3MHHA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
473
structure length
433
Chain Sequence
b'AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTTSTNRQTGFIYLLTCAWKINSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQGECNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
total genus 127
structure length 433
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhhA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhhA02
1NB3A 2IDAA 2DCAA 5I3LA 3KV5A 3IUTA 3L11A 1X9YA 2YJ8A 2JRJA 4A0CD 5H1UA 3ZPVE 2M3HA 4QBBA 3BCNA 1AIMA 2AUZA 2DZYA 4ZDTA 4BPVA 2VNFA 2KWNA 1KHQA 3EB5A 3N9OA 2AU1A 3HWNA 1CPJA 2XU3A 5CVNB 7PCKA 3O33A 3C9EA 3IOQA 2ECVA 2LGGA 4CZWA 4TKPB 2LDRA 1SP4B 4GNFA 3P5XA 3BWKA 3QSDA 1GMYA 5B79A 1WE9A 4IC2A 1EWMA 3K9MA 2E6SA 3WXGA 2KWOA 1THEA 4MSXA 4W5CA 5H1TA 1KFXL 2AIMA 3O0UA 3D6SA 1QMYA 4DMXA 2VJEA 4HWYA 2AN6A 2Y6EA 4PP2E 2P0RA 2ZETC 5FERA 1NL6A 3KFQA 1EWPA 3HCTA 1MHWA 4N79A 5CVMA 5DKAA 2K17A 4R7EA 2FO5A 1U9XA 1MM3A 2EODA 1MIRA 5B75A 1Z60A 3S3QA 3N9QA 5LCWB 8PCHA 1M6DA 4BQVA 1U9WA 1Y08A 2LXHC 1TL9A 2YUCA 3C5KA 3HCSA 4GNGA 6PADA 1EF7A 3I3TA 1IWDA 2KU3A 5DINA 1VFYA 5TDRA 5CHTA 4YYVA 2HDPA 2Y43A 2ECGA 2M1RA 2JMIA 5G04B 1CVZA 3PDFA 3H8CA 1S4VA 3KQIA 5D1MB 3N4CA 1U9QX 4MVTA 5K16A 5FB0A 2VJFB 4AXLA 3HHAA 2MNZA 2LGVA 2FSAA 1X4UA 2GFOA 4YV8A 4B86C 1NB5A 2K16A 2PNSA 1WEEA 5KH7A 2G43A 3K8UA 2ACTA 4XR7A 1JM7B 3RPGC 2MIQA 3ZVZB 4N4FA 4W5BA 2FUUA 3V43A 1NLJA 2DJGB 3P5VA 1SNKA 4X6HA 4LLBA 1QXPA 4LK9A 1NQCA 3HCUA 2F1GA 2YHNA 2FT2A 4QRXA 5FEYA 3HHIA 2LQ6A 2E00A 3ZUAA 3KX1A 4CCGX 1F29A 2AYOA 1ZBDB 2G45A 1TU6A 2Y1MA 1CTEA 2DC6A 1F2AA 2CKLA 1U9VA 3IEJA 2E01A 2IPPB 1WEOA 2H0DA 3DF0A 5J3XA 1T1HA 1CSBB 1WEWA 2DJFB 3SOWA 2F42A 1AU3A 4V3LC 2WBFX 4S3OB 1WILA 4P6EA 4FO9A 1YK7A 4A4CA 3IHPA 4QH6A 4V3KC 2YQMA 4Q6FA 3LXSA 5LKXA 2AYNA 5C13A 4MZSA 3SOUA 4FIPA 5AIUA 2YJBA 4YYSA 2EA6A 3C6WA 3BC3A 4GB0A 2NQAA 1VD4A 2Y1NA 2VP7A 1CS8A 2MA6A 5B77A 2VJEB 1HYJA 1EWOA 1K3BB 3KWBX 2QIZA 4I07A 3NG2A 1JQPA 3TNXA 2VPEA 2C2VS 1Z6UA 4I7CA 1N87A 2FQ9A 5D1LB 4X3GA 3F5VA 1WEPA 5B8DA 2OZ2A 2QICA 4YABA 2BAYA 3P5WA 3ZVYA 1WEQA 2PADA 1ME3A 2DCCA 1WEMA 1X4IA 2PREA 3ZPV1 5KH9A 4MZOA 4I04A 2AS8A 2MT5A 2P7UA 1Z2QA 3PNRA 3PW3A 3O34A 5G05B 2OULA 2E6RA 3N9MA 2JMDA 2YU4A 2CIOA 4GNDA 1PXVA 2C0YA 5FPWA 4P6GA 5JH3A 2KYUA 4YBMA 4RY2A 2K1JA 4UI9B 2HH5A 1CV8A 1E4UA 3OF8A 3QJ3A 3AI8A 1HYIA 2E02A 2PUYA 3DPLR 4YC9A 3O36A 4AUQB 2L43A 3IMAA 4PTBA 4QF3A 2AVWA 2RI7A 2HYED 2HD5A 2JQGR 2BDLA 1AU2A 1XWHA 4LADB 1WEUA 1PADA 1ITOA 1YALA 5H1VA 2I50A 1DF0A 3SHBA 5A24A 4XI1A 1WEVA 4PP1A 5JG6A 4AYCA 3PHDA 3S3RA 2VPDA 2XU5A 1WGMA 4BS5A 1QOLA 2KIZA 1GLOA 4YBSA 4KLBA 2G7YA 4FK5A 2OP3A 2UZGA 3KWZA 3CBJA 4UP0A 4Q8HA 3O7AA 2FYEA 2KFTA 3MTNA 2ECIA 1A6RA 1HUCB 2BDZA 1F2CA 2XB1A 3VK6A 3N3KA 2YSJA 2MD7B 5G0FA 3O1GA 3GCBA 4ZUXU 2Y5BA 3L1XA 1NPZA 4AXMA 2VPBA 3KW9A 1O0EA 4YYWA 1AU4A 2AUXA 4OEMA 2YW8A 3P5UA 2CT2A 1STFE 2FTDA 2YSMA 3O37A 2L0BA 1BORA 2CSYA 3T7LA 2QJ0A 4AVXA 2YURA 5KH3A 1V87A 2NAAA 2YHOA 3V6EA 3BOWA 2L5UA 4A49A 4X6JA 3HTKC 2KE1A 2B1NA 2R9FA 2C2LA 2DX8A 1PE6A 5C11A 4OELA 2K4DA 4L58A 3B79A 3ZYQA 2DCBA 1PPOA 5EF4A 2R9CA 3MHHA 2YYRA 2D8SA 4IC3A 4YAXA 2XEUA 3N9LA 5B76A 2F6NA 1YK8A 2HXZA 4N4ZA 5JA7A 3GV4A 3H6SA 2DC7A 2EGPA 2XU1A 5LKZA 2G8JA 1GECE 3F75A 3O35A 1F62A 3U5OA 2NQDB 2DC8A 2JQFR 1POPA 4CDEB 1DVPA 2LXPC 3H89A 1KHPA 2DCDA 1ZCMA 1WFKA 1PPPA 3RVWA 2M85A 4PI3A 1MEMA 1JM7A 2H7JA 5D1KB 2LGKA 3PUQA 1MS6A 2NQGA 1MEGA 4G54A 2OXQC 5J94A 1YT7A 4LKAA 2NQIA 3I2DA 5PADA 2L75A 1VSNA 3RVVA 1KFUL 2XU4A 2DZZA 3WXFA 4UP5A 2FRAA 4BHWA 3KNVA 3OISA 2KWJA 4R8PK 3DQVR 4CDDB 4AYCB 2ARYA 5LKUA 1PBHA 1TLOA 3BPMA 3N9PA 3RPGB 3L1ZB 4B7YC 4BSQA 2LV9A 2YJ9A 1IYMA 3ERVA 4YYRA 4CDCB 3N9NA 2VHFA 2G6DA 1PCIA 2KGGA 5TRBA 1CJLA 1WESA 1YVBA 1PIPA 3BPFA 4ZQLA 1G25A 3WXEA 3RVXA 1BGOA 3E1ZB 3OVZA 1F2BA 1VJVA 4P5OB 4PPEA 1CQDA 1AYUA 2GHUA 4YYQA 2ECNA 4GNEA 4S3OC 2CB5A 2E03A 4X6IA 2ECTA 3T6RA 4A4BA 3OF9A 1ATKA 3O70A 1ZIVA 2PNXA 2PBHA 3U8EA 4YVAA 2JMJA 1EWLA 3GL6A 3MHSA 3KKUA 2YREA 3LQIA 4WZ0A 1AYWA 4C9ZA 3EB6A 3QZVA 3PURA 2DC9A 3CBKA 2VHSA 3LQJA 3V6CA 3N3GA 5CHVA 2MUMA 4WA6A 2YJCA 2CKLB 2RSDA 2MNYA 2H0DB 2M6MA 4I7DA 1PPDA 1BQIA 4CA1A 5B78A 4WZ3B 2KGIA 4YBTA 1ME4A 2FRQA 2ECWA 4N3WA 2IBIA 4I05A 5F02A 2KWKA 2FUIA 1CB5A 3QT4A 4YATA 3M63A 2R9OA 1KXRA 2CSZA 2MD8C 1RMDA 1U5IA 4Q8GA 4AP4A 4F52B 5H9MA 2MA5A 2O6XA 1WENA 4QRVA 2LRIC 1XKGA 2R9NA 5CVOB 2YQLA 2YJ2A 2P86A 3MORA 3PBHA 1JOCA 2B1MA 1BP4A 4K7CA 4QF2A 1DEUA 3U5PA 3SOXA 1FBVA 5EYAF 5LKTA 2F6JA 2R9MA 4N8WA 3KV6A 3CH3X 5TABA 1BY8A 3K24A 4PADA 3NHEA 1AYVA 3CH2X 2KREA 4O64A 2LGLA 2KR4A 5TBNA 3H7DA 1VYXA 3ZNIA 1FH0A 1K2FA 2YT5A 1WIMA 3U5NA 4W4UA 3LQHA 4WZ2A 5TDWA 4YYUA 3RTRB 2F7DA 3USVA 1FP0A 3ZTGA 3HD3A 1ICFA 5EGWA 1GCBA 9PAPA 2ECJA 4CDFB 2ATOA 3M99A 4L7XA 2FUDA 4YADA 3IV2A 1MM2A 4R2YA 4XUIA 4BBQA 3LFYA 3OVXA 1U6GB 2VJFA 3U5MA 3LRQA 4I7BA 4DMYA 2G6QA 1Q6KA 3FL2A 2L80A 3KSEA 1AU0A 2R6NA 3M62A 4BS6A 2G8EA 3ASLA 2HHNA 1MDWA 4QRGA 1LDKC 1Y4HA 1QDQA 4FJCA 1PPNA 5AITA 1LDJB 1CHCA 1AECA 3I06A 2LN0A 1X4JA 2VPGA 4NN2A 5FB1A 3H8BA 4LJNA
chains in the Genus database with same CATH superfamily
1NB3A 2IDAA 2DCAA 2P57A 5I3LA 4MM3B 3KV5A 4BOZA 3IUTA 3L11A 1X9YA 2YJ8A 2JRJA 4A0CD 5H1UA 3PHXA 3ZPVE 2M3HA 4QBBA 3B21A 3BBAA 3BCNA 1AIMA 2AUZA 2DZYA 4ZDTA 1PVJA 4BPVA 2VNFA 2KWNA 1KHQA 3EB5A 3N9OA 2AU1A 2EXUA 3HWNA 1CPJA 2XU3A 5CVNB 7PCKA 4BOPA 3O33A 3C9EA 3IOQA 2ECVA 2LGGA 3Q1DA 4CZWA 4TKPB 2LDRA 1SP4B 4GNFA 3P5XA 3JUEA 3BWKA 3QSDA 1GMYA 5B79A 3SUBA 4BOQA 1WE9A 4IC2A 1EWMA 3K9MA 2E6SA 3WXGA 2KWOA 1THEA 4MSXA 4W5CA 5H1TA 1KFXL 2IQJA 2AIMA 3O0UA 3D6SA 2BTWB 1QMYA 3MJ5A 3ZNHA 4PT5A 4DMXA 2FFWA 2VJEA 4HWYA 2AN6A 2Y6EA 2XOYA 4GUAA 4PP2E 2P0RA 2ZETC 3DDTA 5FERA 1NL6A 3KFQA 1EWPA 2CRRA 3HCTA 1MHWA 4N79A 5CVMA 5DKAA 2K17A 4R7EA 2FO5A 2KKYA 1U9XA 1MM3A 2EODA 1MIRA 5B75A 3C0RA 3MP2A 1Z60A 3S3QA 3N9QA 3E9SA 5LCWB 3M7KA 8PCHA 1M6DA 4BQVA 1U9WA 1Y08A 2LXHC 1TL9A 2YUCA 3C5KA 3HCSA 3LVQE 2JM3A 4GNGA 4XZXA 6PADA 1EF7A 2EGMA 1IWDA 3I3TA 2KU3A 5DINA 3DWDA 1VFYA 5TDRA 5CHTA 4YYVA 2HDPA 2Y43A 2ECGA 2M1RA 2JMIA 5G04B 3FANA 1CVZA 3PDFA 3H8CA 1S4VA 3KQIA 5D1MB 3N4CA 1U9QX 4HXDB 4MVTA 5K16A 5FB0A 2VJFB 4AXLA 3HHAA 2MNZA 2LGVA 1MBMA 2FSAA 1X4UA 3FAOA 1YZBA 2GFOA 4YV8A 4B86C 1NB5A 2K16A 2PNSA 1WEEA 5KH7A 2G43A 3K8UA 4M0WA 4BOSA 2ACTA 4XR7A 1JM7B 4D8BA 3RPGC 2MIQA 3ZVZB 4N4FA 4W5BA 2FUUA 3V43A 1NLJA 2DJGB 3P5VA 1SNKA 4X6HA 4LLBA 1QXPA 4LK9A 1NQCA 3HCUA 2F1GA 2YHNA 2FT2A 4QRXA 5FEYA 3HHIA 2LQ6A 2E00A 2RR4A 3ZUAA 3KX1A 4CCGX 1F29A 5K3QA 2AYOA 1ZBDB 2G45A 1TU6A 2Y1MA 1CTEA 2DC6A 1F2AA 2CKLA 1U9VA 2JRIA 3IEJA 2E01A 2IPPB 1WEOA 2H0DA 3DF0A 5J3XA 1T1HA 1CSBB 1WEWA 2YVRA 2DJFB 3SOWA 2F42A 1AU3A 4V3LC 4Z0OA 2WBFX 4S3OB 2BU3A 1WILA 4P6EA 4FO9A 1YK7A 4A4CA 3IHPA 4QH6A 4V3KC 3H7HA 2YQMA 4Q6FA 3LXSA 5LKXA 2AYNA 5C13A 4MZSA 3SOUA 4FIPA 5AIUA 3PSEA 2YJBA 4YYSA 2EA6A 3C6WA 3BC3A 4GB0A 2NQAA 4IUMA 3LVRE 1VD4A 2Y1NA 4D8EA 2VP7A 1CS8A 3FM8C 2MA6A 5B77A 2VJEB 1HYJA 1EWOA 1K3BB 3KWBX 3TRKA 2QIZA 4I07A 3RNVA 5SVIA 3NG2A 1JQPA 3TNXA 4H9DA 2VPEA 2C2VS 1Z6UA 4I7CA 4RF1A 2KKXA 3PRMA 1N87A 2FQ9A 5D1LB 4X3GA 3F5VA 1WEPA 5B8DA 2CSVA 2OZ2A 2QICA 4YABA 2BAYA 3P5WA 3ZVYA 1WEQA 2PADA 1ME3A 2AGAA 2OWAA 2DCCA 1WEMA 1X4IA 2PREA 3ZPV1 5KH9A 4MZOA 4I04A 2AS8A 2FD4A 2MT5A 2P7UA 4F1PA 4OVZA 1Z2QA 3PNRA 3PW3A 3O34A 5G05B 2OULA 2E6RA 3N9MA 2JMDA 2YU4A 2CIOA 4GNDA 1PXVA 2C0YA 4RF0A 5FPWA 4P6GA 5JH3A 2KYUA 4YBMA 4RY2A 2K1JA 4UI9B 2HH5A 1CV8A 1E4UA 3OF8A 3QJ3A 4REZA 3AI8A 1HYIA 2E02A 2PUYA 3DPLR 4YC9A 4BOUA 3O36A 4AUQB 2L43A 3IMAA 4PTBA 4QF3A 4R3DA 4OGCA 2AVWA 2RI7A 2HYED 2HD5A 2JQGR 2BDLA 1AU2A 1XWHA 4LADB 1WEUA 1PADA 1ITOA 1YALA 5H1VA 2I50A 1DF0A 3SHBA 5A24A 4XI1A 1WEVA 4PP1A 3W31A 5JG6A 4AYCA 3PHDA 3S3RA 2VPDA 2XU5A 1WGMA 4BS5A 1QOLA 2KIZA 1GLOA 4YBSA 4KLBA 2G7YA 4FK5A 2OP3A 2UZGA 3KWZA 3CBJA 4UP0A 4Q8HA 3PRPA 3O7AA 2FYEA 4ZTBA 2KFTA 3MTNA 2ECIA 1A6RA 1HUCB 2BDZA 1F2CA 2XB1A 3VK6A 3N3KA 2YSJA 2MD7B 5G0FA 3O1GA 3GCBA 4ZUXU 2D8UA 1DCQA 2Y5BA 3L1XA 1NPZA 1DKIA 2LAUA 2VPBA 4QQ4A 3KW9A 1O0EA 4AXMA 4YYWA 1AU4A 2AUXA 2L7PA 2BTWA 5E6JA 4OEMA 2YW8A 3P5UA 2CT2A 1STFE 2FTDA 3LDYA 2YSMA 3O37A 2L0BA 1BORA 2CONA 2CSYA 3T7LA 2QJ0A 4AVXA 4RKXA 2YURA 5KH3A 1V87A 2NAAA 2YHOA 3O47A 3BOWA 2DJAA 3V6EA 2L5UA 4A49A 4X6JA 3HTKC 2KE1A 2B1NA 3MTVA 2M13A 2C2LA 2DX8A 1PE6A 2R9FA 5C11A 4OELA 2K4DA 4L58A 3B79A 3ZYQA 2DCBA 3T9KA 1PPOA 5EF4A 2R9CA 3MHHA 2YYRA 3MDBC 2D8SA 4IC3A 4YAXA 2B0OE 2XEUA 3N9LA 5B76A 2F6NA 2E61A 1YK8A 2HXZA 4N4ZA 5JA7A 3GV4A 3H6SA 5SVYA 2DC7A 2EGPA 2XU1A 5LKZA 2XOZA 2G8JA 1GECE 3F75A 3O35A 1F62A 3U5OA 2NQDB 2DC8A 2JQFR 1POPA 4CDEB 1DVPA 2LXPC 3H89A 1KHPA 2XP0A 1ZCMA 2DCDA 1WFKA 1PPPA 3RVWA 2M85A 4PI3A 1MEMA 1JM7A 2H7JA 5D1KB 2LGKA 3PUQA 1MS6A 2NQGA 2JUNA 1MEGA 4G54A 2OXQC 5EZQA 5KO3A 5J94A 1YT7A 4LKAA 2NQIA 2UZJA 4RNAA 3LJUX 3I2DA 5PADA 3BY4A 2L75A 2CRWA 1VSNA 3RVVA 1KFUL 2XU4A 2DZZA 3WXFA 4UP5A 2FRAA 4BHWA 2XOCA 4O62A 3KNVA 3OISA 4WURA 2KWJA 4R8PK 3DQVR 4CDDB 4AYCB 2ARYA 5LKUA 1PBHA 1TLOA 3BPMA 3N9PA 3RPGB 3L1ZB 4B7YC 2DOSA 4BSQA 2LV9A 2YJ9A 1IYMA 3ERVA 4YYRA 4CDCB 3N9NA 2VHFA 2G6DA 1PCIA 3PHUA 2KGGA 5TRBA 1CJLA 3PHWA 3IFUA 1WESA 1YVBA 4MI7A 1PIPA 3BPFA 4ZQLA 1G25A 3WXEA 4Z0RA 3RVXA 1BGOA 3E1ZB 3OVZA 1F2BA 1VJVA 4IP3A 4P5OB 4PPEA 1CQDA 1AYUA 2GHUA 4YYQA 2ECNA 4GNEA 4S3OC 2CB5A 2E03A 4P16A 4X6IA 2ECTA 3T6RA 4A4BA 2HWKA 1ATKA 3O70A 1ZIVA 3OF9A 2PNXA 2PBHA 3U8EA 4YVAA 2JMJA 1EWLA 3GL6A 3MHSA 3KKUA 2YREA 3LQIA 4WZ0A 1AYWA 4C9ZA 3EB6A 3QZVA 3TMPA 3PURA 3KDEC 2DC9A 2VHSA 3LQJA 3CBKA 3N3GA 5CHVA 3V6CA 2MUMA 4WA6A 2YJCA 2CKLB 2RSDA 3O65A 2MNYA 2H0DB 2M6MA 4I7DA 1PPDA 2Z84A 1BQIA 2JTCA 4CA1A 5B78A 4WZ3B 2KGIA 4YBTA 1ME4A 2FRQA 2MKEA 2ECWA 4N3WA 2IBIA 4I05A 5F02A 2KWKA 2FUIA 1CB5A 3QT4A 4YATA 3M63A 2R9OA 1KXRA 2CSZA 2DSMA 2MD8C 1RMDA 1U5IA 4Q8GA 4AP4A 4F52B 5H9MA 2J7QA 2MA5A 2O6XA 1WENA 4QRVA 2LRIC 1XKGA 2R9NA 5CVOB 2YQLA 2YJ2A 2P86A 3MORA 3PBHA 1JOCA 2B1MA 1BP4A 4K7CA 4QF2A 1DEUA 3U5PA 3SOXA 2FE8A 1FBVA 5EYAF 5LKTA 2F6JA 2R9MA 3BB7A 4OW0A 4N8WA 3KV6A 3CH3X 5TABA 1BY8A 3PT2A 3K24A 4PADA 5SVIB 3NHEA 1AYVA 3CH2X 2KREA 4O64A 2LGLA 2KR4A 5TBNA 2J7QC 3H7DA 1VYXA 3ZNIA 1FH0A 5EZSA 1K2FA 2YT5A 1WIMA 3U5NA 4W4UA 3LQHA 4WZ2A 3FJUB 5TDWA 4YYUA 3RTRB 2F7DA 3USVA 1FP0A 3ZTGA 3HD3A 1ICFA 3FEHA 5EGWA 5SVXA 1GCBA 9PAPA 2ECJA 4CDFB 2ATOA 3M99A 4L7XA 2FUDA 4YADA 3IV2A 4A5UA 1MM2A 4R2YA 4XUIA 4BBQA 3LFYA 4D8IA 3OVXA 1U6GB 2VJFA 3U5MA 4OVZB 3LRQA 4I7BA 4DMYA 2G6QA 3W30A 1Q6KA 3FL2A 2L80A 3PLWA 3KSEA 1AU0A 2R6NA 3M62A 4BS6A 2G8EA 3ASLA 2HHNA 1MDWA 4QRGA 1LDKC 1Y4HA 1QDQA 4OGEA 4FJCA 1PPNA 5AITA 1LDJB 1CHCA 1AECA 3I06A 3E2DA 2LN0A 1X4JA 2VPGA 4NN2A 5FB1A 1UKFA 3H8BA 3OQCA 5JZEA 4LJNA
chains in the Genus database with same CATH topology
1NB3A 2IDAA 2DCAA 5I3LA 3KV5A 3IUTA 3L11A 1X9YA 2YJ8A 2JRJA 4A0CD 5H1UA 3ZPVE 2M3HA 4QBBA 3BCNA 2VFBA 1AIMA 2AUZA 2DZYA 4ZDTA 4BPVA 2VNFA 2KWNA 1KHQA 3EB5A 3N9OA 2AU1A 3HWNA 1CPJA 2XU3A 5CVNB 7PCKA 3O33A 3C9EA 3IOQA 2ECVA 2LGGA 4CZWA 4TKPB 4B55A 2LDRA 1SP4B 4GNFA 3P5XA 3BWKA 3QSDA 1GMYA 5B79A 1WE9A 4IC2A 1EWMA 3K9MA 2E6SA 3WXGA 2KWOA 1THEA 4MSXA 2BSZA 4W5CA 5H1TA 1KFXL 2AIMA 3O0UA 3D6SA 1QMYA 4DMXA 2VJEA 4HWYA 2AN6A 2Y6EA 4PP2E 2P0RA 2ZETC 5FERA 1NL6A 3KFQA 1EWPA 3HCTA 1MHWA 4N79A 5CVMA 5DKAA 2K17A 4R7EA 2FO5A 1U9XA 1MM3A 2EODA 1MIRA 5B75A 1Z60A 3S3QA 3N9QA 5LCWB 8PCHA 1M6DA 4BQVA 1U9WA 1Y08A 2LXHC 1TL9A 2YUCA 3C5KA 3HCSA 4GNGA 6PADA 1EF7A 3I3TA 1IWDA 2KU3A 5DINA 1VFYA 5TDRA 5CHTA 4YYVA 2HDPA 2Y43A 2ECGA 2M1RA 2JMIA 5G04B 1CVZA 3PDFA 3H8CA 1S4VA 3KQIA 5D1MB 3N4CA 1U9QX 4MVTA 5K16A 5FB0A 2VJFB 4AXLA 3HHAA 2MNZA 2LGVA 2FSAA 1X4UA 2GFOA 4YV8A 4B86C 1NB5A 2K16A 2PNSA 1WEEA 5KH7A 2G43A 3K8UA 2ACTA 4XR7A 1JM7B 3RPGC 4BGFA 2MIQA 3ZVZB 4N4FA 1E2TA 4W5BA 2FUUA 3V43A 1NLJA 2DJGB 3P5VA 1SNKA 4X6HA 4LLBA 1QXPA 4LK9A 1NQCA 3HCUA 1GX3A 2F1GA 2YHNA 2FT2A 4QRXA 5FEYA 3HHIA 2LQ6A 2E00A 3ZUAA 3KX1A 4CCGX 1F29A 2AYOA 1ZBDB 2G45A 1TU6A 2Y1MA 1CTEA 2DC6A 1F2AA 2CKLA 1U9VA 3IEJA 2E01A 2IPPB 1WEOA 2H0DA 3DF0A 5J3XA 1T1HA 1CSBB 1WEWA 2DJFB 3SOWA 2F42A 1AU3A 4V3LC 2WBFX 4S3OB 1WILA 4P6EA 4FO9A 1YK7A 4A4CA 3IHPA 4QH6A 4V3KC 2YQMA 4Q6FA 3LXSA 5LKXA 2AYNA 5C13A 4MZSA 3SOUA 4FIPA 5AIUA 2YJBA 4YYSA 2EA6A 3C6WA 3BC3A 4GB0A 2NQAA 1VD4A 2Y1NA 2VP7A 1CS8A 2MA6A 5B77A 2VJEB 1HYJA 1EWOA 1K3BB 3KWBX 2QIZA 4I07A 3LTWA 3NG2A 1JQPA 3TNXA 2VPEA 2C2VS 1Z6UA 4I7CA 1N87A 2FQ9A 5D1LB 4X3GA 3F5VA 1WEPA 5B8DA 2OZ2A 2QICA 4YABA 2BAYA 3P5WA 3ZVYA 1WEQA 2PADA 1ME3A 2DCCA 1WEMA 1X4IA 2PREA 3ZPV1 5KH9A 4MZOA 4I04A 2AS8A 2MT5A 2P7UA 1Z2QA 3PNRA 3PW3A 3O34A 5G05B 2OULA 2E6RA 3N9MA 2JMDA 2YU4A 2CIOA 4GNDA 1PXVA 2C0YA 5FPWA 4P6GA 5JH3A 2KYUA 4YBMA 4RY2A 2K1JA 4UI9B 2HH5A 1CV8A 1E4UA 3OF8A 3QJ3A 3AI8A 1HYIA 2E02A 2PUYA 3DPLR 4YC9A 3D9WA 3O36A 4AUQB 2L43A 3IMAA 4PTBA 4QF3A 2AVWA 2RI7A 2HYED 2HD5A 2JQGR 2BDLA 1AU2A 1XWHA 4LADB 1WEUA 1PADA 1ITOA 1YALA 5H1VA 2I50A 1DF0A 3SHBA 5A24A 4XI1A 1WEVA 4PP1A 5JG6A 4AYCA 3PHDA 3S3RA 2VPDA 2XU5A 1WGMA 4NV8A 4BS5A 1QOLA 2KIZA 1GLOA 4YBSA 4KLBA 2G7YA 4FK5A 2OP3A 2UZGA 3KWZA 3CBJA 4UP0A 4Q8HA 3O7AA 2FYEA 2KFTA 3MTNA 2ECIA 1A6RA 1HUCB 2BDZA 1F2CA 2XB1A 3VK6A 3N3KA 1W4TA 2YSJA 2MD7B 5G0FA 3O1GA 3GCBA 4ZUXU 2Y5BA 3L1XA 1NPZA 4AXMA 2VPBA 3KW9A 1O0EA 4YYWA 1AU4A 2AUXA 4OEMA 2YW8A 3P5UA 2CT2A 1STFE 2FTDA 2YSMA 3O37A 2L0BA 1BORA 2CSYA 3T7LA 2QJ0A 4AVXA 2YURA 5KH3A 1V87A 2NAAA 2YHOA 3V6EA 3BOWA 2L5UA 4A49A 4X6JA 3HTKC 2KE1A 2B1NA 2R9FA 2C2LA 2DX8A 1PE6A 5C11A 4OELA 2K4DA 4L58A 3B79A 3ZYQA 2DCBA 1PPOA 5EF4A 2R9CA 3MHHA 2YYRA 2D8SA 4IC3A 4YAXA 2XEUA 3N9LA 5B76A 2F6NA 1YK8A 2HXZA 4N4ZA 5JA7A 3GV4A 3H6SA 2DC7A 2EGPA 2XU1A 5LKZA 2G8JA 1GECE 3F75A 3O35A 1F62A 3U5OA 2NQDB 2DC8A 2JQFR 1POPA 4CDEB 1DVPA 2LXPC 3H89A 1KHPA 2DCDA 1ZCMA 1WFKA 1PPPA 3RVWA 2M85A 4PI3A 1MEMA 1JM7A 2H7JA 5D1KB 2LGKA 3PUQA 1MS6A 2NQGA 1MEGA 4G54A 2OXQC 5J94A 1YT7A 4LKAA 2NQIA 3I2DA 1W5RA 5PADA 2L75A 1VSNA 3RVVA 1KFUL 2XU4A 2DZZA 3WXFA 4UP5A 2FRAA 4BHWA 3KNVA 3OISA 2KWJA 4R8PK 3DQVR 4CDDB 4AYCB 2ARYA 5LKUA 1PBHA 1TLOA 3BPMA 3N9PA 3RPGB 3L1ZB 4B7YC 4BSQA 2LV9A 2YJ9A 1IYMA 3ERVA 4YYRA 4CDCB 3N9NA 2VHFA 2G6DA 1PCIA 2KGGA 5TRBA 1CJLA 1WESA 1YVBA 1PIPA 3BPFA 4ZQLA 1G25A 3WXEA 3RVXA 4NV7A 4GUZA 1BGOA 3E1ZB 3OVZA 1F2BA 1VJVA 2VFCA 4P5OB 4PPEA 1CQDA 1AYUA 2GHUA 4YYQA 2ECNA 4GNEA 4S3OC 2CB5A 2E03A 4X6IA 2ECTA 3T6RA 4A4BA 3OF9A 1ATKA 3O70A 1ZIVA 2PNXA 2PBHA 3U8EA 4YVAA 2JMJA 4C5PA 1EWLA 3GL6A 3MHSA 3KKUA 2YREA 3LQIA 4WZ0A 1AYWA 4C9ZA 3EB6A 3QZVA 3PURA 2DC9A 3CBKA 2VHSA 3LQJA 3V6CA 3N3GA 5CHVA 2MUMA 4WA6A 2YJCA 2CKLB 2RSDA 2MNYA 2H0DB 2M6MA 4I7DA 1PPDA 1BQIA 4CA1A 5B78A 4WZ3B 2KGIA 4YBTA 1ME4A 2FRQA 2ECWA 4N3WA 2IBIA 4I05A 5F02A 2KWKA 2FUIA 1CB5A 3QT4A 4YATA 3M63A 2R9OA 1KXRA 2CSZA 2MD8C 1RMDA 1U5IA 4Q8GA 4AP4A 4F52B 5H9MA 2MA5A 2O6XA 1WENA 4QRVA 2LRIC 1XKGA 2R9NA 5CVOB 2YQLA 2YJ2A 2P86A 3MORA 3PBHA 1JOCA 2B1MA 1BP4A 4K7CA 4QF2A 1DEUA 3U5PA 3SOXA 1FBVA 5EYAF 5LKTA 2F6JA 2R9MA 4N8WA 3KV6A 3CH3X 5TABA 1BY8A 3K24A 4PADA 1W6FA 3NHEA 1AYVA 3CH2X 2KREA 4O64A 2LGLA 2KR4A 5TBNA 3H7DA 1VYXA 3ZNIA 1FH0A 1K2FA 2YT5A 1WIMA 3U5NA 4W4UA 3LQHA 4WZ2A 5TDWA 4YYUA 3RTRB 2F7DA 3USVA 1FP0A 3ZTGA 3HD3A 1ICFA 5EGWA 1GCBA 9PAPA 2ECJA 4CDFB 2ATOA 3M99A 4L7XA 2FUDA 4YADA 3IV2A 1MM2A 4R2YA 4XUIA 4BBQA 3LFYA 3OVXA 1U6GB 2VJFA 3U5MA 3LRQA 4I7BA 4DMYA 2G6QA 1Q6KA 3FL2A 2L80A 3KSEA 1AU0A 2R6NA 3M62A 4BS6A 2G8EA 3ASLA 2HHNA 1MDWA 4QRGA 1LDKC 1Y4HA 1QDQA 4FJCA 1PPNA 5AITA 1LDJB 1CHCA 1AECA 3I06A 2LN0A 1X4JA 2VPGA 4NN2A 5FB1A 3H8BA 4LJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB3 A;  2IDA A;  2DCA A;  5I3L A;  3KV5 A;  3IUT A;  3L11 A;  1X9Y A;  2YJ8 A;  2JRJ A;  4A0C D;  5H1U A;  3ZPV E;  2M3H A;  4QBB A;  3BCN A;  1AIM A;  2AUZ A;  2DZY A;  4ZDT A;  4BPV A;  2VNF A;  2KWN A;  1KHQ A;  3EB5 A;  3N9O A;  2AU1 A;  3HWN A;  1CPJ A;  2XU3 A;  5CVN B;  7PCK A;  3O33 A;  3C9E A;  3IOQ A;  2ECV A;  2LGG A;  4CZW A;  4TKP B;  2LDR A;  1SP4 B;  4GNF A;  3P5X A;  3BWK A;  3QSD A;  1GMY A;  5B79 A;  1WE9 A;  4IC2 A;  1EWM A;  3K9M A;  2E6S A;  3WXG A;  2KWO A;  1THE A;  4MSX A;  4W5C A;  5H1T A;  1KFX L;  2AIM A;  3O0U A;  3D6S A;  1QMY A;  4DMX A;  2VJE A;  4HWY A;  2AN6 A;  2Y6E A;  4PP2 E;  2P0R A;  2ZET C;  5FER A;  1NL6 A;  3KFQ A;  1EWP A;  3HCT A;  1MHW A;  4N79 A;  5CVM A;  5DKA A;  2K17 A;  4R7E A;  2FO5 A;  1U9X A;  1MM3 A;  2EOD A;  1MIR A;  5B75 A;  1Z60 A;  3S3Q A;  3N9Q A;  5LCW B;  8PCH A;  1M6D A;  4BQV A;  1U9W A;  1Y08 A;  2LXH C;  1TL9 A;  2YUC A;  3C5K A;  3HCS A;  4GNG A;  6PAD A;  1EF7 A;  3I3T A;  1IWD A;  2KU3 A;  5DIN A;  1VFY A;  5TDR A;  5CHT A;  4YYV A;  2HDP A;  2Y43 A;  2ECG A;  2M1R A;  2JMI A;  5G04 B;  1CVZ A;  3PDF A;  3H8C A;  1S4V A;  3KQI A;  5D1M B;  3N4C A;  1U9Q X;  4MVT A;  5K16 A;  5FB0 A;  2VJF B;  4AXL A;  3HHA A;  2MNZ A;  2LGV A;  2FSA A;  1X4U A;  2GFO A;  4YV8 A;  4B86 C;  1NB5 A;  2K16 A;  2PNS A;  1WEE A;  5KH7 A;  2G43 A;  3K8U A;  2ACT A;  4XR7 A;  1JM7 B;  3RPG C;  2MIQ A;  3ZVZ B;  4N4F A;  4W5B A;  2FUU A;  3V43 A;  1NLJ A;  2DJG B;  3P5V A;  1SNK A;  4X6H A;  4LLB A;  1QXP A;  4LK9 A;  1NQC A;  3HCU A;  2F1G A;  2YHN A;  2FT2 A;  4QRX A;  5FEY A;  3HHI A;  2LQ6 A;  2E00 A;  3ZUA A;  3KX1 A;  4CCG X;  1F29 A;  2AYO A;  1ZBD B;  2G45 A;  1TU6 A;  2Y1M A;  1CTE A;  2DC6 A;  1F2A A;  2CKL A;  1U9V A;  3IEJ A;  2E01 A;  2IPP B;  1WEO A;  2H0D A;  3DF0 A;  5J3X A;  1T1H A;  1CSB B;  1WEW A;  2DJF B;  3SOW A;  2F42 A;  1AU3 A;  4V3L C;  2WBF X;  4S3O B;  1WIL A;  4P6E A;  4FO9 A;  1YK7 A;  4A4C A;  3IHP A;  4QH6 A;  4V3K C;  2YQM A;  4Q6F A;  3LXS A;  5LKX A;  2AYN A;  5C13 A;  4MZS A;  3SOU A;  4FIP A;  5AIU A;  2YJB A;  4YYS A;  2EA6 A;  3C6W A;  3BC3 A;  4GB0 A;  2NQA A;  1VD4 A;  2Y1N A;  2VP7 A;  1CS8 A;  2MA6 A;  5B77 A;  2VJE B;  1HYJ A;  1EWO A;  1K3B B;  3KWB X;  2QIZ A;  4I07 A;  3NG2 A;  1JQP A;  3TNX A;  2VPE A;  2C2V S;  1Z6U A;  4I7C A;  1N87 A;  2FQ9 A;  5D1L B;  4X3G A;  3F5V A;  1WEP A;  5B8D A;  2OZ2 A;  2QIC A;  4YAB A;  2BAY A;  3P5W A;  3ZVY A;  1WEQ A;  2PAD A;  1ME3 A;  2DCC A;  1WEM A;  1X4I A;  2PRE A;  3ZPV 1;  5KH9 A;  4MZO A;  4I04 A;  2AS8 A;  2MT5 A;  2P7U A;  1Z2Q A;  3PNR A;  3PW3 A;  3O34 A;  5G05 B;  2OUL A;  2E6R A;  3N9M A;  2JMD A;  2YU4 A;  2CIO A;  4GND A;  1PXV A;  2C0Y A;  5FPW A;  4P6G A;  5JH3 A;  2KYU A;  4YBM A;  4RY2 A;  2K1J A;  4UI9 B;  2HH5 A;  1CV8 A;  1E4U A;  3OF8 A;  3QJ3 A;  3AI8 A;  1HYI A;  2E02 A;  2PUY A;  3DPL R;  4YC9 A;  3O36 A;  4AUQ B;  2L43 A;  3IMA A;  4PTB A;  4QF3 A;  2AVW A;  2RI7 A;  2HYE D;  2HD5 A;  2JQG R;  2BDL A;  1AU2 A;  1XWH A;  4LAD B;  1WEU A;  1PAD A;  1ITO A;  1YAL A;  5H1V A;  2I50 A;  1DF0 A;  3SHB A;  5A24 A;  4XI1 A;  1WEV A;  4PP1 A;  5JG6 A;  4AYC A;  3PHD A;  3S3R A;  2VPD A;  2XU5 A;  1WGM A;  4BS5 A;  1QOL A;  2KIZ A;  1GLO A;  4YBS A;  4KLB A;  2G7Y A;  4FK5 A;  2OP3 A;  2UZG A;  3KWZ A;  3CBJ A;  4UP0 A;  4Q8H A;  3O7A A;  2FYE A;  2KFT A;  3MTN A;  2ECI A;  1A6R A;  1HUC B;  2BDZ A;  1F2C A;  2XB1 A;  3VK6 A;  3N3K A;  2YSJ A;  2MD7 B;  5G0F A;  3O1G A;  3GCB A;  4ZUX U;  2Y5B A;  3L1X A;  1NPZ A;  4AXM A;  2VPB A;  3KW9 A;  1O0E A;  4YYW A;  1AU4 A;  2AUX A;  4OEM A;  2YW8 A;  3P5U A;  2CT2 A;  1STF E;  2FTD A;  2YSM A;  3O37 A;  2L0B A;  1BOR A;  2CSY A;  3T7L A;  2QJ0 A;  4AVX A;  2YUR A;  5KH3 A;  1V87 A;  2NAA A;  2YHO A;  3V6E A;  3BOW A;  2L5U A;  4A49 A;  4X6J A;  3HTK C;  2KE1 A;  2B1N A;  2R9F A;  2C2L A;  2DX8 A;  1PE6 A;  5C11 A;  4OEL A;  2K4D A;  4L58 A;  3B79 A;  3ZYQ A;  2DCB A;  1PPO A;  5EF4 A;  2R9C A;  3MHH A;  2YYR A;  2D8S A;  4IC3 A;  4YAX A;  2XEU A;  3N9L A;  5B76 A;  2F6N A;  1YK8 A;  2HXZ A;  4N4Z A;  5JA7 A;  3GV4 A;  3H6S A;  2DC7 A;  2EGP A;  2XU1 A;  5LKZ A;  2G8J A;  1GEC E;  3F75 A;  3O35 A;  1F62 A;  3U5O A;  2NQD B;  2DC8 A;  2JQF R;  1POP A;  4CDE B;  1DVP A;  2LXP C;  3H89 A;  1KHP A;  2DCD A;  1ZCM A;  1WFK A;  1PPP A;  3RVW A;  2M85 A;  4PI3 A;  1MEM A;  1JM7 A;  2H7J A;  5D1K B;  2LGK A;  3PUQ A;  1MS6 A;  2NQG A;  1MEG A;  4G54 A;  2OXQ C;  5J94 A;  1YT7 A;  4LKA A;  2NQI A;  3I2D A;  5PAD A;  2L75 A;  1VSN A;  3RVV A;  1KFU L;  2XU4 A;  2DZZ A;  3WXF A;  4UP5 A;  2FRA A;  4BHW A;  3KNV A;  3OIS A;  2KWJ A;  4R8P K;  3DQV R;  4CDD B;  4AYC B;  2ARY A;  5LKU A;  1PBH A;  1TLO A;  3BPM A;  3N9P A;  3RPG B;  3L1Z B;  4B7Y C;  4BSQ A;  2LV9 A;  2YJ9 A;  1IYM A;  3ERV A;  4YYR A;  4CDC B;  3N9N A;  2VHF A;  2G6D A;  1PCI A;  2KGG A;  5TRB A;  1CJL A;  1WES A;  1YVB A;  1PIP A;  3BPF A;  4ZQL A;  1G25 A;  3WXE A;  3RVX A;  1BGO A;  3E1Z B;  3OVZ A;  1F2B A;  1VJV A;  4P5O B;  4PPE A;  1CQD A;  1AYU A;  2GHU A;  4YYQ A;  2ECN A;  4GNE A;  4S3O C;  2CB5 A;  2E03 A;  4X6I A;  2ECT A;  3T6R A;  4A4B A;  3OF9 A;  1ATK A;  3O70 A;  1ZIV A;  2PNX A;  2PBH A;  3U8E A;  4YVA A;  2JMJ A;  1EWL A;  3GL6 A;  3MHS A;  3KKU A;  2YRE A;  3LQI A;  4WZ0 A;  1AYW A;  4C9Z A;  3EB6 A;  3QZV A;  3PUR A;  2DC9 A;  3CBK A;  2VHS A;  3LQJ A;  3V6C A;  3N3G A;  5CHV A;  2MUM A;  4WA6 A;  2YJC A;  2CKL B;  2RSD A;  2MNY A;  2H0D B;  2M6M A;  4I7D A;  1PPD A;  1BQI A;  4CA1 A;  5B78 A;  4WZ3 B;  2KGI A;  4YBT A;  1ME4 A;  2FRQ A;  2ECW A;  4N3W A;  2IBI A;  4I05 A;  5F02 A;  2KWK A;  2FUI A;  1CB5 A;  3QT4 A;  4YAT A;  3M63 A;  2R9O A;  1KXR A;  2CSZ A;  2MD8 C;  1RMD A;  1U5I A;  4Q8G A;  4AP4 A;  4F52 B;  5H9M A;  2MA5 A;  2O6X A;  1WEN A;  4QRV A;  2LRI C;  1XKG A;  2R9N A;  5CVO B;  2YQL A;  2YJ2 A;  2P86 A;  3MOR A;  3PBH A;  1JOC A;  2B1M A;  1BP4 A;  4K7C A;  4QF2 A;  1DEU A;  3U5P A;  3SOX A;  1FBV A;  5EYA F;  5LKT A;  2F6J A;  2R9M A;  4N8W A;  3KV6 A;  3CH3 X;  5TAB A;  1BY8 A;  3K24 A;  4PAD A;  3NHE A;  1AYV A;  3CH2 X;  2KRE A;  4O64 A;  2LGL A;  2KR4 A;  5TBN A;  3H7D A;  1VYX A;  3ZNI A;  1FH0 A;  1K2F A;  2YT5 A;  1WIM A;  3U5N A;  4W4U A;  3LQH A;  4WZ2 A;  5TDW A;  4YYU A;  3RTR B;  2F7D A;  3USV A;  1FP0 A;  3ZTG A;  3HD3 A;  1ICF A;  5EGW A;  1GCB A;  9PAP A;  2ECJ A;  4CDF B;  2ATO A;  3M99 A;  4L7X A;  2FUD A;  4YAD A;  3IV2 A;  1MM2 A;  4R2Y A;  4XUI A;  4BBQ A;  3LFY A;  3OVX A;  1U6G B;  2VJF A;  3U5M A;  3LRQ A;  4I7B A;  4DMY A;  2G6Q A;  1Q6K A;  3FL2 A;  2L80 A;  3KSE A;  1AU0 A;  2R6N A;  3M62 A;  4BS6 A;  2G8E A;  3ASL A;  2HHN A;  1MDW A;  4QRG A;  1LDK C;  1Y4H A;  1QDQ A;  4FJC A;  1PPN A;  5AIT A;  1LDJ B;  1CHC A;  1AEC A;  3I06 A;  2LN0 A;  1X4J A;  2VPG A;  4NN2 A;  5FB1 A;  3H8B A;  4LJN A; 
#chains in the Genus database with same CATH topology
 1NB3 A;  2IDA A;  2DCA A;  2P57 A;  5I3L A;  4MM3 B;  3KV5 A;  4BOZ A;  3IUT A;  3L11 A;  1X9Y A;  2YJ8 A;  2JRJ A;  4A0C D;  5H1U A;  3PHX A;  3ZPV E;  2M3H A;  4QBB A;  3B21 A;  3BBA A;  3BCN A;  1AIM A;  2AUZ A;  2DZY A;  4ZDT A;  1PVJ A;  4BPV A;  2VNF A;  2KWN A;  1KHQ A;  3EB5 A;  3N9O A;  2AU1 A;  2EXU A;  3HWN A;  1CPJ A;  2XU3 A;  5CVN B;  7PCK A;  4BOP A;  3O33 A;  3C9E A;  3IOQ A;  2ECV A;  2LGG A;  3Q1D A;  4CZW A;  4TKP B;  2LDR A;  1SP4 B;  4GNF A;  3P5X A;  3JUE A;  3BWK A;  3QSD A;  1GMY A;  5B79 A;  3SUB A;  4BOQ A;  1WE9 A;  4IC2 A;  1EWM A;  3K9M A;  2E6S A;  3WXG A;  2KWO A;  1THE A;  4MSX A;  4W5C A;  5H1T A;  1KFX L;  2IQJ A;  2AIM A;  3O0U A;  3D6S A;  2BTW B;  1QMY A;  3MJ5 A;  3ZNH A;  4PT5 A;  4DMX A;  2FFW A;  2VJE A;  4HWY A;  2AN6 A;  2Y6E A;  2XOY A;  4GUA A;  4PP2 E;  2P0R A;  2ZET C;  3DDT A;  5FER A;  1NL6 A;  3KFQ A;  1EWP A;  2CRR A;  3HCT A;  1MHW A;  4N79 A;  5CVM A;  5DKA A;  2K17 A;  4R7E A;  2FO5 A;  2KKY A;  1U9X A;  1MM3 A;  2EOD A;  1MIR A;  5B75 A;  3C0R A;  3MP2 A;  1Z60 A;  3S3Q A;  3N9Q A;  3E9S A;  5LCW B;  3M7K A;  8PCH A;  1M6D A;  4BQV A;  1U9W A;  1Y08 A;  2LXH C;  1TL9 A;  2YUC A;  3C5K A;  3HCS A;  3LVQ E;  2JM3 A;  4GNG A;  4XZX A;  6PAD A;  1EF7 A;  2EGM A;  1IWD A;  3I3T A;  2KU3 A;  5DIN A;  3DWD A;  1VFY A;  5TDR A;  5CHT A;  4YYV A;  2HDP A;  2Y43 A;  2ECG A;  2M1R A;  2JMI A;  5G04 B;  3FAN A;  1CVZ A;  3PDF A;  3H8C A;  1S4V A;  3KQI A;  5D1M B;  3N4C A;  1U9Q X;  4HXD B;  4MVT A;  5K16 A;  5FB0 A;  2VJF B;  4AXL A;  3HHA A;  2MNZ A;  2LGV A;  1MBM A;  2FSA A;  1X4U A;  3FAO A;  1YZB A;  2GFO A;  4YV8 A;  4B86 C;  1NB5 A;  2K16 A;  2PNS A;  1WEE A;  5KH7 A;  2G43 A;  3K8U A;  4M0W A;  4BOS A;  2ACT A;  4XR7 A;  1JM7 B;  4D8B A;  3RPG C;  2MIQ A;  3ZVZ B;  4N4F A;  4W5B A;  2FUU A;  3V43 A;  1NLJ A;  2DJG B;  3P5V A;  1SNK A;  4X6H A;  4LLB A;  1QXP A;  4LK9 A;  1NQC A;  3HCU A;  2F1G A;  2YHN A;  2FT2 A;  4QRX A;  5FEY A;  3HHI A;  2LQ6 A;  2E00 A;  2RR4 A;  3ZUA A;  3KX1 A;  4CCG X;  1F29 A;  5K3Q A;  2AYO A;  1ZBD B;  2G45 A;  1TU6 A;  2Y1M A;  1CTE A;  2DC6 A;  1F2A A;  2CKL A;  1U9V A;  2JRI A;  3IEJ A;  2E01 A;  2IPP B;  1WEO A;  2H0D A;  3DF0 A;  5J3X A;  1T1H A;  1CSB B;  1WEW A;  2YVR A;  2DJF B;  3SOW A;  2F42 A;  1AU3 A;  4V3L C;  4Z0O A;  2WBF X;  4S3O B;  2BU3 A;  1WIL A;  4P6E A;  4FO9 A;  1YK7 A;  4A4C A;  3IHP A;  4QH6 A;  4V3K C;  3H7H A;  2YQM A;  4Q6F A;  3LXS A;  5LKX A;  2AYN A;  5C13 A;  4MZS A;  3SOU A;  4FIP A;  5AIU A;  3PSE A;  2YJB A;  4YYS A;  2EA6 A;  3C6W A;  3BC3 A;  4GB0 A;  2NQA A;  4IUM A;  3LVR E;  1VD4 A;  2Y1N A;  4D8E A;  2VP7 A;  1CS8 A;  3FM8 C;  2MA6 A;  5B77 A;  2VJE B;  1HYJ A;  1EWO A;  1K3B B;  3KWB X;  3TRK A;  2QIZ A;  4I07 A;  3RNV A;  5SVI A;  3NG2 A;  1JQP A;  3TNX A;  4H9D A;  2VPE A;  2C2V S;  1Z6U A;  4I7C A;  4RF1 A;  2KKX A;  3PRM A;  1N87 A;  2FQ9 A;  5D1L B;  4X3G A;  3F5V A;  1WEP A;  5B8D A;  2CSV A;  2OZ2 A;  2QIC A;  4YAB A;  2BAY A;  3P5W A;  3ZVY A;  1WEQ A;  2PAD A;  1ME3 A;  2AGA A;  2OWA A;  2DCC A;  1WEM A;  1X4I A;  2PRE A;  3ZPV 1;  5KH9 A;  4MZO A;  4I04 A;  2AS8 A;  2FD4 A;  2MT5 A;  2P7U A;  4F1P A;  4OVZ A;  1Z2Q A;  3PNR A;  3PW3 A;  3O34 A;  5G05 B;  2OUL A;  2E6R A;  3N9M A;  2JMD A;  2YU4 A;  2CIO A;  4GND A;  1PXV A;  2C0Y A;  4RF0 A;  5FPW A;  4P6G A;  5JH3 A;  2KYU A;  4YBM A;  4RY2 A;  2K1J A;  4UI9 B;  2HH5 A;  1CV8 A;  1E4U A;  3OF8 A;  3QJ3 A;  4REZ A;  3AI8 A;  1HYI A;  2E02 A;  2PUY A;  3DPL R;  4YC9 A;  4BOU A;  3O36 A;  4AUQ B;  2L43 A;  3IMA A;  4PTB A;  4QF3 A;  4R3D A;  4OGC A;  2AVW A;  2RI7 A;  2HYE D;  2HD5 A;  2JQG R;  2BDL A;  1AU2 A;  1XWH A;  4LAD B;  1WEU A;  1PAD A;  1ITO A;  1YAL A;  5H1V A;  2I50 A;  1DF0 A;  3SHB A;  5A24 A;  4XI1 A;  1WEV A;  4PP1 A;  3W31 A;  5JG6 A;  4AYC A;  3PHD A;  3S3R A;  2VPD A;  2XU5 A;  1WGM A;  4BS5 A;  1QOL A;  2KIZ A;  1GLO A;  4YBS A;  4KLB A;  2G7Y A;  4FK5 A;  2OP3 A;  2UZG A;  3KWZ A;  3CBJ A;  4UP0 A;  4Q8H A;  3PRP A;  3O7A A;  2FYE A;  4ZTB A;  2KFT A;  3MTN A;  2ECI A;  1A6R A;  1HUC B;  2BDZ A;  1F2C A;  2XB1 A;  3VK6 A;  3N3K A;  2YSJ A;  2MD7 B;  5G0F A;  3O1G A;  3GCB A;  4ZUX U;  2D8U A;  1DCQ A;  2Y5B A;  3L1X A;  1NPZ A;  1DKI A;  2LAU A;  2VPB A;  4QQ4 A;  3KW9 A;  1O0E A;  4AXM A;  4YYW A;  1AU4 A;  2AUX A;  2L7P A;  2BTW A;  5E6J A;  4OEM A;  2YW8 A;  3P5U A;  2CT2 A;  1STF E;  2FTD A;  3LDY A;  2YSM A;  3O37 A;  2L0B A;  1BOR A;  2CON A;  2CSY A;  3T7L A;  2QJ0 A;  4AVX A;  4RKX A;  2YUR A;  5KH3 A;  1V87 A;  2NAA A;  2YHO A;  3O47 A;  3BOW A;  2DJA A;  3V6E A;  2L5U A;  4A49 A;  4X6J A;  3HTK C;  2KE1 A;  2B1N A;  3MTV A;  2M13 A;  2C2L A;  2DX8 A;  1PE6 A;  2R9F A;  5C11 A;  4OEL A;  2K4D A;  4L58 A;  3B79 A;  3ZYQ A;  2DCB A;  3T9K A;  1PPO A;  5EF4 A;  2R9C A;  3MHH A;  2YYR A;  3MDB C;  2D8S A;  4IC3 A;  4YAX A;  2B0O E;  2XEU A;  3N9L A;  5B76 A;  2F6N A;  2E61 A;  1YK8 A;  2HXZ A;  4N4Z A;  5JA7 A;  3GV4 A;  3H6S A;  5SVY A;  2DC7 A;  2EGP A;  2XU1 A;  5LKZ A;  2XOZ A;  2G8J A;  1GEC E;  3F75 A;  3O35 A;  1F62 A;  3U5O A;  2NQD B;  2DC8 A;  2JQF R;  1POP A;  4CDE B;  1DVP A;  2LXP C;  3H89 A;  1KHP A;  2XP0 A;  1ZCM A;  2DCD A;  1WFK A;  1PPP A;  3RVW A;  2M85 A;  4PI3 A;  1MEM A;  1JM7 A;  2H7J A;  5D1K B;  2LGK A;  3PUQ A;  1MS6 A;  2NQG A;  2JUN A;  1MEG A;  4G54 A;  2OXQ C;  5EZQ A;  5KO3 A;  5J94 A;  1YT7 A;  4LKA A;  2NQI A;  2UZJ A;  4RNA A;  3LJU X;  3I2D A;  5PAD A;  3BY4 A;  2L75 A;  2CRW A;  1VSN A;  3RVV A;  1KFU L;  2XU4 A;  2DZZ A;  3WXF A;  4UP5 A;  2FRA A;  4BHW A;  2XOC A;  4O62 A;  3KNV A;  3OIS A;  4WUR A;  2KWJ A;  4R8P K;  3DQV R;  4CDD B;  4AYC B;  2ARY A;  5LKU A;  1PBH A;  1TLO A;  3BPM A;  3N9P A;  3RPG B;  3L1Z B;  4B7Y C;  2DOS A;  4BSQ A;  2LV9 A;  2YJ9 A;  1IYM A;  3ERV A;  4YYR A;  4CDC B;  3N9N A;  2VHF A;  2G6D A;  1PCI A;  3PHU A;  2KGG A;  5TRB A;  1CJL A;  3PHW A;  3IFU A;  1WES A;  1YVB A;  4MI7 A;  1PIP A;  3BPF A;  4ZQL A;  1G25 A;  3WXE A;  4Z0R A;  3RVX A;  1BGO A;  3E1Z B;  3OVZ A;  1F2B A;  1VJV A;  4IP3 A;  4P5O B;  4PPE A;  1CQD A;  1AYU A;  2GHU A;  4YYQ A;  2ECN A;  4GNE A;  4S3O C;  2CB5 A;  2E03 A;  4P16 A;  4X6I A;  2ECT A;  3T6R A;  4A4B A;  2HWK A;  1ATK A;  3O70 A;  1ZIV A;  3OF9 A;  2PNX A;  2PBH A;  3U8E A;  4YVA A;  2JMJ A;  1EWL A;  3GL6 A;  3MHS A;  3KKU A;  2YRE A;  3LQI A;  4WZ0 A;  1AYW A;  4C9Z A;  3EB6 A;  3QZV A;  3TMP A;  3PUR A;  3KDE C;  2DC9 A;  2VHS A;  3LQJ A;  3CBK A;  3N3G A;  5CHV A;  3V6C A;  2MUM A;  4WA6 A;  2YJC A;  2CKL B;  2RSD A;  3O65 A;  2MNY A;  2H0D B;  2M6M A;  4I7D A;  1PPD A;  2Z84 A;  1BQI A;  2JTC A;  4CA1 A;  5B78 A;  4WZ3 B;  2KGI A;  4YBT A;  1ME4 A;  2FRQ A;  2MKE A;  2ECW A;  4N3W A;  2IBI A;  4I05 A;  5F02 A;  2KWK A;  2FUI A;  1CB5 A;  3QT4 A;  4YAT A;  3M63 A;  2R9O A;  1KXR A;  2CSZ A;  2DSM A;  2MD8 C;  1RMD A;  1U5I A;  4Q8G A;  4AP4 A;  4F52 B;  5H9M A;  2J7Q A;  2MA5 A;  2O6X A;  1WEN A;  4QRV A;  2LRI C;  1XKG A;  2R9N A;  5CVO B;  2YQL A;  2YJ2 A;  2P86 A;  3MOR A;  3PBH A;  1JOC A;  2B1M A;  1BP4 A;  4K7C A;  4QF2 A;  1DEU A;  3U5P A;  3SOX A;  2FE8 A;  1FBV A;  5EYA F;  5LKT A;  2F6J A;  2R9M A;  3BB7 A;  4OW0 A;  4N8W A;  3KV6 A;  3CH3 X;  5TAB A;  1BY8 A;  3PT2 A;  3K24 A;  4PAD A;  5SVI B;  3NHE A;  1AYV A;  3CH2 X;  2KRE A;  4O64 A;  2LGL A;  2KR4 A;  5TBN A;  2J7Q C;  3H7D A;  1VYX A;  3ZNI A;  1FH0 A;  5EZS A;  1K2F A;  2YT5 A;  1WIM A;  3U5N A;  4W4U A;  3LQH A;  4WZ2 A;  3FJU B;  5TDW A;  4YYU A;  3RTR B;  2F7D A;  3USV A;  1FP0 A;  3ZTG A;  3HD3 A;  1ICF A;  3FEH A;  5EGW A;  5SVX A;  1GCB A;  9PAP A;  2ECJ A;  4CDF B;  2ATO A;  3M99 A;  4L7X A;  2FUD A;  4YAD A;  3IV2 A;  4A5U A;  1MM2 A;  4R2Y A;  4XUI A;  4BBQ A;  3LFY A;  4D8I A;  3OVX A;  1U6G B;  2VJF A;  3U5M A;  4OVZ B;  3LRQ A;  4I7B A;  4DMY A;  2G6Q A;  3W30 A;  1Q6K A;  3FL2 A;  2L80 A;  3PLW A;  3KSE A;  1AU0 A;  2R6N A;  3M62 A;  4BS6 A;  2G8E A;  3ASL A;  2HHN A;  1MDW A;  4QRG A;  1LDK C;  1Y4H A;  1QDQ A;  4OGE A;  4FJC A;  1PPN A;  5AIT A;  1LDJ B;  1CHC A;  1AEC A;  3I06 A;  3E2D A;  2LN0 A;  1X4J A;  2VPG A;  4NN2 A;  5FB1 A;  1UKF A;  3H8B A;  3OQC A;  5JZE A;  4LJN A; 
#chains in the Genus database with same CATH homology
 1NB3 A;  2IDA A;  2DCA A;  5I3L A;  3KV5 A;  3IUT A;  3L11 A;  1X9Y A;  2YJ8 A;  2JRJ A;  4A0C D;  5H1U A;  3ZPV E;  2M3H A;  4QBB A;  3BCN A;  2VFB A;  1AIM A;  2AUZ A;  2DZY A;  4ZDT A;  4BPV A;  2VNF A;  2KWN A;  1KHQ A;  3EB5 A;  3N9O A;  2AU1 A;  3HWN A;  1CPJ A;  2XU3 A;  5CVN B;  7PCK A;  3O33 A;  3C9E A;  3IOQ A;  2ECV A;  2LGG A;  4CZW A;  4TKP B;  4B55 A;  2LDR A;  1SP4 B;  4GNF A;  3P5X A;  3BWK A;  3QSD A;  1GMY A;  5B79 A;  1WE9 A;  4IC2 A;  1EWM A;  3K9M A;  2E6S A;  3WXG A;  2KWO A;  1THE A;  4MSX A;  2BSZ A;  4W5C A;  5H1T A;  1KFX L;  2AIM A;  3O0U A;  3D6S A;  1QMY A;  4DMX A;  2VJE A;  4HWY A;  2AN6 A;  2Y6E A;  4PP2 E;  2P0R A;  2ZET C;  5FER A;  1NL6 A;  3KFQ A;  1EWP A;  3HCT A;  1MHW A;  4N79 A;  5CVM A;  5DKA A;  2K17 A;  4R7E A;  2FO5 A;  1U9X A;  1MM3 A;  2EOD A;  1MIR A;  5B75 A;  1Z60 A;  3S3Q A;  3N9Q A;  5LCW B;  8PCH A;  1M6D A;  4BQV A;  1U9W A;  1Y08 A;  2LXH C;  1TL9 A;  2YUC A;  3C5K A;  3HCS A;  4GNG A;  6PAD A;  1EF7 A;  3I3T A;  1IWD A;  2KU3 A;  5DIN A;  1VFY A;  5TDR A;  5CHT A;  4YYV A;  2HDP A;  2Y43 A;  2ECG A;  2M1R A;  2JMI A;  5G04 B;  1CVZ A;  3PDF A;  3H8C A;  1S4V A;  3KQI A;  5D1M B;  3N4C A;  1U9Q X;  4MVT A;  5K16 A;  5FB0 A;  2VJF B;  4AXL A;  3HHA A;  2MNZ A;  2LGV A;  2FSA A;  1X4U A;  2GFO A;  4YV8 A;  4B86 C;  1NB5 A;  2K16 A;  2PNS A;  1WEE A;  5KH7 A;  2G43 A;  3K8U A;  2ACT A;  4XR7 A;  1JM7 B;  3RPG C;  4BGF A;  2MIQ A;  3ZVZ B;  4N4F A;  1E2T A;  4W5B A;  2FUU A;  3V43 A;  1NLJ A;  2DJG B;  3P5V A;  1SNK A;  4X6H A;  4LLB A;  1QXP A;  4LK9 A;  1NQC A;  3HCU A;  1GX3 A;  2F1G A;  2YHN A;  2FT2 A;  4QRX A;  5FEY A;  3HHI A;  2LQ6 A;  2E00 A;  3ZUA A;  3KX1 A;  4CCG X;  1F29 A;  2AYO A;  1ZBD B;  2G45 A;  1TU6 A;  2Y1M A;  1CTE A;  2DC6 A;  1F2A A;  2CKL A;  1U9V A;  3IEJ A;  2E01 A;  2IPP B;  1WEO A;  2H0D A;  3DF0 A;  5J3X A;  1T1H A;  1CSB B;  1WEW A;  2DJF B;  3SOW A;  2F42 A;  1AU3 A;  4V3L C;  2WBF X;  4S3O B;  1WIL A;  4P6E A;  4FO9 A;  1YK7 A;  4A4C A;  3IHP A;  4QH6 A;  4V3K C;  2YQM A;  4Q6F A;  3LXS A;  5LKX A;  2AYN A;  5C13 A;  4MZS A;  3SOU A;  4FIP A;  5AIU A;  2YJB A;  4YYS A;  2EA6 A;  3C6W A;  3BC3 A;  4GB0 A;  2NQA A;  1VD4 A;  2Y1N A;  2VP7 A;  1CS8 A;  2MA6 A;  5B77 A;  2VJE B;  1HYJ A;  1EWO A;  1K3B B;  3KWB X;  2QIZ A;  4I07 A;  3LTW A;  3NG2 A;  1JQP A;  3TNX A;  2VPE A;  2C2V S;  1Z6U A;  4I7C A;  1N87 A;  2FQ9 A;  5D1L B;  4X3G A;  3F5V A;  1WEP A;  5B8D A;  2OZ2 A;  2QIC A;  4YAB A;  2BAY A;  3P5W A;  3ZVY A;  1WEQ A;  2PAD A;  1ME3 A;  2DCC A;  1WEM A;  1X4I A;  2PRE A;  3ZPV 1;  5KH9 A;  4MZO A;  4I04 A;  2AS8 A;  2MT5 A;  2P7U A;  1Z2Q A;  3PNR A;  3PW3 A;  3O34 A;  5G05 B;  2OUL A;  2E6R A;  3N9M A;  2JMD A;  2YU4 A;  2CIO A;  4GND A;  1PXV A;  2C0Y A;  5FPW A;  4P6G A;  5JH3 A;  2KYU A;  4YBM A;  4RY2 A;  2K1J A;  4UI9 B;  2HH5 A;  1CV8 A;  1E4U A;  3OF8 A;  3QJ3 A;  3AI8 A;  1HYI A;  2E02 A;  2PUY A;  3DPL R;  4YC9 A;  3D9W A;  3O36 A;  4AUQ B;  2L43 A;  3IMA A;  4PTB A;  4QF3 A;  2AVW A;  2RI7 A;  2HYE D;  2HD5 A;  2JQG R;  2BDL A;  1AU2 A;  1XWH A;  4LAD B;  1WEU A;  1PAD A;  1ITO A;  1YAL A;  5H1V A;  2I50 A;  1DF0 A;  3SHB A;  5A24 A;  4XI1 A;  1WEV A;  4PP1 A;  5JG6 A;  4AYC A;  3PHD A;  3S3R A;  2VPD A;  2XU5 A;  1WGM A;  4NV8 A;  4BS5 A;  1QOL A;  2KIZ A;  1GLO A;  4YBS A;  4KLB A;  2G7Y A;  4FK5 A;  2OP3 A;  2UZG A;  3KWZ A;  3CBJ A;  4UP0 A;  4Q8H A;  3O7A A;  2FYE A;  2KFT A;  3MTN A;  2ECI A;  1A6R A;  1HUC B;  2BDZ A;  1F2C A;  2XB1 A;  3VK6 A;  3N3K A;  1W4T A;  2YSJ A;  2MD7 B;  5G0F A;  3O1G A;  3GCB A;  4ZUX U;  2Y5B A;  3L1X A;  1NPZ A;  4AXM A;  2VPB A;  3KW9 A;  1O0E A;  4YYW A;  1AU4 A;  2AUX A;  4OEM A;  2YW8 A;  3P5U A;  2CT2 A;  1STF E;  2FTD A;  2YSM A;  3O37 A;  2L0B A;  1BOR A;  2CSY A;  3T7L A;  2QJ0 A;  4AVX A;  2YUR A;  5KH3 A;  1V87 A;  2NAA A;  2YHO A;  3V6E A;  3BOW A;  2L5U A;  4A49 A;  4X6J A;  3HTK C;  2KE1 A;  2B1N A;  2R9F A;  2C2L A;  2DX8 A;  1PE6 A;  5C11 A;  4OEL A;  2K4D A;  4L58 A;  3B79 A;  3ZYQ A;  2DCB A;  1PPO A;  5EF4 A;  2R9C A;  3MHH A;  2YYR A;  2D8S A;  4IC3 A;  4YAX A;  2XEU A;  3N9L A;  5B76 A;  2F6N A;  1YK8 A;  2HXZ A;  4N4Z A;  5JA7 A;  3GV4 A;  3H6S A;  2DC7 A;  2EGP A;  2XU1 A;  5LKZ A;  2G8J A;  1GEC E;  3F75 A;  3O35 A;  1F62 A;  3U5O A;  2NQD B;  2DC8 A;  2JQF R;  1POP A;  4CDE B;  1DVP A;  2LXP C;  3H89 A;  1KHP A;  2DCD A;  1ZCM A;  1WFK A;  1PPP A;  3RVW A;  2M85 A;  4PI3 A;  1MEM A;  1JM7 A;  2H7J A;  5D1K B;  2LGK A;  3PUQ A;  1MS6 A;  2NQG A;  1MEG A;  4G54 A;  2OXQ C;  5J94 A;  1YT7 A;  4LKA A;  2NQI A;  3I2D A;  1W5R A;  5PAD A;  2L75 A;  1VSN A;  3RVV A;  1KFU L;  2XU4 A;  2DZZ A;  3WXF A;  4UP5 A;  2FRA A;  4BHW A;  3KNV A;  3OIS A;  2KWJ A;  4R8P K;  3DQV R;  4CDD B;  4AYC B;  2ARY A;  5LKU A;  1PBH A;  1TLO A;  3BPM A;  3N9P A;  3RPG B;  3L1Z B;  4B7Y C;  4BSQ A;  2LV9 A;  2YJ9 A;  1IYM A;  3ERV A;  4YYR A;  4CDC B;  3N9N A;  2VHF A;  2G6D A;  1PCI A;  2KGG A;  5TRB A;  1CJL A;  1WES A;  1YVB A;  1PIP A;  3BPF A;  4ZQL A;  1G25 A;  3WXE A;  3RVX A;  4NV7 A;  4GUZ A;  1BGO A;  3E1Z B;  3OVZ A;  1F2B A;  1VJV A;  2VFC A;  4P5O B;  4PPE A;  1CQD A;  1AYU A;  2GHU A;  4YYQ A;  2ECN A;  4GNE A;  4S3O C;  2CB5 A;  2E03 A;  4X6I A;  2ECT A;  3T6R A;  4A4B A;  3OF9 A;  1ATK A;  3O70 A;  1ZIV A;  2PNX A;  2PBH A;  3U8E A;  4YVA A;  2JMJ A;  4C5P A;  1EWL A;  3GL6 A;  3MHS A;  3KKU A;  2YRE A;  3LQI A;  4WZ0 A;  1AYW A;  4C9Z A;  3EB6 A;  3QZV A;  3PUR A;  2DC9 A;  3CBK A;  2VHS A;  3LQJ A;  3V6C A;  3N3G A;  5CHV A;  2MUM A;  4WA6 A;  2YJC A;  2CKL B;  2RSD A;  2MNY A;  2H0D B;  2M6M A;  4I7D A;  1PPD A;  1BQI A;  4CA1 A;  5B78 A;  4WZ3 B;  2KGI A;  4YBT A;  1ME4 A;  2FRQ A;  2ECW A;  4N3W A;  2IBI A;  4I05 A;  5F02 A;  2KWK A;  2FUI A;  1CB5 A;  3QT4 A;  4YAT A;  3M63 A;  2R9O A;  1KXR A;  2CSZ A;  2MD8 C;  1RMD A;  1U5I A;  4Q8G A;  4AP4 A;  4F52 B;  5H9M A;  2MA5 A;  2O6X A;  1WEN A;  4QRV A;  2LRI C;  1XKG A;  2R9N A;  5CVO B;  2YQL A;  2YJ2 A;  2P86 A;  3MOR A;  3PBH A;  1JOC A;  2B1M A;  1BP4 A;  4K7C A;  4QF2 A;  1DEU A;  3U5P A;  3SOX A;  1FBV A;  5EYA F;  5LKT A;  2F6J A;  2R9M A;  4N8W A;  3KV6 A;  3CH3 X;  5TAB A;  1BY8 A;  3K24 A;  4PAD A;  1W6F A;  3NHE A;  1AYV A;  3CH2 X;  2KRE A;  4O64 A;  2LGL A;  2KR4 A;  5TBN A;  3H7D A;  1VYX A;  3ZNI A;  1FH0 A;  1K2F A;  2YT5 A;  1WIM A;  3U5N A;  4W4U A;  3LQH A;  4WZ2 A;  5TDW A;  4YYU A;  3RTR B;  2F7D A;  3USV A;  1FP0 A;  3ZTG A;  3HD3 A;  1ICF A;  5EGW A;  1GCB A;  9PAP A;  2ECJ A;  4CDF B;  2ATO A;  3M99 A;  4L7X A;  2FUD A;  4YAD A;  3IV2 A;  1MM2 A;  4R2Y A;  4XUI A;  4BBQ A;  3LFY A;  3OVX A;  1U6G B;  2VJF A;  3U5M A;  3LRQ A;  4I7B A;  4DMY A;  2G6Q A;  1Q6K A;  3FL2 A;  2L80 A;  3KSE A;  1AU0 A;  2R6N A;  3M62 A;  4BS6 A;  2G8E A;  3ASL A;  2HHN A;  1MDW A;  4QRG A;  1LDK C;  1Y4H A;  1QDQ A;  4FJC A;  1PPN A;  5AIT A;  1LDJ B;  1CHC A;  1AEC A;  3I06 A;  2LN0 A;  1X4J A;  2VPG A;  4NN2 A;  5FB1 A;  3H8B A;  4LJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...