3MHHA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
473
structure length
433
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTTSTNRQTGFIYLLTCAWKINSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQGECNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 127
structure length 433
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhhA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhhA02
1CV8A 2OP3A 2PUYA 2FSAA 4A49A 4A0CD 3V43A 2CKLA 3PHDA 3WXFA 4PP2E 3P5VA 8PCHA 3O33A 3HHIA 2EA6A 4X6IA 3N9PA 2QICA 5B75A 5LKUA 1O0EA 4YYVA 1JOCA 2WBFX 3KX1A 3S3RA 1PIPA 1GCBA 2D8SA 5H1VA 5TBNA 5D1LB 3ZTGA 3N9OA 2IBIA 3N3GA 5TDRA 4YBSA 2YJ9A 4AXLA 4BBQA 2ECIA 3RVVA 2K4DA 4FK5A 3GCBA 4QH6A 1CVZA 3T6RA 4IC3A 1WE9A 1BQIA 2FUUA 3LQHA 2KGIA 1ZIVA 4WA6A 1VFYA 5JG6A 4N4ZA 1F29A 4W5BA 3ASLA 2AVWA 5CVOB 4AXMA 5TRBA 1AYUA 1F2BA 2FT2A 3H7DA 2HHNA 1PADA 4I07A 1WFKA 2YUCA 1YK7A 4CCGX 3CBJA 3H89A 4MZSA 1Z6UA 1PCIA 3GV4A 5EYAF 1WIMA 2I50A 2ATOA 3WXEA 2VPDA 3TNXA 2G6DA 4CDFB 3RVWA 3MHHA 2VNFA 2E6RA 4L58A 4FJCA 1VSNA 4PP1A 1VYXA 4BSQA 3N9MA 3VK6A 3HWNA 1F2AA 2YSMA 4YV8A 1X4JA 4Q8HA 3EB6A 1JM7B 1PPDA 1Y4HA 3ERVA 2Y43A 2VP7A 1KHPA 3PURA 5EGWA 2MD7B 2VJEB 1YK8A 1F2CA 2Y5BA 1PPNA 2AN6A 1MM2A 5G0FA 3K24A 2AYOA 1YALA 1FP0A 4CDCB 1RMDA 2L80A 3N4CA 5K16A 2JMDA 3PUQA 3QJ3A 1QXPA 9PAPA 5F02A 3F5VA 2ECVA 1X4UA 5H1UA 3S3QA 2FTDA 2JQGR 1BORA 3KSEA 5DINA 4BS5A 4K7CA 1PPPA 2LGVA 4YBTA 4I7DA 3CBKA 1PPOA 2KREA 3N9LA 2LGLA 2O6XA 1QMYA 1T1HA 2JQFR 2IDAA 2AYNA 4YYQA 1NL6A 4XI1A 4LLBA 2G8JA 2LGGA 3ZPVE 2LXPC 2ECJA 3T7LA 3U5NA 2G45A 2R9MA 3KKUA 4QRXA 4HWYA 2FO5A 4P6GA 2YREA 2ZETC 4AYCB 2QIZA 3O34A 5FEYA 2FUDA 5B78A 4S3OC 1U9QX 3ZUAA 2LRIC 2YJ8A 4LKAA 1GECE 4L7XA 1KHQA 2DZZA 2MA5A 2R6NA 2C0YA 2F7DA 5H1TA 2CSZA 3RPGC 3P5XA 4QF2A 5D1KB 4I05A 4N8WA 2K16A 5C13A 5LKZA 1CB5A 3CH2X 3BCNA 2VPGA 5H9MA 4Q6FA 2XEUA 1ICFA 2CKLB 5TABA 3HTKC 3H8BA 2VHFA 2OXQC 3L1XA 3OF8A 3KV5A 4YADA 4QRGA 2L5UA 4RY2A 4QBBA 2MUMA 3SOXA 1AYVA 1WEWA 1VJVA 3QSDA 3ZVZB 1EF7A 3KWZA 1M6DA 4X3GA 4I7CA 1ME3A 2IPPB 2G6QA 2PREA 4WZ3B 4GNFA 1SNKA 4YYRA 3KWBX 2DJGB 2DX8A 4GB0A 1AU3A 1PE6A 2YJCA 1BP4A 2EGPA 5KH7A 1NLJA 2MA6A 2RSDA 2XU4A 2ECGA 1QOLA 4QF3A 5JH3A 2FYEA 2KWOA 4NN2A 2AU1A 2AS8A 2L0BA 2DC9A 3M62A 3DPLR 5AITA 4YBMA 3OVZA 3DF0A 2C2LA 3CH3X 1EWMA 2DCAA 2DC6A 2MNZA 4C9ZA 4N4FA 1U9WA 2G7YA 3ZVYA 3HD3A 5D1MB 5FB1A 2L75A 2ARYA 1QDQA 1N87A 2FQ9A 3IUTA 2H7JA 1NB5A 3P5UA 1Q6KA 2NAAA 2LN0A 3NHEA 3O1GA 2YW8A 1CTEA 4AVXA 1PXVA 2M6MA 1MEMA 2VJFB 3PBHA 2KU3A 2MNYA 4YVAA 5B8DA 4CDDB 1WILA 2E03A 5CHVA 2DJFB 5DKAA 2VHSA 2Y6EA 3N9NA 1U9XA 5KH9A 4YYSA 2FUIA 4I04A 1MEGA 2LXHC 2YQMA 4I7BA 2E6SA 1WEEA 1WESA 1ZCMA 2DC7A 3M99A 3O37A 3KNVA 2FRQA 5A24A 2F6JA 3WXGA 1CSBB 3USVA 3KQIA 7PCKA 1Z60A 4OELA 2M3HA 1AECA 3L1ZB 4PPEA 1A6RA 2VJEA 2H0DA 2ACTA 3IHPA 3C9EA 1KFXL 2DCBA 3PDFA 2MT5A 4P6EA 1F62A 5LKXA 4KLBA 3RVXA 4DMXA 3U5PA 1MM3A 5CVMA 4F52B 5FB0A 2BAYA 4V3KC 1WEOA 2VPEA 4N3WA 2KWKA 3HCTA 2UZGA 1KXRA 4S3OB 3O7AA 1KFUL 5J94A 4P5OB 2GFOA 4BHWA 2LQ6A 3F75A 2R9FA 5LCWB 4UP0A 4AUQB 1U9VA 3IMAA 1AYWA 4OEMA 4YATA 2KWJA 1AU0A 1STFE 2CT2A 2F6NA 2JRJA 2E00A 3ZNIA 3C5KA 2RI7A 5G05B 3LQJA 2YHOA 2VPBA 2B1NA 2HXZA 2M1RA 4A4BA 4YC9A 2HD5A 4N79A 4R2YA 2CIOA 3MTNA 1CS8A 2P7UA 2YJ2A 4R8PK 3LRQA 4ZDTA 4W5CA 4XUIA 2XU3A 4BPVA 4B86C 2AUXA 1U6GB 2P86A 4FO9A 6PADA 1S4VA 2YT5A 2F1GA 3LFYA 1BY8A 3OF9A 4O64A 3KFQA 2CSYA 4QRVA 4YAXA 3SOUA 2ECTA 2YURA 1IWDA 1MS6A 3E1ZB 2KFTA 2AIMA 4X6HA 4TKPB 1JQPA 1JM7A 4GNGA 1TU6A 1ZBDB 2B1MA 4PADA 3B79A 5KH3A 1WGMA 1LDJB 3O0UA 5JA7A 1E4UA 2G43A 1G25A 3BWKA 3RTRB 4B7YC 1CJLA 1MDWA 3EB5A 2K1JA 2BDZA 1K3BB 1NQCA 5FERA 2JMIA 3IOQA 3GL6A 4V3LC 4UI9B 2ECNA 1MIRA 3SOWA 1V87A 2PNXA 3MORA 1CPJA 2YHNA 2LV9A 3FL2A 3ZPV1 2XU5A 2PADA 2R9OA 4R7EA 2BDLA 4W4UA 3H8CA 4XR7A 2P0RA 2QJ0A 3H6SA 1Y08A 1THEA 1BGOA 3P5WA 1K2FA 3NG2A 3BPFA 3O70A 5FPWA 4FIPA 1SP4B 2KIZA 1MHWA 3QZVA 2R9CA 3QT4A 4DMYA 1EWLA 3K9MA 4PI3A 2XB1A 5B76A 2CB5A 4PTBA 3N3KA 2YQLA 3PW3A 1XWHA 2OULA 1YT7A 1FBVA 2YSJA 1NPZA 1ME4A 2Y1MA 5TDWA 2KE1A 5I3LA 1CQDA 1AU4A 3D6SA 4LJNA 5C11A 3BPMA 1DEUA 1X4IA 3L11A 3LQIA 3C6WA 3IEJA 3V6EA 2DCDA 1WENA 3U5OA 3RPGB 3HCSA 3KV6A 1LDKC 1AIMA 2ECWA 1XKGA 2KR4A 2E02A 4G54A 4ZQLA 4BS6A 1IYMA 4MSXA 2LDRA 3LXSA 1HYIA 2C2VS 3KW9A 1CHCA 2AUZA 4YYWA 2E01A 2F42A 2M85A 4GNEA 4AYCA 4CA1A 5B79A 2NQAA 1WEPA 2DCCA 1WEUA 1HYJA 2KWNA 4AP4A 3MHSA 1EWOA 1NB3A 2NQDB 2YU4A 4WZ0A 2DZYA 2GHUA 2KGGA 2XU1A 2H0DB 4Q8GA 2PBHA 3U8EA 2L43A 2YYRA 4CDEB 3DQVR 5PADA 1TLOA 5G04B 1TL9A 2LGKA 5AIUA 5EF4A 4A4CA 5B77A 3I3TA 3U5MA 3OISA 1Z2QA 1U5IA 2NQIA 4LK9A 3ZYQA 3M63A 4MVTA 1YVBA 2HYED 5LKTA 1ITOA 5CHTA 3IV2A 2G8EA 2MD8C 1FH0A 3AI8A 4GNDA 4WZ2A 1ATKA 2PNSA 4IC2A 1DF0A 1GLOA 4UP5A 1HUCB 3PNRA 2MIQA 5J3XA 3SHBA 1VD4A 3BOWA 1DVPA 2KYUA 3OVXA 2VJFA 2HDPA 3HCUA 2FRAA 4YYUA 2DC8A 1WEMA 4ZUXU 4X6JA 2K17A 2Y1NA 3BC3A 3O35A 4YABA 2R9NA 1GMYA 3I06A 2JMJA 2OZ2A 3K8UA 1POPA 3N9QA 1X9YA 3HHAA 1PBHA 5CVNB 4LADB 1WEVA 1AU2A 4MZOA 1EWPA 4CZWA 3O36A 3V6CA 3I2DA 4BQVA 2YJBA 1WEQA 2EODA 2HH5A 2NQGA
chains in the Genus database with same CATH superfamily
1CV8A 3PRPA 2OP3A 2PUYA 4Z0OA 3BBAA 2FSAA 4A49A 4A0CD 3V43A 2CKLA 3PHDA 3WXFA 4PP2E 3P5VA 8PCHA 3O33A 4OGEA 3HHIA 2EA6A 4X6IA 3N9PA 2QICA 5B75A 3FAOA 5LKUA 1O0EA 2LAUA 4YYVA 1JOCA 1DCQA 2WBFX 3IFUA 3KX1A 1PIPA 4OVZA 1UKFA 3S3RA 1GCBA 2D8SA 5H1VA 5TBNA 5D1LB 3ZTGA 3N9OA 2IBIA 3N3GA 4RF1A 5TDRA 4YBSA 2YJ9A 4AXLA 4D8IA 4BBQA 2ECIA 3RVVA 2K4DA 4FK5A 3GCBA 4QH6A 1CVZA 3T6RA 4IC3A 1WE9A 1BQIA 2FUUA 3LQHA 2KGIA 1ZIVA 4WA6A 1VFYA 5JG6A 2KKYA 4N4ZA 1F29A 4W5BA 4BOSA 3ASLA 2AVWA 3DWDA 5CVOB 2DJAA 4AXMA 5TRBA 1AYUA 1F2BA 2FT2A 3H7DA 2HHNA 1PADA 4I07A 1WFKA 2YUCA 1YK7A 2MKEA 4CCGX 3CBJA 3H89A 4MZSA 1Z6UA 1PCIA 3GV4A 5EYAF 1WIMA 2I50A 2ATOA 3WXEA 2J7QC 2VPDA 3TNXA 2G6DA 4CDFB 3RVWA 3MHHA 2VNFA 4BOZA 2E6RA 4L58A 4FJCA 1VSNA 4PP1A 1VYXA 4BSQA 3N9MA 3VK6A 3HWNA 1F2AA 2YSMA 4YV8A 1X4JA 3PSEA 4Q8HA 3EB6A 1JM7B 1PPDA 1Y4HA 3E9SA 2Y43A 3ERVA 2VP7A 1KHPA 3PURA 5EGWA 2MD7B 2VJEB 1YK8A 1F2CA 2Y5BA 1PPNA 2AN6A 1MM2A 5G0FA 3K24A 2AYOA 3BY4A 1YALA 1FP0A 4CDCB 1RMDA 2L80A 3N4CA 5K16A 2JMDA 3PUQA 3QJ3A 1QXPA 9PAPA 5F02A 3F5VA 2ECVA 1X4UA 5H1UA 3S3QA 2FTDA 2JQGR 1BORA 2XOCA 5DINA 3KSEA 4BS5A 4K7CA 1PPPA 2LGVA 4YBTA 4I7DA 3CBKA 1PPOA 2CONA 2KREA 2LGLA 3N9LA 2O6XA 2D8UA 3TRKA 4RNAA 1QMYA 1T1HA 2JQFR 2IDAA 2AYNA 4YYQA 1NL6A 4XI1A 3OQCA 4LLBA 2G8JA 2LGGA 4GUAA 3ZPVE 2LXPC 2ECJA 3T7LA 3U5NA 2G45A 2R9MA 3KKUA 4QRXA 4HWYA 2FO5A 4P6GA 2YREA 2ZETC 4AYCB 2P57A 3MTVA 2QIZA 3O34A 5FEYA 2FUDA 5B78A 4S3OC 1U9QX 3ZUAA 2LRIC 2YJ8A 4LKAA 1GECE 4L7XA 3LDYA 1KHQA 2DZZA 2MA5A 2E61A 2C0YA 2F7DA 2R6NA 5H1TA 2CSZA 3RPGC 3P5XA 4QF2A 5D1KB 4I05A 4N8WA 2K16A 5C13A 5LKZA 4QQ4A 3LVRE 1CB5A 3CH2X 5E6JA 3BCNA 2VPGA 5H9MA 4Q6FA 2XEUA 1ICFA 2CKLB 5TABA 3HTKC 5JZEA 3H8BA 2VHFA 2OXQC 4MM3B 3L1XA 3OF8A 3KV5A 4YADA 2BTWB 4QRGA 2L5UA 4RY2A 4QBBA 4OVZB 2MUMA 3SOXA 1AYVA 1WEWA 1VJVA 3O65A 3ZVZB 1EF7A 3KWZA 3QSDA 1M6DA 3C0RA 5EZQA 4X3GA 4I7CA 1ME3A 3PHXA 2IPPB 2CSVA 2G6QA 2PREA 4WZ3B 4GNFA 1SNKA 4YYRA 3KWBX 2DJGB 2DX8A 4GB0A 1AU3A 1PE6A 2YJCA 1BP4A 2EGPA 5KH7A 1NLJA 2MA6A 2RSDA 2XU4A 2ECGA 1QOLA 4IUMA 4QF3A 5JH3A 2FYEA 2KWOA 4NN2A 2AU1A 2AS8A 2L0BA 2DC9A 3M62A 3DPLR 5AITA 4YBMA 3OVZA 3DF0A 2XP0A 2C2LA 3MDBC 3CH3X 1EWMA 2DCAA 2OWAA 2DC6A 2MNZA 4C9ZA 4N4FA 1U9WA 2G7YA 2BTWA 3ZVYA 3HD3A 5D1MB 5FB1A 2L75A 2ARYA 1QDQA 1N87A 2FQ9A 3IUTA 2H7JA 1NB5A 3P5UA 1Q6KA 2NAAA 2LN0A 3NHEA 3O1GA 2YW8A 1CTEA 4AVXA 1PXVA 2M6MA 1MEMA 2VJFB 3PBHA 2KU3A 2MNYA 2UZJA 5SVIB 4YVAA 5B8DA 4CDDB 1WILA 2E03A 5CHVA 2DJFB 5DKAA 2VHSA 2Y6EA 2AGAA 3N9NA 1U9XA 5KH9A 2M13A 4YYSA 2FUIA 4I04A 1MEGA 2LXHC 2YQMA 4I7BA 3JUEA 2E6SA 1WEEA 1WESA 1ZCMA 3M7KA 3M99A 3O37A 2DC7A 1YZBA 3KNVA 4IP3A 4D8EA 4BOUA 2FRQA 5A24A 2F6JA 3WXGA 1CSBB 3USVA 4PT5A 3KQIA 7PCKA 1Z60A 4OELA 2M3HA 1AECA 3L1ZB 4PPEA 1A6RA 2VJEA 2H0DA 3PLWA 2ACTA 3IHPA 2JUNA 1KFXL 2DCBA 3C9EA 3PDFA 2MT5A 4P6EA 3PRMA 1F62A 5LKXA 4KLBA 4ZTBA 3RVXA 3U5PA 4DMXA 1MM3A 5CVMA 4F52B 5FB0A 2BAYA 4V3KC 1WEOA 2VPEA 2JRIA 4N3WA 2KWKA 4XZXA 3HCTA 2EGMA 5K3QA 2UZGA 1KXRA 1PVJA 4S3OB 3O7AA 1KFUL 5J94A 4P5OB 2GFOA 4BHWA 2LQ6A 4H9DA 3F75A 2R9FA 5LCWB 4UP0A 4AUQB 1U9VA 3IMAA 1AYWA 4OEMA 2XOYA 2JM3A 2KWJA 4YATA 1AU0A 1STFE 2FE8A 2CT2A 2F6NA 2JRJA 2E00A 3ZNIA 3RNVA 3C5KA 4D8BA 2RI7A 5G05B 4HXDB 3LQJA 2YHOA 2VPBA 2B1NA 2HXZA 2M1RA 4A4BA 4YC9A 2HD5A 4N79A 4R2YA 2CIOA 3MTNA 1CS8A 2P7UA 2YJ2A 4R3DA 3O47A 4R8PK 3LRQA 4ZDTA 4W5CA 4XUIA 2XU3A 4BPVA 3PHUA 4B86C 2AUXA 1U6GB 2P86A 4FO9A 2HWKA 6PADA 3T9KA 1S4VA 2YT5A 2F1GA 3E2DA 3LJUX 1BY8A 3LFYA 3OF9A 4O64A 3KFQA 2CSYA 4QRVA 4YAXA 4OGCA 3SOUA 3FM8C 3Q1DA 2ECTA 4MI7A 2YURA 3H7HA 3FANA 1IWDA 1MS6A 3E1ZB 4BOPA 2KFTA 2AIMA 2EXUA 4TKPB 4X6HA 1JQPA 1JM7A 4GNGA 1TU6A 2JTCA 1ZBDB 2B1MA 4PADA 3B79A 5KH3A 1WGMA 1LDJB 3O0UA 5JA7A 1E4UA 2FD4A 2G43A 1G25A 5KO3A 3BWKA 3RTRB 4B7YC 3MP2A 1CJLA 1MDWA 3EB5A 2K1JA 5SVIA 2BDZA 3W30A 1K3BB 1NQCA 5FERA 2JMIA 3IOQA 3GL6A 4V3LC 4UI9B 2ECNA 3PHWA 1MIRA 3KDEC 3SOWA 1V87A 2PNXA 2YVRA 3MORA 1CPJA 2YHNA 3PT2A 2LV9A 3FL2A 3ZPV1 2CRRA 2XU5A 2BU3A 3FJUB 2PADA 2R9OA 4R7EA 4OW0A 2BDLA 4W4UA 3H8CA 4XR7A 3SUBA 2P0RA 2QJ0A 3H6SA 4REZA 1Y08A 1THEA 1BGOA 3P5WA 1K2FA 2Z84A 3NG2A 3BPFA 3O70A 5FPWA 4FIPA 1SP4B 2KIZA 1MHWA 3QZVA 2R9CA 3QT4A 1DKIA 4DMYA 1EWLA 3K9MA 5EZSA 4PI3A 2XB1A 5B76A 4O62A 4PTBA 2CB5A 3W31A 3N3KA 2YQLA 3PW3A 1XWHA 2OULA 1YT7A 1FBVA 2YSJA 1NPZA 1ME4A 2Y1MA 5TDWA 2KE1A 5I3LA 1CQDA 1AU4A 3D6SA 4LJNA 5C11A 3BPMA 1DEUA 1X4IA 3L11A 3LQIA 3C6WA 3IEJA 3V6EA 3MJ5A 2DCDA 1WENA 3RPGB 3U5OA 3HCSA 3KV6A 1LDKC 1AIMA 2ECWA 1XKGA 2KR4A 2E02A 4G54A 4ZQLA 4BS6A 1IYMA 4MSXA 2LDRA 3LXSA 2FFWA 1HYIA 2C2VS 3KW9A 1CHCA 2AUZA 4YYWA 2DOSA 3ZNHA 2E01A 2F42A 2M85A 3DDTA 4GNEA 4AYCA 4CA1A 5B79A 2NQAA 1WEPA 2DCCA 1WEUA 1HYJA 2KWNA 4AP4A 3MHSA 1EWOA 1NB3A 2NQDB 2YU4A 1MBMA 4WZ0A 2DZYA 2GHUA 4RKXA 2KGGA 2XU1A 2H0DB 4Q8GA 2PBHA 2B0OE 2L43A 2YYRA 4M0WA 3U8EA 4CDEB 3DQVR 5PADA 1TLOA 5G04B 1TL9A 3B21A 2LGKA 5AIUA 5EF4A 4Z0RA 4A4CA 4F1PA 5B77A 3I3TA 3U5MA 3OISA 1Z2QA 1U5IA 2NQIA 3FEHA 4LK9A 3ZYQA 3M63A 4MVTA 4WURA 1YVBA 2HYED 5LKTA 3BB7A 1ITOA 5SVXA 3IV2A 2G8EA 2MD8C 5CHTA 1FH0A 3AI8A 4GNDA 4WZ2A 1ATKA 2DSMA 2PNSA 4IC2A 1DF0A 1GLOA 4UP5A 1HUCB 3PNRA 2MIQA 5J3XA 3SHBA 1VD4A 3BOWA 1DVPA 2KYUA 3OVXA 2VJFA 3LVQE 2XOZA 4RF0A 2J7QA 2HDPA 3HCUA 2FRAA 4YYUA 2DC8A 2CRWA 1WEMA 5SVYA 4ZUXU 4X6JA 2K17A 2Y1NA 3BC3A 3O35A 4YABA 2R9NA 1GMYA 2RR4A 3I06A 4BOQA 2JMJA 2OZ2A 3K8UA 1POPA 3N9QA 1X9YA 2L7PA 2KKXA 3HHAA 2IQJA 1PBHA 3TMPA 5CVNB 4LADB 1WEVA 1AU2A 4MZOA 1EWPA 4CZWA 3O36A 3V6CA 3I2DA 4P16A 4BQVA 2YJBA 1WEQA 2EODA 2HH5A 2NQGA 4A5UA
chains in the Genus database with same CATH topology
1CV8A 2OP3A 2PUYA 2FSAA 4A49A 4A0CD 3V43A 2CKLA 3PHDA 1GX3A 4PP2E 3WXFA 3P5VA 8PCHA 3O33A 3HHIA 2EA6A 4X6IA 3N9PA 2QICA 5B75A 5LKUA 1O0EA 4YYVA 1JOCA 2VFCA 4BGFA 2WBFX 3KX1A 3S3RA 1PIPA 1GCBA 2D8SA 5H1VA 2VFBA 5TBNA 5D1LB 3ZTGA 3N9OA 2IBIA 3N3GA 4NV8A 3D9WA 5TDRA 4YBSA 2YJ9A 4AXLA 4BBQA 2ECIA 3RVVA 2K4DA 4FK5A 3GCBA 4QH6A 1CVZA 3T6RA 4IC3A 1WE9A 1BQIA 2FUUA 3LQHA 2KGIA 1ZIVA 4WA6A 1VFYA 5JG6A 4N4ZA 1F29A 4W5BA 3ASLA 2AVWA 5CVOB 4AXMA 5TRBA 1AYUA 1F2BA 2FT2A 3H7DA 2HHNA 1PADA 4I07A 1WFKA 2YUCA 1YK7A 4CCGX 3CBJA 3H89A 4MZSA 1Z6UA 1PCIA 3GV4A 5EYAF 1WIMA 2I50A 2ATOA 3WXEA 2VPDA 3TNXA 2G6DA 4CDFB 3RVWA 1W4TA 3MHHA 2VNFA 2E6RA 4L58A 4FJCA 1VSNA 4PP1A 1VYXA 4BSQA 3N9MA 3VK6A 3HWNA 1F2AA 2YSMA 4YV8A 1X4JA 4Q8HA 3EB6A 1JM7B 1PPDA 1Y4HA 3ERVA 2Y43A 2VP7A 1KHPA 3PURA 5EGWA 2MD7B 2VJEB 1YK8A 1F2CA 2Y5BA 1PPNA 2AN6A 1MM2A 5G0FA 3K24A 2AYOA 1YALA 1FP0A 4CDCB 1RMDA 2L80A 3N4CA 5K16A 2JMDA 3PUQA 3QJ3A 1QXPA 9PAPA 5F02A 3F5VA 2ECVA 1X4UA 5H1UA 3S3QA 2FTDA 2JQGR 1BORA 3KSEA 5DINA 4BS5A 4K7CA 1PPPA 2LGVA 4YBTA 4I7DA 3CBKA 4GUZA 1PPOA 2KREA 3N9LA 2LGLA 2O6XA 1QMYA 1T1HA 2JQFR 2IDAA 2AYNA 4YYQA 1NL6A 4XI1A 4LLBA 2G8JA 2LGGA 3ZPVE 2LXPC 2ECJA 3T7LA 3U5NA 2G45A 2R9MA 3KKUA 4QRXA 4HWYA 2FO5A 4P6GA 2YREA 2ZETC 4AYCB 2QIZA 3O34A 5FEYA 2FUDA 5B78A 4S3OC 1U9QX 3ZUAA 2LRIC 2YJ8A 4LKAA 1GECE 4L7XA 1KHQA 2DZZA 2MA5A 2R6NA 2C0YA 2F7DA 5H1TA 2CSZA 3RPGC 1W5RA 3P5XA 4QF2A 5D1KB 4I05A 4N8WA 2K16A 5C13A 5LKZA 1CB5A 3CH2X 3BCNA 2VPGA 5H9MA 2BSZA 4Q6FA 2XEUA 1ICFA 2CKLB 5TABA 3HTKC 3H8BA 2VHFA 2OXQC 3L1XA 3OF8A 3KV5A 4YADA 4QRGA 2L5UA 4RY2A 4QBBA 2MUMA 3SOXA 1AYVA 1WEWA 1VJVA 3QSDA 3ZVZB 1EF7A 3KWZA 1M6DA 4X3GA 4I7CA 1ME3A 2IPPB 2G6QA 2PREA 4WZ3B 4GNFA 1SNKA 4YYRA 3KWBX 2DJGB 2DX8A 4GB0A 1AU3A 1PE6A 2YJCA 1BP4A 2EGPA 5KH7A 1NLJA 2MA6A 2RSDA 2XU4A 2ECGA 1QOLA 4QF3A 5JH3A 2FYEA 2KWOA 4NN2A 2AU1A 2AS8A 2L0BA 2DC9A 3M62A 3DPLR 5AITA 4YBMA 3OVZA 3DF0A 2C2LA 3CH3X 1EWMA 2DCAA 2DC6A 2MNZA 4C9ZA 4N4FA 1U9WA 2G7YA 3ZVYA 3HD3A 5D1MB 5FB1A 2L75A 2ARYA 1QDQA 1N87A 2FQ9A 3IUTA 2H7JA 1NB5A 3P5UA 1Q6KA 2NAAA 2LN0A 4NV7A 3NHEA 3O1GA 2YW8A 1CTEA 4AVXA 1PXVA 2M6MA 1MEMA 2VJFB 3PBHA 2KU3A 2MNYA 1E2TA 4YVAA 5B8DA 4CDDB 1WILA 2E03A 5CHVA 2DJFB 5DKAA 2VHSA 2Y6EA 3N9NA 1U9XA 5KH9A 4YYSA 2FUIA 4I04A 1MEGA 2LXHC 2YQMA 4I7BA 2E6SA 1WEEA 1WESA 1ZCMA 2DC7A 3M99A 3O37A 3KNVA 2FRQA 5A24A 2F6JA 3WXGA 1CSBB 3USVA 3KQIA 7PCKA 1Z60A 4OELA 2M3HA 1AECA 3L1ZB 4PPEA 1A6RA 2VJEA 2H0DA 2ACTA 3IHPA 3C9EA 1KFXL 2DCBA 3PDFA 2MT5A 4P6EA 1F62A 5LKXA 4KLBA 3RVXA 4DMXA 3U5PA 1MM3A 5CVMA 4F52B 5FB0A 2BAYA 4V3KC 1WEOA 2VPEA 4N3WA 2KWKA 3HCTA 2UZGA 1KXRA 4S3OB 3O7AA 1KFUL 5J94A 4P5OB 2GFOA 4BHWA 2LQ6A 3F75A 2R9FA 5LCWB 4UP0A 4AUQB 1U9VA 3IMAA 1AYWA 4OEMA 4YATA 2KWJA 1AU0A 1STFE 2CT2A 2F6NA 2JRJA 2E00A 3ZNIA 3C5KA 2RI7A 5G05B 3LQJA 2YHOA 2VPBA 2B1NA 2HXZA 2M1RA 4A4BA 4YC9A 2HD5A 4N79A 4R2YA 2CIOA 3MTNA 1CS8A 2P7UA 2YJ2A 4R8PK 3LRQA 4ZDTA 4W5CA 4XUIA 2XU3A 4BPVA 4B86C 2AUXA 1U6GB 2P86A 4FO9A 6PADA 1S4VA 2YT5A 2F1GA 3LFYA 1BY8A 3OF9A 4O64A 3KFQA 2CSYA 4QRVA 4YAXA 3SOUA 2ECTA 2YURA 1IWDA 1MS6A 3E1ZB 2KFTA 2AIMA 4X6HA 4TKPB 1JQPA 1JM7A 4GNGA 1TU6A 1ZBDB 2B1MA 4PADA 3B79A 5KH3A 1WGMA 1LDJB 3O0UA 5JA7A 1E4UA 2G43A 1G25A 3BWKA 3RTRB 4B7YC 4B55A 1CJLA 1MDWA 3EB5A 2K1JA 2BDZA 1K3BB 1NQCA 5FERA 2JMIA 3IOQA 4C5PA 3GL6A 4V3LC 4UI9B 2ECNA 1MIRA 3SOWA 1V87A 2PNXA 1W6FA 1CPJA 2YHNA 3MORA 2LV9A 3FL2A 3ZPV1 2XU5A 2PADA 2R9OA 4R7EA 2BDLA 4W4UA 3H8CA 4XR7A 2P0RA 2QJ0A 3H6SA 1Y08A 1THEA 1BGOA 3P5WA 1K2FA 3NG2A 3BPFA 3O70A 5FPWA 4FIPA 1SP4B 2KIZA 1MHWA 3QZVA 2R9CA 3QT4A 4DMYA 1EWLA 3K9MA 4PI3A 2XB1A 5B76A 2CB5A 4PTBA 3N3KA 2YQLA 3PW3A 1XWHA 2OULA 1YT7A 1FBVA 2YSJA 1NPZA 1ME4A 2Y1MA 5TDWA 2KE1A 5I3LA 1CQDA 1AU4A 3D6SA 4LJNA 5C11A 3BPMA 1DEUA 3LTWA 1X4IA 3L11A 3LQIA 3C6WA 3IEJA 3V6EA 2DCDA 1WENA 3U5OA 3RPGB 3HCSA 3KV6A 1LDKC 1AIMA 2ECWA 1XKGA 2KR4A 2E02A 4G54A 4ZQLA 4BS6A 1IYMA 4MSXA 2LDRA 3LXSA 1HYIA 2C2VS 3KW9A 1CHCA 2AUZA 4YYWA 2E01A 2F42A 2M85A 4GNEA 4AYCA 4CA1A 5B79A 2NQAA 1WEPA 2DCCA 1WEUA 1HYJA 2KWNA 4AP4A 3MHSA 1EWOA 1NB3A 2NQDB 2YU4A 4WZ0A 2DZYA 2GHUA 2KGGA 2XU1A 2H0DB 4Q8GA 2PBHA 3U8EA 2L43A 2YYRA 4CDEB 3DQVR 5PADA 1TLOA 5G04B 1TL9A 2LGKA 5AIUA 5EF4A 4A4CA 5B77A 3I3TA 3U5MA 3OISA 1Z2QA 1U5IA 2NQIA 4LK9A 3ZYQA 3M63A 4MVTA 1YVBA 2HYED 5LKTA 1ITOA 5CHTA 3IV2A 2G8EA 2MD8C 1FH0A 3AI8A 4GNDA 4WZ2A 1ATKA 2PNSA 4IC2A 1DF0A 1GLOA 4UP5A 1HUCB 3PNRA 2MIQA 5J3XA 3SHBA 1VD4A 3BOWA 1DVPA 2KYUA 3OVXA 2VJFA 2HDPA 3HCUA 2FRAA 4YYUA 2DC8A 1WEMA 4ZUXU 4X6JA 2K17A 2Y1NA 3BC3A 3O35A 4YABA 2R9NA 1GMYA 3I06A 2JMJA 2OZ2A 3K8UA 1POPA 3N9QA 1X9YA 3HHAA 1PBHA 5CVNB 4LADB 1WEVA 1AU2A 4MZOA 1EWPA 4CZWA 3O36A 3V6CA 3I2DA 4BQVA 2YJBA 1WEQA 2EODA 2HH5A 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CV8 A;  2OP3 A;  2PUY A;  2FSA A;  4A49 A;  4A0C D;  3V43 A;  2CKL A;  3PHD A;  3WXF A;  4PP2 E;  3P5V A;  8PCH A;  3O33 A;  3HHI A;  2EA6 A;  4X6I A;  3N9P A;  2QIC A;  5B75 A;  5LKU A;  1O0E A;  4YYV A;  1JOC A;  2WBF X;  3KX1 A;  3S3R A;  1PIP A;  1GCB A;  2D8S A;  5H1V A;  5TBN A;  5D1L B;  3ZTG A;  3N9O A;  2IBI A;  3N3G A;  5TDR A;  4YBS A;  2YJ9 A;  4AXL A;  4BBQ A;  2ECI A;  3RVV A;  2K4D A;  4FK5 A;  3GCB A;  4QH6 A;  1CVZ A;  3T6R A;  4IC3 A;  1WE9 A;  1BQI A;  2FUU A;  3LQH A;  2KGI A;  1ZIV A;  4WA6 A;  1VFY A;  5JG6 A;  4N4Z A;  1F29 A;  4W5B A;  3ASL A;  2AVW A;  5CVO B;  4AXM A;  5TRB A;  1AYU A;  1F2B A;  2FT2 A;  3H7D A;  2HHN A;  1PAD A;  4I07 A;  1WFK A;  2YUC A;  1YK7 A;  4CCG X;  3CBJ A;  3H89 A;  4MZS A;  1Z6U A;  1PCI A;  3GV4 A;  5EYA F;  1WIM A;  2I50 A;  2ATO A;  3WXE A;  2VPD A;  3TNX A;  2G6D A;  4CDF B;  3RVW A;  3MHH A;  2VNF A;  2E6R A;  4L58 A;  4FJC A;  1VSN A;  4PP1 A;  1VYX A;  4BSQ A;  3N9M A;  3VK6 A;  3HWN A;  1F2A A;  2YSM A;  4YV8 A;  1X4J A;  4Q8H A;  3EB6 A;  1JM7 B;  1PPD A;  1Y4H A;  3ERV A;  2Y43 A;  2VP7 A;  1KHP A;  3PUR A;  5EGW A;  2MD7 B;  2VJE B;  1YK8 A;  1F2C A;  2Y5B A;  1PPN A;  2AN6 A;  1MM2 A;  5G0F A;  3K24 A;  2AYO A;  1YAL A;  1FP0 A;  4CDC B;  1RMD A;  2L80 A;  3N4C A;  5K16 A;  2JMD A;  3PUQ A;  3QJ3 A;  1QXP A;  9PAP A;  5F02 A;  3F5V A;  2ECV A;  1X4U A;  5H1U A;  3S3Q A;  2FTD A;  2JQG R;  1BOR A;  3KSE A;  5DIN A;  4BS5 A;  4K7C A;  1PPP A;  2LGV A;  4YBT A;  4I7D A;  3CBK A;  1PPO A;  2KRE A;  3N9L A;  2LGL A;  2O6X A;  1QMY A;  1T1H A;  2JQF R;  2IDA A;  2AYN A;  4YYQ A;  1NL6 A;  4XI1 A;  4LLB A;  2G8J A;  2LGG A;  3ZPV E;  2LXP C;  2ECJ A;  3T7L A;  3U5N A;  2G45 A;  2R9M A;  3KKU A;  4QRX A;  4HWY A;  2FO5 A;  4P6G A;  2YRE A;  2ZET C;  4AYC B;  2QIZ A;  3O34 A;  5FEY A;  2FUD A;  5B78 A;  4S3O C;  1U9Q X;  3ZUA A;  2LRI C;  2YJ8 A;  4LKA A;  1GEC E;  4L7X A;  1KHQ A;  2DZZ A;  2MA5 A;  2R6N A;  2C0Y A;  2F7D A;  5H1T A;  2CSZ A;  3RPG C;  3P5X A;  4QF2 A;  5D1K B;  4I05 A;  4N8W A;  2K16 A;  5C13 A;  5LKZ A;  1CB5 A;  3CH2 X;  3BCN A;  2VPG A;  5H9M A;  4Q6F A;  2XEU A;  1ICF A;  2CKL B;  5TAB A;  3HTK C;  3H8B A;  2VHF A;  2OXQ C;  3L1X A;  3OF8 A;  3KV5 A;  4YAD A;  4QRG A;  2L5U A;  4RY2 A;  4QBB A;  2MUM A;  3SOX A;  1AYV A;  1WEW A;  1VJV A;  3QSD A;  3ZVZ B;  1EF7 A;  3KWZ A;  1M6D A;  4X3G A;  4I7C A;  1ME3 A;  2IPP B;  2G6Q A;  2PRE A;  4WZ3 B;  4GNF A;  1SNK A;  4YYR A;  3KWB X;  2DJG B;  2DX8 A;  4GB0 A;  1AU3 A;  1PE6 A;  2YJC A;  1BP4 A;  2EGP A;  5KH7 A;  1NLJ A;  2MA6 A;  2RSD A;  2XU4 A;  2ECG A;  1QOL A;  4QF3 A;  5JH3 A;  2FYE A;  2KWO A;  4NN2 A;  2AU1 A;  2AS8 A;  2L0B A;  2DC9 A;  3M62 A;  3DPL R;  5AIT A;  4YBM A;  3OVZ A;  3DF0 A;  2C2L A;  3CH3 X;  1EWM A;  2DCA A;  2DC6 A;  2MNZ A;  4C9Z A;  4N4F A;  1U9W A;  2G7Y A;  3ZVY A;  3HD3 A;  5D1M B;  5FB1 A;  2L75 A;  2ARY A;  1QDQ A;  1N87 A;  2FQ9 A;  3IUT A;  2H7J A;  1NB5 A;  3P5U A;  1Q6K A;  2NAA A;  2LN0 A;  3NHE A;  3O1G A;  2YW8 A;  1CTE A;  4AVX A;  1PXV A;  2M6M A;  1MEM A;  2VJF B;  3PBH A;  2KU3 A;  2MNY A;  4YVA A;  5B8D A;  4CDD B;  1WIL A;  2E03 A;  5CHV A;  2DJF B;  5DKA A;  2VHS A;  2Y6E A;  3N9N A;  1U9X A;  5KH9 A;  4YYS A;  2FUI A;  4I04 A;  1MEG A;  2LXH C;  2YQM A;  4I7B A;  2E6S A;  1WEE A;  1WES A;  1ZCM A;  2DC7 A;  3M99 A;  3O37 A;  3KNV A;  2FRQ A;  5A24 A;  2F6J A;  3WXG A;  1CSB B;  3USV A;  3KQI A;  7PCK A;  1Z60 A;  4OEL A;  2M3H A;  1AEC A;  3L1Z B;  4PPE A;  1A6R A;  2VJE A;  2H0D A;  2ACT A;  3IHP A;  3C9E A;  1KFX L;  2DCB A;  3PDF A;  2MT5 A;  4P6E A;  1F62 A;  5LKX A;  4KLB A;  3RVX A;  4DMX A;  3U5P A;  1MM3 A;  5CVM A;  4F52 B;  5FB0 A;  2BAY A;  4V3K C;  1WEO A;  2VPE A;  4N3W A;  2KWK A;  3HCT A;  2UZG A;  1KXR A;  4S3O B;  3O7A A;  1KFU L;  5J94 A;  4P5O B;  2GFO A;  4BHW A;  2LQ6 A;  3F75 A;  2R9F A;  5LCW B;  4UP0 A;  4AUQ B;  1U9V A;  3IMA A;  1AYW A;  4OEM A;  4YAT A;  2KWJ A;  1AU0 A;  1STF E;  2CT2 A;  2F6N A;  2JRJ A;  2E00 A;  3ZNI A;  3C5K A;  2RI7 A;  5G05 B;  3LQJ A;  2YHO A;  2VPB A;  2B1N A;  2HXZ A;  2M1R A;  4A4B A;  4YC9 A;  2HD5 A;  4N79 A;  4R2Y A;  2CIO A;  3MTN A;  1CS8 A;  2P7U A;  2YJ2 A;  4R8P K;  3LRQ A;  4ZDT A;  4W5C A;  4XUI A;  2XU3 A;  4BPV A;  4B86 C;  2AUX A;  1U6G B;  2P86 A;  4FO9 A;  6PAD A;  1S4V A;  2YT5 A;  2F1G A;  3LFY A;  1BY8 A;  3OF9 A;  4O64 A;  3KFQ A;  2CSY A;  4QRV A;  4YAX A;  3SOU A;  2ECT A;  2YUR A;  1IWD A;  1MS6 A;  3E1Z B;  2KFT A;  2AIM A;  4X6H A;  4TKP B;  1JQP A;  1JM7 A;  4GNG A;  1TU6 A;  1ZBD B;  2B1M A;  4PAD A;  3B79 A;  5KH3 A;  1WGM A;  1LDJ B;  3O0U A;  5JA7 A;  1E4U A;  2G43 A;  1G25 A;  3BWK A;  3RTR B;  4B7Y C;  1CJL A;  1MDW A;  3EB5 A;  2K1J A;  2BDZ A;  1K3B B;  1NQC A;  5FER A;  2JMI A;  3IOQ A;  3GL6 A;  4V3L C;  4UI9 B;  2ECN A;  1MIR A;  3SOW A;  1V87 A;  2PNX A;  3MOR A;  1CPJ A;  2YHN A;  2LV9 A;  3FL2 A;  3ZPV 1;  2XU5 A;  2PAD A;  2R9O A;  4R7E A;  2BDL A;  4W4U A;  3H8C A;  4XR7 A;  2P0R A;  2QJ0 A;  3H6S A;  1Y08 A;  1THE A;  1BGO A;  3P5W A;  1K2F A;  3NG2 A;  3BPF A;  3O70 A;  5FPW A;  4FIP A;  1SP4 B;  2KIZ A;  1MHW A;  3QZV A;  2R9C A;  3QT4 A;  4DMY A;  1EWL A;  3K9M A;  4PI3 A;  2XB1 A;  5B76 A;  2CB5 A;  4PTB A;  3N3K A;  2YQL A;  3PW3 A;  1XWH A;  2OUL A;  1YT7 A;  1FBV A;  2YSJ A;  1NPZ A;  1ME4 A;  2Y1M A;  5TDW A;  2KE1 A;  5I3L A;  1CQD A;  1AU4 A;  3D6S A;  4LJN A;  5C11 A;  3BPM A;  1DEU A;  1X4I A;  3L11 A;  3LQI A;  3C6W A;  3IEJ A;  3V6E A;  2DCD A;  1WEN A;  3U5O A;  3RPG B;  3HCS A;  3KV6 A;  1LDK C;  1AIM A;  2ECW A;  1XKG A;  2KR4 A;  2E02 A;  4G54 A;  4ZQL A;  4BS6 A;  1IYM A;  4MSX A;  2LDR A;  3LXS A;  1HYI A;  2C2V S;  3KW9 A;  1CHC A;  2AUZ A;  4YYW A;  2E01 A;  2F42 A;  2M85 A;  4GNE A;  4AYC A;  4CA1 A;  5B79 A;  2NQA A;  1WEP A;  2DCC A;  1WEU A;  1HYJ A;  2KWN A;  4AP4 A;  3MHS A;  1EWO A;  1NB3 A;  2NQD B;  2YU4 A;  4WZ0 A;  2DZY A;  2GHU A;  2KGG A;  2XU1 A;  2H0D B;  4Q8G A;  2PBH A;  3U8E A;  2L43 A;  2YYR A;  4CDE B;  3DQV R;  5PAD A;  1TLO A;  5G04 B;  1TL9 A;  2LGK A;  5AIU A;  5EF4 A;  4A4C A;  5B77 A;  3I3T A;  3U5M A;  3OIS A;  1Z2Q A;  1U5I A;  2NQI A;  4LK9 A;  3ZYQ A;  3M63 A;  4MVT A;  1YVB A;  2HYE D;  5LKT A;  1ITO A;  5CHT A;  3IV2 A;  2G8E A;  2MD8 C;  1FH0 A;  3AI8 A;  4GND A;  4WZ2 A;  1ATK A;  2PNS A;  4IC2 A;  1DF0 A;  1GLO A;  4UP5 A;  1HUC B;  3PNR A;  2MIQ A;  5J3X A;  3SHB A;  1VD4 A;  3BOW A;  1DVP A;  2KYU A;  3OVX A;  2VJF A;  2HDP A;  3HCU A;  2FRA A;  4YYU A;  2DC8 A;  1WEM A;  4ZUX U;  4X6J A;  2K17 A;  2Y1N A;  3BC3 A;  3O35 A;  4YAB A;  2R9N A;  1GMY A;  3I06 A;  2JMJ A;  2OZ2 A;  3K8U A;  1POP A;  3N9Q A;  1X9Y A;  3HHA A;  1PBH A;  5CVN B;  4LAD B;  1WEV A;  1AU2 A;  4MZO A;  1EWP A;  4CZW A;  3O36 A;  3V6C A;  3I2D A;  4BQV A;  2YJB A;  1WEQ A;  2EOD A;  2HH5 A;  2NQG A; 
#chains in the Genus database with same CATH topology
 1CV8 A;  3PRP A;  2OP3 A;  2PUY A;  4Z0O A;  3BBA A;  2FSA A;  4A49 A;  4A0C D;  3V43 A;  2CKL A;  3PHD A;  3WXF A;  4PP2 E;  3P5V A;  8PCH A;  3O33 A;  4OGE A;  3HHI A;  2EA6 A;  4X6I A;  3N9P A;  2QIC A;  5B75 A;  3FAO A;  5LKU A;  1O0E A;  2LAU A;  4YYV A;  1JOC A;  1DCQ A;  2WBF X;  3IFU A;  3KX1 A;  1PIP A;  4OVZ A;  1UKF A;  3S3R A;  1GCB A;  2D8S A;  5H1V A;  5TBN A;  5D1L B;  3ZTG A;  3N9O A;  2IBI A;  3N3G A;  4RF1 A;  5TDR A;  4YBS A;  2YJ9 A;  4AXL A;  4D8I A;  4BBQ A;  2ECI A;  3RVV A;  2K4D A;  4FK5 A;  3GCB A;  4QH6 A;  1CVZ A;  3T6R A;  4IC3 A;  1WE9 A;  1BQI A;  2FUU A;  3LQH A;  2KGI A;  1ZIV A;  4WA6 A;  1VFY A;  5JG6 A;  2KKY A;  4N4Z A;  1F29 A;  4W5B A;  4BOS A;  3ASL A;  2AVW A;  3DWD A;  5CVO B;  2DJA A;  4AXM A;  5TRB A;  1AYU A;  1F2B A;  2FT2 A;  3H7D A;  2HHN A;  1PAD A;  4I07 A;  1WFK A;  2YUC A;  1YK7 A;  2MKE A;  4CCG X;  3CBJ A;  3H89 A;  4MZS A;  1Z6U A;  1PCI A;  3GV4 A;  5EYA F;  1WIM A;  2I50 A;  2ATO A;  3WXE A;  2J7Q C;  2VPD A;  3TNX A;  2G6D A;  4CDF B;  3RVW A;  3MHH A;  2VNF A;  4BOZ A;  2E6R A;  4L58 A;  4FJC A;  1VSN A;  4PP1 A;  1VYX A;  4BSQ A;  3N9M A;  3VK6 A;  3HWN A;  1F2A A;  2YSM A;  4YV8 A;  1X4J A;  3PSE A;  4Q8H A;  3EB6 A;  1JM7 B;  1PPD A;  1Y4H A;  3E9S A;  2Y43 A;  3ERV A;  2VP7 A;  1KHP A;  3PUR A;  5EGW A;  2MD7 B;  2VJE B;  1YK8 A;  1F2C A;  2Y5B A;  1PPN A;  2AN6 A;  1MM2 A;  5G0F A;  3K24 A;  2AYO A;  3BY4 A;  1YAL A;  1FP0 A;  4CDC B;  1RMD A;  2L80 A;  3N4C A;  5K16 A;  2JMD A;  3PUQ A;  3QJ3 A;  1QXP A;  9PAP A;  5F02 A;  3F5V A;  2ECV A;  1X4U A;  5H1U A;  3S3Q A;  2FTD A;  2JQG R;  1BOR A;  2XOC A;  5DIN A;  3KSE A;  4BS5 A;  4K7C A;  1PPP A;  2LGV A;  4YBT A;  4I7D A;  3CBK A;  1PPO A;  2CON A;  2KRE A;  2LGL A;  3N9L A;  2O6X A;  2D8U A;  3TRK A;  4RNA A;  1QMY A;  1T1H A;  2JQF R;  2IDA A;  2AYN A;  4YYQ A;  1NL6 A;  4XI1 A;  3OQC A;  4LLB A;  2G8J A;  2LGG A;  4GUA A;  3ZPV E;  2LXP C;  2ECJ A;  3T7L A;  3U5N A;  2G45 A;  2R9M A;  3KKU A;  4QRX A;  4HWY A;  2FO5 A;  4P6G A;  2YRE A;  2ZET C;  4AYC B;  2P57 A;  3MTV A;  2QIZ A;  3O34 A;  5FEY A;  2FUD A;  5B78 A;  4S3O C;  1U9Q X;  3ZUA A;  2LRI C;  2YJ8 A;  4LKA A;  1GEC E;  4L7X A;  3LDY A;  1KHQ A;  2DZZ A;  2MA5 A;  2E61 A;  2C0Y A;  2F7D A;  2R6N A;  5H1T A;  2CSZ A;  3RPG C;  3P5X A;  4QF2 A;  5D1K B;  4I05 A;  4N8W A;  2K16 A;  5C13 A;  5LKZ A;  4QQ4 A;  3LVR E;  1CB5 A;  3CH2 X;  5E6J A;  3BCN A;  2VPG A;  5H9M A;  4Q6F A;  2XEU A;  1ICF A;  2CKL B;  5TAB A;  3HTK C;  5JZE A;  3H8B A;  2VHF A;  2OXQ C;  4MM3 B;  3L1X A;  3OF8 A;  3KV5 A;  4YAD A;  2BTW B;  4QRG A;  2L5U A;  4RY2 A;  4QBB A;  4OVZ B;  2MUM A;  3SOX A;  1AYV A;  1WEW A;  1VJV A;  3O65 A;  3ZVZ B;  1EF7 A;  3KWZ A;  3QSD A;  1M6D A;  3C0R A;  5EZQ A;  4X3G A;  4I7C A;  1ME3 A;  3PHX A;  2IPP B;  2CSV A;  2G6Q A;  2PRE A;  4WZ3 B;  4GNF A;  1SNK A;  4YYR A;  3KWB X;  2DJG B;  2DX8 A;  4GB0 A;  1AU3 A;  1PE6 A;  2YJC A;  1BP4 A;  2EGP A;  5KH7 A;  1NLJ A;  2MA6 A;  2RSD A;  2XU4 A;  2ECG A;  1QOL A;  4IUM A;  4QF3 A;  5JH3 A;  2FYE A;  2KWO A;  4NN2 A;  2AU1 A;  2AS8 A;  2L0B A;  2DC9 A;  3M62 A;  3DPL R;  5AIT A;  4YBM A;  3OVZ A;  3DF0 A;  2XP0 A;  2C2L A;  3MDB C;  3CH3 X;  1EWM A;  2DCA A;  2OWA A;  2DC6 A;  2MNZ A;  4C9Z A;  4N4F A;  1U9W A;  2G7Y A;  2BTW A;  3ZVY A;  3HD3 A;  5D1M B;  5FB1 A;  2L75 A;  2ARY A;  1QDQ A;  1N87 A;  2FQ9 A;  3IUT A;  2H7J A;  1NB5 A;  3P5U A;  1Q6K A;  2NAA A;  2LN0 A;  3NHE A;  3O1G A;  2YW8 A;  1CTE A;  4AVX A;  1PXV A;  2M6M A;  1MEM A;  2VJF B;  3PBH A;  2KU3 A;  2MNY A;  2UZJ A;  5SVI B;  4YVA A;  5B8D A;  4CDD B;  1WIL A;  2E03 A;  5CHV A;  2DJF B;  5DKA A;  2VHS A;  2Y6E A;  2AGA A;  3N9N A;  1U9X A;  5KH9 A;  2M13 A;  4YYS A;  2FUI A;  4I04 A;  1MEG A;  2LXH C;  2YQM A;  4I7B A;  3JUE A;  2E6S A;  1WEE A;  1WES A;  1ZCM A;  3M7K A;  3M99 A;  3O37 A;  2DC7 A;  1YZB A;  3KNV A;  4IP3 A;  4D8E A;  4BOU A;  2FRQ A;  5A24 A;  2F6J A;  3WXG A;  1CSB B;  3USV A;  4PT5 A;  3KQI A;  7PCK A;  1Z60 A;  4OEL A;  2M3H A;  1AEC A;  3L1Z B;  4PPE A;  1A6R A;  2VJE A;  2H0D A;  3PLW A;  2ACT A;  3IHP A;  2JUN A;  1KFX L;  2DCB A;  3C9E A;  3PDF A;  2MT5 A;  4P6E A;  3PRM A;  1F62 A;  5LKX A;  4KLB A;  4ZTB A;  3RVX A;  3U5P A;  4DMX A;  1MM3 A;  5CVM A;  4F52 B;  5FB0 A;  2BAY A;  4V3K C;  1WEO A;  2VPE A;  2JRI A;  4N3W A;  2KWK A;  4XZX A;  3HCT A;  2EGM A;  5K3Q A;  2UZG A;  1KXR A;  1PVJ A;  4S3O B;  3O7A A;  1KFU L;  5J94 A;  4P5O B;  2GFO A;  4BHW A;  2LQ6 A;  4H9D A;  3F75 A;  2R9F A;  5LCW B;  4UP0 A;  4AUQ B;  1U9V A;  3IMA A;  1AYW A;  4OEM A;  2XOY A;  2JM3 A;  2KWJ A;  4YAT A;  1AU0 A;  1STF E;  2FE8 A;  2CT2 A;  2F6N A;  2JRJ A;  2E00 A;  3ZNI A;  3RNV A;  3C5K A;  4D8B A;  2RI7 A;  5G05 B;  4HXD B;  3LQJ A;  2YHO A;  2VPB A;  2B1N A;  2HXZ A;  2M1R A;  4A4B A;  4YC9 A;  2HD5 A;  4N79 A;  4R2Y A;  2CIO A;  3MTN A;  1CS8 A;  2P7U A;  2YJ2 A;  4R3D A;  3O47 A;  4R8P K;  3LRQ A;  4ZDT A;  4W5C A;  4XUI A;  2XU3 A;  4BPV A;  3PHU A;  4B86 C;  2AUX A;  1U6G B;  2P86 A;  4FO9 A;  2HWK A;  6PAD A;  3T9K A;  1S4V A;  2YT5 A;  2F1G A;  3E2D A;  3LJU X;  1BY8 A;  3LFY A;  3OF9 A;  4O64 A;  3KFQ A;  2CSY A;  4QRV A;  4YAX A;  4OGC A;  3SOU A;  3FM8 C;  3Q1D A;  2ECT A;  4MI7 A;  2YUR A;  3H7H A;  3FAN A;  1IWD A;  1MS6 A;  3E1Z B;  4BOP A;  2KFT A;  2AIM A;  2EXU A;  4TKP B;  4X6H A;  1JQP A;  1JM7 A;  4GNG A;  1TU6 A;  2JTC A;  1ZBD B;  2B1M A;  4PAD A;  3B79 A;  5KH3 A;  1WGM A;  1LDJ B;  3O0U A;  5JA7 A;  1E4U A;  2FD4 A;  2G43 A;  1G25 A;  5KO3 A;  3BWK A;  3RTR B;  4B7Y C;  3MP2 A;  1CJL A;  1MDW A;  3EB5 A;  2K1J A;  5SVI A;  2BDZ A;  3W30 A;  1K3B B;  1NQC A;  5FER A;  2JMI A;  3IOQ A;  3GL6 A;  4V3L C;  4UI9 B;  2ECN A;  3PHW A;  1MIR A;  3KDE C;  3SOW A;  1V87 A;  2PNX A;  2YVR A;  3MOR A;  1CPJ A;  2YHN A;  3PT2 A;  2LV9 A;  3FL2 A;  3ZPV 1;  2CRR A;  2XU5 A;  2BU3 A;  3FJU B;  2PAD A;  2R9O A;  4R7E A;  4OW0 A;  2BDL A;  4W4U A;  3H8C A;  4XR7 A;  3SUB A;  2P0R A;  2QJ0 A;  3H6S A;  4REZ A;  1Y08 A;  1THE A;  1BGO A;  3P5W A;  1K2F A;  2Z84 A;  3NG2 A;  3BPF A;  3O70 A;  5FPW A;  4FIP A;  1SP4 B;  2KIZ A;  1MHW A;  3QZV A;  2R9C A;  3QT4 A;  1DKI A;  4DMY A;  1EWL A;  3K9M A;  5EZS A;  4PI3 A;  2XB1 A;  5B76 A;  4O62 A;  4PTB A;  2CB5 A;  3W31 A;  3N3K A;  2YQL A;  3PW3 A;  1XWH A;  2OUL A;  1YT7 A;  1FBV A;  2YSJ A;  1NPZ A;  1ME4 A;  2Y1M A;  5TDW A;  2KE1 A;  5I3L A;  1CQD A;  1AU4 A;  3D6S A;  4LJN A;  5C11 A;  3BPM A;  1DEU A;  1X4I A;  3L11 A;  3LQI A;  3C6W A;  3IEJ A;  3V6E A;  3MJ5 A;  2DCD A;  1WEN A;  3RPG B;  3U5O A;  3HCS A;  3KV6 A;  1LDK C;  1AIM A;  2ECW A;  1XKG A;  2KR4 A;  2E02 A;  4G54 A;  4ZQL A;  4BS6 A;  1IYM A;  4MSX A;  2LDR A;  3LXS A;  2FFW A;  1HYI A;  2C2V S;  3KW9 A;  1CHC A;  2AUZ A;  4YYW A;  2DOS A;  3ZNH A;  2E01 A;  2F42 A;  2M85 A;  3DDT A;  4GNE A;  4AYC A;  4CA1 A;  5B79 A;  2NQA A;  1WEP A;  2DCC A;  1WEU A;  1HYJ A;  2KWN A;  4AP4 A;  3MHS A;  1EWO A;  1NB3 A;  2NQD B;  2YU4 A;  1MBM A;  4WZ0 A;  2DZY A;  2GHU A;  4RKX A;  2KGG A;  2XU1 A;  2H0D B;  4Q8G A;  2PBH A;  2B0O E;  2L43 A;  2YYR A;  4M0W A;  3U8E A;  4CDE B;  3DQV R;  5PAD A;  1TLO A;  5G04 B;  1TL9 A;  3B21 A;  2LGK A;  5AIU A;  5EF4 A;  4Z0R A;  4A4C A;  4F1P A;  5B77 A;  3I3T A;  3U5M A;  3OIS A;  1Z2Q A;  1U5I A;  2NQI A;  3FEH A;  4LK9 A;  3ZYQ A;  3M63 A;  4MVT A;  4WUR A;  1YVB A;  2HYE D;  5LKT A;  3BB7 A;  1ITO A;  5SVX A;  3IV2 A;  2G8E A;  2MD8 C;  5CHT A;  1FH0 A;  3AI8 A;  4GND A;  4WZ2 A;  1ATK A;  2DSM A;  2PNS A;  4IC2 A;  1DF0 A;  1GLO A;  4UP5 A;  1HUC B;  3PNR A;  2MIQ A;  5J3X A;  3SHB A;  1VD4 A;  3BOW A;  1DVP A;  2KYU A;  3OVX A;  2VJF A;  3LVQ E;  2XOZ A;  4RF0 A;  2J7Q A;  2HDP A;  3HCU A;  2FRA A;  4YYU A;  2DC8 A;  2CRW A;  1WEM A;  5SVY A;  4ZUX U;  4X6J A;  2K17 A;  2Y1N A;  3BC3 A;  3O35 A;  4YAB A;  2R9N A;  1GMY A;  2RR4 A;  3I06 A;  4BOQ A;  2JMJ A;  2OZ2 A;  3K8U A;  1POP A;  3N9Q A;  1X9Y A;  2L7P A;  2KKX A;  3HHA A;  2IQJ A;  1PBH A;  3TMP A;  5CVN B;  4LAD B;  1WEV A;  1AU2 A;  4MZO A;  1EWP A;  4CZW A;  3O36 A;  3V6C A;  3I2D A;  4P16 A;  4BQV A;  2YJB A;  1WEQ A;  2EOD A;  2HH5 A;  2NQG A;  4A5U A; 
#chains in the Genus database with same CATH homology
 1CV8 A;  2OP3 A;  2PUY A;  2FSA A;  4A49 A;  4A0C D;  3V43 A;  2CKL A;  3PHD A;  1GX3 A;  4PP2 E;  3WXF A;  3P5V A;  8PCH A;  3O33 A;  3HHI A;  2EA6 A;  4X6I A;  3N9P A;  2QIC A;  5B75 A;  5LKU A;  1O0E A;  4YYV A;  1JOC A;  2VFC A;  4BGF A;  2WBF X;  3KX1 A;  3S3R A;  1PIP A;  1GCB A;  2D8S A;  5H1V A;  2VFB A;  5TBN A;  5D1L B;  3ZTG A;  3N9O A;  2IBI A;  3N3G A;  4NV8 A;  3D9W A;  5TDR A;  4YBS A;  2YJ9 A;  4AXL A;  4BBQ A;  2ECI A;  3RVV A;  2K4D A;  4FK5 A;  3GCB A;  4QH6 A;  1CVZ A;  3T6R A;  4IC3 A;  1WE9 A;  1BQI A;  2FUU A;  3LQH A;  2KGI A;  1ZIV A;  4WA6 A;  1VFY A;  5JG6 A;  4N4Z A;  1F29 A;  4W5B A;  3ASL A;  2AVW A;  5CVO B;  4AXM A;  5TRB A;  1AYU A;  1F2B A;  2FT2 A;  3H7D A;  2HHN A;  1PAD A;  4I07 A;  1WFK A;  2YUC A;  1YK7 A;  4CCG X;  3CBJ A;  3H89 A;  4MZS A;  1Z6U A;  1PCI A;  3GV4 A;  5EYA F;  1WIM A;  2I50 A;  2ATO A;  3WXE A;  2VPD A;  3TNX A;  2G6D A;  4CDF B;  3RVW A;  1W4T A;  3MHH A;  2VNF A;  2E6R A;  4L58 A;  4FJC A;  1VSN A;  4PP1 A;  1VYX A;  4BSQ A;  3N9M A;  3VK6 A;  3HWN A;  1F2A A;  2YSM A;  4YV8 A;  1X4J A;  4Q8H A;  3EB6 A;  1JM7 B;  1PPD A;  1Y4H A;  3ERV A;  2Y43 A;  2VP7 A;  1KHP A;  3PUR A;  5EGW A;  2MD7 B;  2VJE B;  1YK8 A;  1F2C A;  2Y5B A;  1PPN A;  2AN6 A;  1MM2 A;  5G0F A;  3K24 A;  2AYO A;  1YAL A;  1FP0 A;  4CDC B;  1RMD A;  2L80 A;  3N4C A;  5K16 A;  2JMD A;  3PUQ A;  3QJ3 A;  1QXP A;  9PAP A;  5F02 A;  3F5V A;  2ECV A;  1X4U A;  5H1U A;  3S3Q A;  2FTD A;  2JQG R;  1BOR A;  3KSE A;  5DIN A;  4BS5 A;  4K7C A;  1PPP A;  2LGV A;  4YBT A;  4I7D A;  3CBK A;  4GUZ A;  1PPO A;  2KRE A;  3N9L A;  2LGL A;  2O6X A;  1QMY A;  1T1H A;  2JQF R;  2IDA A;  2AYN A;  4YYQ A;  1NL6 A;  4XI1 A;  4LLB A;  2G8J A;  2LGG A;  3ZPV E;  2LXP C;  2ECJ A;  3T7L A;  3U5N A;  2G45 A;  2R9M A;  3KKU A;  4QRX A;  4HWY A;  2FO5 A;  4P6G A;  2YRE A;  2ZET C;  4AYC B;  2QIZ A;  3O34 A;  5FEY A;  2FUD A;  5B78 A;  4S3O C;  1U9Q X;  3ZUA A;  2LRI C;  2YJ8 A;  4LKA A;  1GEC E;  4L7X A;  1KHQ A;  2DZZ A;  2MA5 A;  2R6N A;  2C0Y A;  2F7D A;  5H1T A;  2CSZ A;  3RPG C;  1W5R A;  3P5X A;  4QF2 A;  5D1K B;  4I05 A;  4N8W A;  2K16 A;  5C13 A;  5LKZ A;  1CB5 A;  3CH2 X;  3BCN A;  2VPG A;  5H9M A;  2BSZ A;  4Q6F A;  2XEU A;  1ICF A;  2CKL B;  5TAB A;  3HTK C;  3H8B A;  2VHF A;  2OXQ C;  3L1X A;  3OF8 A;  3KV5 A;  4YAD A;  4QRG A;  2L5U A;  4RY2 A;  4QBB A;  2MUM A;  3SOX A;  1AYV A;  1WEW A;  1VJV A;  3QSD A;  3ZVZ B;  1EF7 A;  3KWZ A;  1M6D A;  4X3G A;  4I7C A;  1ME3 A;  2IPP B;  2G6Q A;  2PRE A;  4WZ3 B;  4GNF A;  1SNK A;  4YYR A;  3KWB X;  2DJG B;  2DX8 A;  4GB0 A;  1AU3 A;  1PE6 A;  2YJC A;  1BP4 A;  2EGP A;  5KH7 A;  1NLJ A;  2MA6 A;  2RSD A;  2XU4 A;  2ECG A;  1QOL A;  4QF3 A;  5JH3 A;  2FYE A;  2KWO A;  4NN2 A;  2AU1 A;  2AS8 A;  2L0B A;  2DC9 A;  3M62 A;  3DPL R;  5AIT A;  4YBM A;  3OVZ A;  3DF0 A;  2C2L A;  3CH3 X;  1EWM A;  2DCA A;  2DC6 A;  2MNZ A;  4C9Z A;  4N4F A;  1U9W A;  2G7Y A;  3ZVY A;  3HD3 A;  5D1M B;  5FB1 A;  2L75 A;  2ARY A;  1QDQ A;  1N87 A;  2FQ9 A;  3IUT A;  2H7J A;  1NB5 A;  3P5U A;  1Q6K A;  2NAA A;  2LN0 A;  4NV7 A;  3NHE A;  3O1G A;  2YW8 A;  1CTE A;  4AVX A;  1PXV A;  2M6M A;  1MEM A;  2VJF B;  3PBH A;  2KU3 A;  2MNY A;  1E2T A;  4YVA A;  5B8D A;  4CDD B;  1WIL A;  2E03 A;  5CHV A;  2DJF B;  5DKA A;  2VHS A;  2Y6E A;  3N9N A;  1U9X A;  5KH9 A;  4YYS A;  2FUI A;  4I04 A;  1MEG A;  2LXH C;  2YQM A;  4I7B A;  2E6S A;  1WEE A;  1WES A;  1ZCM A;  2DC7 A;  3M99 A;  3O37 A;  3KNV A;  2FRQ A;  5A24 A;  2F6J A;  3WXG A;  1CSB B;  3USV A;  3KQI A;  7PCK A;  1Z60 A;  4OEL A;  2M3H A;  1AEC A;  3L1Z B;  4PPE A;  1A6R A;  2VJE A;  2H0D A;  2ACT A;  3IHP A;  3C9E A;  1KFX L;  2DCB A;  3PDF A;  2MT5 A;  4P6E A;  1F62 A;  5LKX A;  4KLB A;  3RVX A;  4DMX A;  3U5P A;  1MM3 A;  5CVM A;  4F52 B;  5FB0 A;  2BAY A;  4V3K C;  1WEO A;  2VPE A;  4N3W A;  2KWK A;  3HCT A;  2UZG A;  1KXR A;  4S3O B;  3O7A A;  1KFU L;  5J94 A;  4P5O B;  2GFO A;  4BHW A;  2LQ6 A;  3F75 A;  2R9F A;  5LCW B;  4UP0 A;  4AUQ B;  1U9V A;  3IMA A;  1AYW A;  4OEM A;  4YAT A;  2KWJ A;  1AU0 A;  1STF E;  2CT2 A;  2F6N A;  2JRJ A;  2E00 A;  3ZNI A;  3C5K A;  2RI7 A;  5G05 B;  3LQJ A;  2YHO A;  2VPB A;  2B1N A;  2HXZ A;  2M1R A;  4A4B A;  4YC9 A;  2HD5 A;  4N79 A;  4R2Y A;  2CIO A;  3MTN A;  1CS8 A;  2P7U A;  2YJ2 A;  4R8P K;  3LRQ A;  4ZDT A;  4W5C A;  4XUI A;  2XU3 A;  4BPV A;  4B86 C;  2AUX A;  1U6G B;  2P86 A;  4FO9 A;  6PAD A;  1S4V A;  2YT5 A;  2F1G A;  3LFY A;  1BY8 A;  3OF9 A;  4O64 A;  3KFQ A;  2CSY A;  4QRV A;  4YAX A;  3SOU A;  2ECT A;  2YUR A;  1IWD A;  1MS6 A;  3E1Z B;  2KFT A;  2AIM A;  4X6H A;  4TKP B;  1JQP A;  1JM7 A;  4GNG A;  1TU6 A;  1ZBD B;  2B1M A;  4PAD A;  3B79 A;  5KH3 A;  1WGM A;  1LDJ B;  3O0U A;  5JA7 A;  1E4U A;  2G43 A;  1G25 A;  3BWK A;  3RTR B;  4B7Y C;  4B55 A;  1CJL A;  1MDW A;  3EB5 A;  2K1J A;  2BDZ A;  1K3B B;  1NQC A;  5FER A;  2JMI A;  3IOQ A;  4C5P A;  3GL6 A;  4V3L C;  4UI9 B;  2ECN A;  1MIR A;  3SOW A;  1V87 A;  2PNX A;  1W6F A;  1CPJ A;  2YHN A;  3MOR A;  2LV9 A;  3FL2 A;  3ZPV 1;  2XU5 A;  2PAD A;  2R9O A;  4R7E A;  2BDL A;  4W4U A;  3H8C A;  4XR7 A;  2P0R A;  2QJ0 A;  3H6S A;  1Y08 A;  1THE A;  1BGO A;  3P5W A;  1K2F A;  3NG2 A;  3BPF A;  3O70 A;  5FPW A;  4FIP A;  1SP4 B;  2KIZ A;  1MHW A;  3QZV A;  2R9C A;  3QT4 A;  4DMY A;  1EWL A;  3K9M A;  4PI3 A;  2XB1 A;  5B76 A;  2CB5 A;  4PTB A;  3N3K A;  2YQL A;  3PW3 A;  1XWH A;  2OUL A;  1YT7 A;  1FBV A;  2YSJ A;  1NPZ A;  1ME4 A;  2Y1M A;  5TDW A;  2KE1 A;  5I3L A;  1CQD A;  1AU4 A;  3D6S A;  4LJN A;  5C11 A;  3BPM A;  1DEU A;  3LTW A;  1X4I A;  3L11 A;  3LQI A;  3C6W A;  3IEJ A;  3V6E A;  2DCD A;  1WEN A;  3U5O A;  3RPG B;  3HCS A;  3KV6 A;  1LDK C;  1AIM A;  2ECW A;  1XKG A;  2KR4 A;  2E02 A;  4G54 A;  4ZQL A;  4BS6 A;  1IYM A;  4MSX A;  2LDR A;  3LXS A;  1HYI A;  2C2V S;  3KW9 A;  1CHC A;  2AUZ A;  4YYW A;  2E01 A;  2F42 A;  2M85 A;  4GNE A;  4AYC A;  4CA1 A;  5B79 A;  2NQA A;  1WEP A;  2DCC A;  1WEU A;  1HYJ A;  2KWN A;  4AP4 A;  3MHS A;  1EWO A;  1NB3 A;  2NQD B;  2YU4 A;  4WZ0 A;  2DZY A;  2GHU A;  2KGG A;  2XU1 A;  2H0D B;  4Q8G A;  2PBH A;  3U8E A;  2L43 A;  2YYR A;  4CDE B;  3DQV R;  5PAD A;  1TLO A;  5G04 B;  1TL9 A;  2LGK A;  5AIU A;  5EF4 A;  4A4C A;  5B77 A;  3I3T A;  3U5M A;  3OIS A;  1Z2Q A;  1U5I A;  2NQI A;  4LK9 A;  3ZYQ A;  3M63 A;  4MVT A;  1YVB A;  2HYE D;  5LKT A;  1ITO A;  5CHT A;  3IV2 A;  2G8E A;  2MD8 C;  1FH0 A;  3AI8 A;  4GND A;  4WZ2 A;  1ATK A;  2PNS A;  4IC2 A;  1DF0 A;  1GLO A;  4UP5 A;  1HUC B;  3PNR A;  2MIQ A;  5J3X A;  3SHB A;  1VD4 A;  3BOW A;  1DVP A;  2KYU A;  3OVX A;  2VJF A;  2HDP A;  3HCU A;  2FRA A;  4YYU A;  2DC8 A;  1WEM A;  4ZUX U;  4X6J A;  2K17 A;  2Y1N A;  3BC3 A;  3O35 A;  4YAB A;  2R9N A;  1GMY A;  3I06 A;  2JMJ A;  2OZ2 A;  3K8U A;  1POP A;  3N9Q A;  1X9Y A;  3HHA A;  1PBH A;  5CVN B;  4LAD B;  1WEV A;  1AU2 A;  4MZO A;  1EWP A;  4CZW A;  3O36 A;  3V6C A;  3I2D A;  4BQV A;  2YJB A;  1WEQ A;  2EOD A;  2HH5 A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...