2C A;  2DC9 A;  2AYO A;  2J7Q C;  2F7D A;  3S3R A;  5EZS A;  1BP4 A;  2DJG B;  1F2A A;  5CHT A;  2DZZ A;  3U8E A;  3M99 A;  1NB3 A;  4BOP A;  1U5I A;  3PHU A;  3IEJ A;  4HXD B;  3PT2 A;  1AIM A;  1CB5 A;  1ME4 A;  1MS6 A;  1XKG A;  3E1Z B;  3PNR A;  3K8U A;  1PPO A;  3BPM A;  2DCD A;  3F5V A;  3ERV A;  4OEM A;  4BSQ A;  3QJ3 A;  6PAD A;  1DKI A;  4P6G A;  5KO3 A;  1PPD A;  4IP3 A;  1VSN A;  2YJ8 A;  2DZY A;  3IHP A;  3I06 A;  4XUI A;  2HHN A;  1CTE A;  1GMY A;  3N3K A;  1CQD A;  1ATK A;  2R9M A;  1DF0 A;  4YYR A;  2GHU A;  4Q8H A;  5CVM A;  1ZIV A;  5EF4 A;  4RKX A;  1M6D A;  2FQ9 A;  2F1G A;  3C0R A;  2NQG A;  1KFX L;  5K16 A;  4FIP A;  2DCC A;  3BOW A;  2G8E A;  4I05 A;  4QRX A;  3PRP A;  4CDC B;  1Y4H A;  1QOL A;  3BBA A;  3O0U A;  4BOQ A;  3I3T A;  2XU4 A;  1NQC A;  3TMP A;  4D8B A;  1U9V A;  1CSB B;  2NQD B;  1PPP A;  1YZB A;  2JQG R;  2BDL A;  2AUX A; 
#chains in the Genus database with same CATH homology
 3MHH A;  2G8J A;  3H6S A;  4N4Z A;  4Q8G A;  5JA7 A;  2BSZ A;  3KKU A;  1ICF A;  1KFU L;  2Y6E A;  3CH2 X;  1SP4 B;  4P6E A;  2P7U A;  3KFQ A;  1ME3 A;  1A6R A;  1TU6 A;  2XU3 A;  3P5U A;  3BC3 A;  4N79 A;  3P5V A;  3H8C A;  4W4U A;  1FH0 A;  4WA6 A;  4BQV A;  3H89 A;  3NHE A;  5F02 A;  2FO5 A;  4PI3 A;  4W5C A;  1W4T A;  4W5B A;  4NV8 A;  2AYN A;  1DEU A;  3WXG A;  1KXR A;  4QH6 A;  2HH5 A;  1AU3 A;  3BWK A;  2C0Y A;  4MZO A;  1EF7 A;  2AS8 A;  1TLO A;  1YK7 A;  2AU1 A;  2IPP B;  4N8W A;  4X6H A;  3IUT A;  2CIO A;  2OZ2 A;  4YVA A;  1U9X A;  4QBB A;  3TNX A;  2G7Y A;  4QRG A;  4GUZ A;  2NQA A;  2FYE A;  4CDE B;  2R6N A;  4BS5 A;  2FUD A;  1QDQ A;  3KSE A;  3WXE A;  2VHF A;  2E03 A;  1EWM A;  1PPN A;  3HHA A;  1F29 A;  2E00 A;  1AYU A;  3BCN A;  1VJV A;  2DCA A;  1S4V A;  2PBH A;  4B55 A;  1YK8 A;  1K3B B;  1CVZ A;  4G54 A;  4HWY A;  1CPJ A;  2CB5 A;  2E01 A;  3OVX A;  2Y5B A;  4BS6 A;  1YAL A;  2R9O A;  2OUL A;  3IV2 A;  4MZS A;  2FRA A;  1NLJ A;  5A24 A;  1BQI A;  3RVV A;  3K24 A;  3V6C A;  2R9F A;  3HWN A;  1AYW A;  1AU4 A;  1CJL A;  1W6F A;  2B1M A;  3BPF A;  2AVW A;  4FK5 A;  1BY8 A;  2ARY A;  2FT2 A;  3N4C A;  5CVO B;  1PXV A;  2OP3 A;  4DMY A;  2DC7 A;  2FRQ A;  1CV8 A;  2WBF X;  4FJC A;  3USV A;  2DC8 A;  1AEC A;  3RVW A;  4YYU A;  2ACT A;  1POP A;  3OF8 A;  3LTW A;  3B79 A;  2XU1 A;  3OVZ A;  1U9W A;  4YYS A;  3N3G A;  3QSD A;  3S3Q A;  1QMY A;  4YYW A;  3PW3 A;  4RY2 A;  4AXM A;  4NV7 A;  1O0E A;  1GCB A;  4CZW A;  3CBJ A;  4KLB A;  2PRE A;  4CDD B;  2YJ9 A;  4K7C A;  4OEL A;  4YYQ A;  1HUC B;  3KW9 A;  1GX3 A;  7PCK A;  4XR7 A;  3LFY A;  2VHS A;  1JQP A;  4X6J A;  1CS8 A;  4PAD A;  9PAP A;  2AIM A;  3MTN A;  1AU2 A;  3PBH A;  4PP2 E;  2XU5 A;  2FTD A;  1ZCM A;  3P5W A;  1MHW A;  1THE A;  2NQI A;  2YJ2 A;  3KX1 A;  2IBI A;  1W5R A;  1EWO A;  2AUZ A;  2O6X A;  4YYV A;  3IOQ A;  4I04 A;  1PIP A;  2H7J A;  1KHQ A;  3KWB X;  3KWZ A;  3QT4 A;  1NPZ A;  2PNS A;  3O1G A;  2HXZ A;  2YJB A;  3PDF A;  1NL6 A;  2DCB A;  3K9M A;  4CDF B;  2R9C A;  1Y08 A;  1PE6 A;  3MHS A;  3ZUA A;  4BPV A;  3MOR A;  1F2B A;  2ATO A;  1KHP A;  1MIR A;  3HHI A;  1SNK A;  2VFC A;  5CHV A;  3D6S A;  3H8B A;  2YJC A;  5EGW A;  4YV8 A;  1Q6K A;  2BDZ A;  1MEM A;  3C9E A;  3F75 A;  1X9Y A;  2GFO A;  1NB5 A;  3IMA A;  2G6D A;  5CVN B;  4X6I A;  1EWP A;  5J94 A;  1MDW A;  5PAD A;  3DF0 A;  2HD5 A;  2P86 A;  1GEC E;  2E02 A;  5FPW A;  3CH3 X;  1YVB A;  4DMX A;  2DC6 A;  1AU0 A;  1MEG A;  1PBH A;  4MSX A;  1TL9 A;  3HD3 A;  3P5X A;  3RVX A;  1PAD A;  1YT7 A;  1E2T A;  3H7D A;  3OF9 A;  2R9N A;  1QXP A;  1STF E;  1U9Q X;  5JH3 A;  1IWD A;  3D9W A;  1AYV A;  4QRV A;  3WXF A;  1BGO A;  8PCH A;  4ZUX U;  1GLO A;  4AXL A;  3V6E A;  4I07 A;  3LXS A;  3AI8 A;  2B1N A;  1EWL A;  4PP1 A;  3GCB A;  1ITO A;  1PCI A;  2JQF R;  2DJF B;  2P0R A;  2PAD A;  3CBK A;  3OIS A;  1F2C A;  2DC9 A;  4BGF A;  2AYO A;  2F7D A;  3S3R A;  1BP4 A;  2DJG B;  1F2A A;  5CHT A;  2DZZ A;  3U8E A;  3M99 A;  1NB3 A;  1U5I A;  4C5P A;  3IEJ A;  1AIM A;  1CB5 A;  1ME4 A;  1MS6 A;  1XKG A;  3E1Z B;  3PNR A;  3K8U A;  1PPO A;  3BPM A;  2DCD A;  3F5V A;  3ERV A;  4OEM A;  4BSQ A;  3QJ3 A;  6PAD A;  4P6G A;  1PPD A;  1VSN A;  2YJ8 A;  2DZY A;  3IHP A;  3I06 A;  4XUI A;  2HHN A;  1CTE A;  1GMY A;  3N3K A;  1CQD A;  1ATK A;  2R9M A;  1DF0 A;  4YYR A;  2VFB A;  2GHU A;  4Q8H A;  5CVM A;  1ZIV A;  5EF4 A;  1M6D A;  2FQ9 A;  2F1G A;  2NQG A;  1KFX L;  5K16 A;  4FIP A;  2DCC A;  3BOW A;  2G8E A;  4I05 A;  4QRX A;  4CDC B;  1Y4H A;  1QOL A;  3O0U A;  3I3T A;  2XU4 A;  1NQC A;  1U9V A;  1CSB B;  2NQD B;  1PPP A;  2JQG R;  2BDL A;  2AUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...