3MHHA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
473
structure length
433
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTTSTNRQTGFIYLLTCAWKINSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQGECNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 127
structure length 433
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhhA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhhA02
4BPVA 3SOXA 4F52B 2MD7B 2C0YA 8PCHA 5AIUA 1JOCA 2E02A 9PAPA 4YYWA 2NQIA 4YBSA 4YABA 3PDFA 2DCCA 3PNRA 5CHVA 1TL9A 4CDFB 1NLJA 3L11A 2DJFB 2F6JA 2HDPA 1A6RA 2AUZA 2ECGA 4P6GA 4C9ZA 2JQFR 1TU6A 2KGGA 3O33A 1Z2QA 3BPFA 2LGLA 2XU4A 4PP1A 4N4FA 1AU4A 2YQMA 3N3GA 4FO9A 1PPNA 2YJ9A 2E03A 2ACTA 4QH6A 1DEUA 2M6MA 1YVBA 1XKGA 2AS8A 4S3OB 3KQIA 3B79A 3KX1A 5D1KB 1E4UA 2KGIA 3LQJA 3O35A 1GECE 4W4UA 4AYCA 2DCDA 2FUDA 3LXSA 5PADA 5J3XA 1G25A 2CT2A 4FJCA 4L58A 1VD4A 1WEPA 1LDJB 5D1LB 4UI9B 2PBHA 3WXGA 3ERVA 2YU4A 2ECWA 1U5IA 2DC7A 3N9MA 3O36A 3T6RA 2AU1A 3ZUAA 3M62A 2KE1A 3IMAA 3IHPA 3U8EA 1POPA 1Y4HA 1MM2A 3VK6A 1DF0A 3KV5A 2HHNA 3PW3A 4I04A 4QRGA 3N9PA 3H8CA 1Y08A 5F02A 2CSYA 1AIMA 4ZDTA 2Y1MA 4A49A 2CSZA 4I7DA 4X3GA 2FRQA 1MM3A 1EWLA 3N9QA 2MT5A 1GCBA 2O6XA 2M1RA 4I07A 3ZTGA 3O37A 3HHAA 3ZVYA 1AU0A 2KWJA 2PNXA 1WENA 1ICFA 1F2CA 1CHCA 2H0DA 2EODA 3QJ3A 1JM7B 1CS8A 3OF8A 1ME3A 3V6EA 1AU3A 3KWBX 4GNFA 4GNDA 2ECTA 1ITOA 1BY8A 2MNZA 2HYED 1WEOA 1PE6A 1QMYA 1CVZA 2R9MA 4BQVA 2M3HA 2OULA 1BORA 3O70A 4LADB 4BBQA 3I06A 2YJBA 2YSMA 5JH3A 4K7CA 1K3BB 2IBIA 5G05B 4PTBA 2YREA 1WESA 4WZ0A 1QOLA 2YJ2A 5TDWA 2QJ0A 1AU2A 2DC6A 2L5UA 3H8BA 2VJFB 5K16A 4S3OC 3RPGC 1BP4A 1O0EA 3N9OA 1PIPA 4RY2A 2XU5A 2G7YA 1F2BA 2OXQC 1NPZA 1Z6UA 4Q6FA 1WE9A 2VPBA 2CIOA 1WIMA 2AIMA 1SP4B 1YALA 3DQVR 2DJGB 3N3KA 1F62A 4DMYA 2NQDB 1VYXA 1X9YA 2L43A 3N4CA 2RSDA 2FT2A 1YK8A 2JQGR 1X4UA 1EWMA 1Q6KA 1KHPA 1ZCMA 5CVOB 5B78A 2HD5A 4YV8A 1T1HA 4W5CA 4AP4A 2KIZA 1JQPA 1WEQA 3DF0A 2H7JA 3IUTA 3ZYQA 5B79A 5TBNA 3HD3A 1NB5A 1STFE 3H89A 4YYRA 2HXZA 2LV9A 2B1MA 3LQHA 4CZWA 3USVA 1U9QX 1AYUA 2EA6A 3KW9A 3MORA 3OVXA 3WXEA 3LFYA 2KU3A 5H1VA 2VPGA 1CSBB 4OELA 2VPEA 3C9EA 4TKPB 1YK7A 5B8DA 3L1ZB 4R2YA 2FSAA 5B77A 2EGPA 1MEGA 4PADA 4YAXA 3IOQA 4YYVA 2YSJA 1CPJA 4LJNA 4X6HA 1CJLA 1MIRA 5EYAF 5EF4A 4AUQB 1WEVA 4IC2A 2K1JA 3PHDA 1HYJA 4I7BA 1CB5A 2DC8A 3F75A 4CA1A 4Q8HA 1ME4A 4GB0A 5FB0A 2G6QA 5TDRA 1KXRA 2MIQA 3RTRB 4YVAA 1YT7A 3PUQA 1IYMA 3EB6A 5FERA 3BC3A 2XEUA 5C13A 2FQ9A 2DZYA 4LLBA 2VP7A 1CQDA 1KFUL 3O7AA 1X4JA 5LKZA 2DCAA 3U5MA 2PUYA 1QXPA 2E00A 5AITA 4O64A 5KH7A 1WGMA 2E6RA 3O0UA 4YYUA 3HCSA 4FK5A 2ECNA 4NN2A 4AVXA 1EF7A 4QF3A 1MEMA 2AVWA 1FP0A 2XU1A 4ZUXU 5H9MA 1NB3A 4GNGA 1GMYA 4CDEB 2F7DA 3OF9A 2B1NA 2PADA 4CDCB 1ZBDB 4AYCB 4XUIA 1WEWA 2NQGA 3SOUA 5I3LA 1VSNA 2YHNA 3IEJA 1KHQA 3N9LA 2E6SA 4AXLA 3C5KA 3GV4A 1DVPA 2K17A 1AECA 4IC3A 4QF2A 1PPDA 2MD8C 3U5NA 3NHEA 4I05A 2VHFA 2GFOA 5JA7A 2G6DA 2P0RA 2BDLA 3O1GA 4GNEA 5FB1A 4LK9A 2VNFA 4YYQA 1SNKA 4YC9A 1WEMA 3ZPV1 2VJFA 5G0FA 4YBMA 4X6JA 2DZZA 2YQLA 1S4VA 2F6NA 1PADA 2FYEA 2CB5A 4ZQLA 1NL6A 1U9XA 3KWZA 3HWNA 2VPDA 5DKAA 4A0CD 2G45A 2ZETC 5CVNB 4BSQA 1VFYA 2IPPB 2BDZA 3KFQA 4QRVA 2D8SA 2KR4A 2P86A 3MHSA 3ASLA 3L1XA 4MZSA 2ECIA 2L75A 3QT4A 4OEMA 4CCGX 3V43A 1PPOA 2QICA 2NQAA 5J94A 2F42A 2C2LA 3TNXA 1BQIA 2FUIA 1N87A 3ZVZB 3K24A 4QRXA 3N9NA 4WZ2A 2MNYA 2LGGA 4PP2E 3P5XA 7PCKA 2LQ6A 4YATA 3KNVA 5A24A 1U6GB 3PBHA 2KFTA 1PPPA 5C11A 2VJEB 3ZPVE 3I2DA 4UP0A 4N3WA 3GL6A 5KH3A 2BAYA 2ECVA 4WA6A 5B76A 2DCBA 4WZ3B 2MA5A 4R8PK 4N4ZA 4LKAA 2KREA 1CTEA 2AYNA 3HTKC 3P5UA 2LXPC 2PREA 4YBTA 4UP5A 2LXHC 2Y1NA 1WFKA 1PXVA 1U9WA 1ATKA 2R9OA 4PI3A 2YHOA 2JMJA 3OISA 2G43A 1FBVA 3KV6A 3CH2X 1PBHA 2CKLB 3S3RA 4MZOA 1LDKC 2R9CA 3CBJA 1GLOA 4I7CA 2K16A 2L0BA 1WILA 5KH9A 3MTNA 2FRAA 3KSEA 2M85A 1WEUA 2LRIC 2LDRA 1MS6A 3HCUA 4B7YC 2KWKA 2I50A 3V6CA 2K4DA 1M6DA 2YURA 1EWOA 3ZNIA 2R9NA 1IWDA 5LKXA 4W5BA 2JMDA 3U5PA 3I3TA 5EGWA 4YADA 2G8JA 2FTDA 1U9VA 3O34A 2VJEA 2XU3A 5D1MB 3RPGB 3KKUA 4DMXA 4BHWA 3BPMA 2L80A 4N79A 4BS5A 1K2FA 4MVTA 3FL2A 2AUXA 1V87A 3LQIA 3BOWA 4CDDB 2OZ2A 2YJ8A 2MUMA 4V3KC 2HH5A 2RI7A 4R7EA 5TABA 2KYUA 2AN6A 2YYRA 1THEA 2YT5A 3T7LA 4QBBA 3E1ZB 3U5OA 3BWKA 3MHHA 4KLBA 2WBFX 3K8UA 3M99A 1PCIA 3OVZA 5H1TA 4P6EA 2LGVA 1EWPA 1F29A 1WEEA 1RMDA 5TRBA 3RVWA 3BCNA 2PNSA 2IDAA 4P5OB 1CV8A 1Z60A 4BS6A 3WXFA 3S3QA 2Y6EA 2NAAA 4B86C 3H7DA 3SHBA 1X4IA 2DX8A 3QZVA 1QDQA 2KWNA 2YW8A 1TLOA 4FIPA 3RVXA 3GCBA 3P5WA 3HCTA 5CHTA 3PURA 3QSDA 3LRQA 2DC9A 4N8WA 1KFXL 2R9FA 2YJCA 5B75A 2LGKA 2P7UA 5G04B 4X6IA 2UZGA 5LKUA 4Q8GA 3IV2A 2ECJA 1F2AA 4HWYA 2G8EA 1MHWA 4A4CA 1AYVA 2R6NA 1AYWA 2VHSA 3CBKA 5DINA 2LN0A 1MDWA 2JMIA 4MSXA 3SOWA 2ARYA 3HHIA 5LKTA 3D6SA 1FH0A 2C2VS 5H1UA 3H6SA 3M63A 1VJVA 2FUUA 3RVVA 2GHUA 4A4BA 2KWOA 2YUCA 2Y43A 3EB5A 3DPLR 1NQCA 3C6WA 3K9MA 4XI1A 4AXMA 2MA6A 1HYIA 1XWHA 2QIZA 6PADA 5LCWB 5FPWA 2F1GA 4PPEA 2JRJA 5FEYA 1HUCB 2FO5A 3AI8A 3F5VA 4XR7A 2E01A 2Y5BA 2H0DB 2ATOA 4G54A 3P5VA 3CH3X 1ZIVA 1JM7A 2AYOA 4YYSA 4V3LC 2OP3A 2CKLA 1BGOA 3NG2A 5CVMA 5JG6A 4L7XA 2XB1A
chains in the Genus database with same CATH superfamily
4BPVA 3SOXA 2EGMA 4F52B 2MD7B 3H7HA 2C0YA 3LVRE 8PCHA 5AIUA 5CVMA 1JOCA 2E02A 9PAPA 4YYWA 3C0RA 2NQIA 4YBSA 4YABA 3PDFA 2DCCA 3PNRA 5CHVA 1TL9A 4CDFB 3TMPA 1NLJA 3L11A 2DJFB 2F6JA 2HDPA 1A6RA 2AUZA 4BOZA 2ECGA 4P6GA 4C9ZA 2JQFR 4BOPA 1TU6A 2KGGA 3O33A 1Z2QA 2JUNA 2LGLA 2XU4A 3BPFA 1PVJA 4PP1A 4N4FA 2BU3A 1AU4A 4A5UA 2YQMA 3N3GA 4FO9A 1PPNA 2YJ9A 4M0WA 2E03A 2ACTA 4QH6A 1DEUA 2M6MA 1YVBA 1XKGA 2AS8A 3DDTA 4S3OB 3KQIA 2UZJA 3B79A 3KX1A 5D1KB 1E4UA 2KGIA 3LQJA 3O35A 1GECE 4W4UA 2KKXA 4AYCA 2DCDA 2FUDA 3LXSA 5PADA 5J3XA 1G25A 2CT2A 3PT2A 4FJCA 4L58A 1VD4A 1WEPA 1LDJB 5D1LB 2BTWB 4UI9B 2PBHA 3WXGA 3ERVA 2YU4A 2ECWA 3PHWA 1U5IA 2DC7A 3N9MA 3OQCA 3O36A 3T6RA 2AU1A 3ZUAA 3M62A 2KE1A 3IMAA 3IHPA 3U8EA 1POPA 1Y4HA 1MM2A 3VK6A 2J7QC 1DF0A 3KV5A 2HHNA 3PW3A 4I04A 4QRGA 3N9PA 3H8CA 1Y08A 5F02A 2CSYA 1AIMA 4ZDTA 2Y1MA 4A49A 2CSZA 4I7DA 4X3GA 2FRQA 1MM3A 1EWLA 2JM3A 3N9QA 2MT5A 1GCBA 2O6XA 2M1RA 4I07A 3ZTGA 3O37A 3HHAA 2HWKA 3ZVYA 1AU0A 2KWJA 2PNXA 1WENA 1ICFA 1F2CA 1CHCA 2H0DA 2EODA 3QJ3A 1JM7B 1CS8A 3IFUA 3OF8A 1ME3A 3V6EA 1AU3A 3KWBX 4GNFA 4GNDA 2ECTA 1ITOA 1BY8A 2MNZA 2HYED 1WEOA 1PE6A 1QMYA 1CVZA 2R9MA 3LJUX 4BQVA 2M3HA 2OULA 3JUEA 3ZNHA 1BORA 3O70A 4LADB 3LVQE 4BBQA 2YJBA 2YSMA 3I06A 4K7CA 5JH3A 1K3BB 2IBIA 5G05B 4PTBA 4WZ0A 2YREA 1WESA 1QOLA 2YJ2A 5TDWA 2QJ0A 1AU2A 2DC6A 2L5UA 3H8BA 2VJFB 5K16A 4S3OC 3MTVA 4BOUA 3RPGC 5SVXA 1BP4A 1O0EA 3N9OA 1PIPA 4RY2A 2XU5A 2G7YA 2DJAA 3B21A 1F2BA 2OXQC 1NPZA 4RKXA 1Z6UA 4Q6FA 1WE9A 2VPBA 2CIOA 1WIMA 2AIMA 1SP4B 1YALA 3DQVR 2DJGB 3N3KA 1F62A 4DMYA 2NQDB 1VYXA 1X9YA 2L43A 3N4CA 2RSDA 2FT2A 1YK8A 3PRPA 2JQGR 1X4UA 1EWMA 1Q6KA 1KHPA 2EXUA 1ZCMA 5CVOB 5B78A 2HD5A 2BTWA 4YV8A 1T1HA 4W5CA 4AP4A 2KIZA 1JQPA 1WEQA 3DF0A 2H7JA 3IUTA 3ZYQA 5B79A 5TBNA 3HD3A 1NB5A 1STFE 3H89A 4YYRA 2HXZA 2LV9A 2B1MA 3LQHA 4CZWA 3USVA 2CRRA 1U9QX 1AYUA 2EA6A 3KW9A 3MORA 3OVXA 2CONA 5SVIA 3WXEA 3LFYA 2KU3A 5H1VA 2VPGA 4P16A 1MBMA 2B0OE 1CSBB 2VPEA 4OELA 3C9EA 4TKPB 1YK7A 4PT5A 4OVZA 5B8DA 3L1ZB 4R2YA 2FSAA 5B77A 2EGPA 1MEGA 4RNAA 4PADA 3MJ5A 4YAXA 3IOQA 4YYVA 2YSJA 3FAOA 1CPJA 4LJNA 4X6HA 4MI7A 1CJLA 2D8UA 1MIRA 2LAUA 5EYAF 5EF4A 4AUQB 1WEVA 4IP3A 4IC2A 2K1JA 3PHDA 1HYJA 4I7BA 1CB5A 2DC8A 3F75A 4CA1A 2OWAA 4Q8HA 1ME4A 4GB0A 4H9DA 5FB0A 4Z0OA 5EZSA 2G6QA 5TDRA 1KXRA 3W30A 2MIQA 3RTRB 4YVAA 1YT7A 3PUQA 1IYMA 3EB6A 5FERA 3BC3A 2XEUA 5C13A 2FQ9A 2DZYA 3SUBA 4LLBA 4WURA 2VP7A 1CQDA 1KFUL 3O7AA 1X4JA 5LKZA 2DCAA 3U5MA 2PUYA 1QXPA 2E00A 5AITA 4O64A 5KH7A 1WGMA 4OGCA 5SVIB 4IUMA 2E6RA 3O0UA 4QQ4A 4YYUA 3HCSA 4FK5A 2ECNA 4NN2A 4AVXA 1EF7A 4QF3A 1MEMA 2AVWA 1FP0A 2XU1A 4ZUXU 5H9MA 1NB3A 4GNGA 1GMYA 4CDEB 2F7DA 3LDYA 3OF9A 2B1NA 2PADA 3BBAA 4CDCB 1ZBDB 4AYCB 4XUIA 1WEWA 2NQGA 2YVRA 3SOUA 5E6JA 5I3LA 1VSNA 3FANA 2YHNA 2DSMA 3IEJA 1KHQA 3N9LA 2E6SA 4AXLA 3C5KA 3GV4A 1DVPA 2K17A 1AECA 4IC3A 4QF2A 1PPDA 2MD8C 2CSVA 3U5NA 3NHEA 3BB7A 4I05A 2VHFA 3FM8C 2GFOA 1DKIA 2E61A 5JA7A 2G6DA 2P0RA 2BDLA 3O1GA 4GNEA 5EZQA 5FB1A 4LK9A 2VNFA 4YYQA 1SNKA 4YC9A 1WEMA 3ZPV1 2VJFA 4R3DA 2J7QA 5G0FA 4YBMA 4X6JA 2DZZA 4O62A 2YQLA 3PLWA 1S4VA 2F6NA 3MDBC 1PADA 2FYEA 2CB5A 5SVYA 4ZQLA 4BOQA 1NL6A 1U9XA 3KWZA 3HWNA 2VPDA 5DKAA 4A0CD 2G45A 2ZETC 5CVNB 4BSQA 4ZTBA 1VFYA 2IPPB 2BDZA 3KFQA 4QRVA 2D8SA 2KR4A 2P86A 2XOCA 3MHSA 3ASLA 3L1XA 4MZSA 2ECIA 2L75A 3QT4A 4OEMA 4CCGX 4HXDB 3V43A 5K3QA 1PPOA 2QICA 2NQAA 5J94A 2F42A 2C2LA 4F1PA 3TNXA 1BQIA 2FUIA 1N87A 3ZVZB 3K24A 4QRXA 3N9NA 4WZ2A 2MNYA 2LGGA 4PP2E 3P5XA 7PCKA 2JTCA 2LQ6A 4YATA 3KNVA 3KDEC 5A24A 1U6GB 3PBHA 2KFTA 1PPPA 5C11A 2VJEB 3ZPVE 2P57A 3I2DA 4UP0A 3M7KA 4N3WA 3GL6A 2FE8A 5KH3A 2BAYA 1DCQA 2ECVA 4WA6A 5B76A 2DCBA 4WZ3B 2MA5A 4R8PK 4N4ZA 4LKAA 2KREA 1CTEA 2AYNA 3HTKC 3P5UA 2LXPC 2PREA 2KKYA 4YBTA 4UP5A 2AGAA 2LXHC 2Y1NA 1WFKA 3TRKA 4BOSA 1PXVA 1U9WA 1ATKA 2R9OA 4PI3A 2YHOA 2JMJA 3OISA 2G43A 1FBVA 3KV6A 3CH2X 1PBHA 2CKLB 2Z84A 3S3RA 2DOSA 4MZOA 1LDKC 3T9KA 2R9CA 3CBJA 3MP2A 1GLOA 4I7CA 2K16A 2L0BA 1WILA 5KH9A 3MTNA 2FRAA 2IQJA 3KSEA 2M85A 1WEUA 2LRIC 2LDRA 1MS6A 3HCUA 4B7YC 2KWKA 2I50A 4REZA 3V6CA 2K4DA 1M6DA 2YURA 1EWOA 3ZNIA 2R9NA 1IWDA 2MKEA 5LKXA 1UKFA 4W5BA 2JMDA 3U5PA 3I3TA 5EGWA 4YADA 2G8JA 2FTDA 1U9VA 3FJUB 3O34A 2VJEA 2XU3A 5D1MB 2L7PA 3RPGB 3KKUA 4DMXA 4BHWA 3BPMA 2L80A 4N79A 4BS5A 1K2FA 3FEHA 3E9SA 4MVTA 3PSEA 3FL2A 2XP0A 2AUXA 1V87A 3PRMA 3LQIA 3BOWA 4RF1A 4CDDB 2OZ2A 2YJ8A 2MUMA 4V3KC 2HH5A 2RI7A 4R7EA 4RF0A 5TABA 2KYUA 2AN6A 2YYRA 1THEA 2YT5A 3T7LA 4QBBA 3E1ZB 3U5OA 3BWKA 3O47A 3MHHA 4KLBA 2WBFX 3K8UA 3M99A 1PCIA 3OVZA 5H1TA 3Q1DA 3O65A 4P6EA 2LGVA 2FFWA 1EWPA 1F29A 1WEEA 3PHUA 4MM3B 3W31A 1RMDA 5TRBA 3RVWA 3BCNA 2PNSA 2IDAA 4P5OB 1CV8A 1Z60A 4BS6A 3WXFA 3S3QA 2Y6EA 2NAAA 4B86C 3H7DA 3SHBA 1X4IA 2DX8A 3QZVA 1QDQA 2KWNA 2YW8A 1TLOA 4FIPA 3RVXA 3GCBA 3P5WA 3HCTA 2M13A 3PURA 3QSDA 5CHTA 3LRQA 2DC9A 4N8WA 3RNVA 1KFXL 2R9FA 2YJCA 5B75A 2LGKA 2P7UA 5G04B 4X6IA 2UZGA 5LKUA 1YZBA 4Q8GA 2JRIA 3IV2A 2ECJA 1F2AA 4HWYA 4D8BA 2G8EA 1MHWA 4OW0A 4A4CA 1AYVA 2R6NA 1AYWA 2VHSA 3CBKA 3BY4A 5DINA 2LN0A 1MDWA 2JMIA 4MSXA 3SOWA 2FD4A 2ARYA 3HHIA 5LKTA 3D6SA 4D8EA 1FH0A 2C2VS 5H1UA 3H6SA 3M63A 1VJVA 2FUUA 3RVVA 2GHUA 4Z0RA 4A4BA 2KWOA 2YUCA 4D8IA 2Y43A 3EB5A 3DPLR 2CRWA 1NQCA 3C6WA 3K9MA 4XI1A 4AXMA 5KO3A 2MA6A 1HYIA 1XWHA 4OVZB 2QIZA 4XZXA 4GUAA 5LCWB 5FPWA 2F1GA 6PADA 4PPEA 2RR4A 2JRJA 5FEYA 1HUCB 2FO5A 3AI8A 3F5VA 4XR7A 2E01A 2XOYA 4OGEA 2Y5BA 2H0DB 2ATOA 4G54A 3P5VA 3CH3X 3DWDA 1ZIVA 1JM7A 2AYOA 4YYSA 4V3LC 2XOZA 2OP3A 2CKLA 1BGOA 3NG2A 3E2DA 3PHXA 5JG6A 4L7XA 2XB1A 5JZEA
chains in the Genus database with same CATH topology
4BPVA 3SOXA 4F52B 2MD7B 2C0YA 8PCHA 5AIUA 1JOCA 2E02A 9PAPA 4YYWA 2NQIA 4YBSA 4YABA 3PDFA 2DCCA 3PNRA 5CHVA 1TL9A 4CDFB 1NLJA 3L11A 2DJFB 2F6JA 2HDPA 1A6RA 2AUZA 4GUZA 2ECGA 4P6GA 4C9ZA 2JQFR 1TU6A 2KGGA 3O33A 1Z2QA 3BPFA 2LGLA 2XU4A 4PP1A 1E2TA 4N4FA 1AU4A 2YQMA 3N3GA 4FO9A 1PPNA 2YJ9A 2E03A 2ACTA 4QH6A 1DEUA 2M6MA 1YVBA 1XKGA 2AS8A 4S3OB 3KQIA 3B79A 3KX1A 5D1KB 1E4UA 2KGIA 3LQJA 3O35A 1GECE 4W4UA 4AYCA 2DCDA 2FUDA 3LXSA 5PADA 5J3XA 1G25A 2CT2A 4FJCA 4L58A 1VD4A 1WEPA 1LDJB 5D1LB 4UI9B 2PBHA 3WXGA 3ERVA 2YU4A 2ECWA 2VFCA 1U5IA 2DC7A 3N9MA 4C5PA 3O36A 3T6RA 2AU1A 3ZUAA 3M62A 2KE1A 3IMAA 3IHPA 2VFBA 3U8EA 1POPA 1Y4HA 1MM2A 3VK6A 1DF0A 3KV5A 2HHNA 3PW3A 4I04A 4QRGA 3N9PA 3H8CA 1Y08A 5F02A 2CSYA 1AIMA 4ZDTA 2Y1MA 4A49A 2CSZA 4I7DA 4X3GA 2FRQA 1MM3A 1EWLA 3N9QA 2MT5A 1GCBA 2O6XA 2M1RA 4I07A 3ZTGA 3O37A 3HHAA 3ZVYA 1AU0A 2KWJA 2PNXA 1WENA 1ICFA 1F2CA 1CHCA 2H0DA 2EODA 3QJ3A 1JM7B 1CS8A 3OF8A 1ME3A 3V6EA 1AU3A 3KWBX 4GNFA 4GNDA 2ECTA 1ITOA 1BY8A 2MNZA 2HYED 1WEOA 1PE6A 1QMYA 1CVZA 2R9MA 4BQVA 2M3HA 2OULA 1BORA 3O70A 4LADB 4BBQA 3I06A 2YJBA 2YSMA 5JH3A 4K7CA 1K3BB 2IBIA 5G05B 4PTBA 2YREA 1WESA 4WZ0A 1QOLA 2YJ2A 5TDWA 2QJ0A 1AU2A 2DC6A 2L5UA 3H8BA 2VJFB 5K16A 4S3OC 3RPGC 1BP4A 1O0EA 3N9OA 1PIPA 4RY2A 2XU5A 2G7YA 1F2BA 2OXQC 1NPZA 1Z6UA 4Q6FA 1WE9A 2VPBA 2CIOA 1WIMA 2AIMA 1SP4B 1YALA 3DQVR 2DJGB 3N3KA 1F62A 4DMYA 2NQDB 1VYXA 1X9YA 2L43A 3N4CA 2RSDA 2FT2A 1YK8A 2JQGR 1X4UA 1EWMA 1Q6KA 1KHPA 1ZCMA 5CVOB 5B78A 2HD5A 4YV8A 1W4TA 1T1HA 4W5CA 4AP4A 2KIZA 1JQPA 1WEQA 3DF0A 2H7JA 3IUTA 3ZYQA 5B79A 5TBNA 3HD3A 1NB5A 1STFE 3H89A 4YYRA 2HXZA 2LV9A 2B1MA 3LQHA 4CZWA 3USVA 1U9QX 1AYUA 2EA6A 3KW9A 3MORA 3OVXA 3WXEA 3LFYA 2KU3A 5H1VA 2VPGA 1CSBB 4OELA 2VPEA 3C9EA 4TKPB 1YK7A 5B8DA 3L1ZB 4R2YA 2FSAA 5B77A 2EGPA 1MEGA 4PADA 4YAXA 3IOQA 1W6FA 4YYVA 2YSJA 1CPJA 4LJNA 4NV7A 4X6HA 1CJLA 1MIRA 5EYAF 5EF4A 3D9WA 4AUQB 1WEVA 4IC2A 2K1JA 3PHDA 1HYJA 4I7BA 1CB5A 2DC8A 3F75A 4CA1A 4Q8HA 1ME4A 4GB0A 5FB0A 2G6QA 5TDRA 1KXRA 2MIQA 3RTRB 4YVAA 1YT7A 3PUQA 1IYMA 3EB6A 5FERA 3BC3A 2XEUA 5C13A 4BGFA 2FQ9A 2DZYA 4LLBA 1W5RA 2VP7A 1CQDA 1KFUL 3O7AA 1X4JA 5LKZA 2DCAA 3U5MA 2PUYA 1QXPA 2E00A 5AITA 4O64A 5KH7A 1WGMA 2E6RA 3O0UA 4YYUA 3HCSA 4FK5A 2ECNA 4NN2A 4AVXA 1EF7A 4QF3A 1MEMA 2AVWA 1FP0A 2XU1A 4ZUXU 5H9MA 1NB3A 4GNGA 1GMYA 4CDEB 2F7DA 3OF9A 2B1NA 2PADA 4CDCB 1ZBDB 4AYCB 4XUIA 1WEWA 2NQGA 3SOUA 5I3LA 1VSNA 2YHNA 3IEJA 1KHQA 3N9LA 2E6SA 4AXLA 3C5KA 3GV4A 1DVPA 2K17A 1AECA 4IC3A 4QF2A 1PPDA 2MD8C 3LTWA 3U5NA 3NHEA 4I05A 2VHFA 2GFOA 5JA7A 2G6DA 2P0RA 2BDLA 3O1GA 4GNEA 5FB1A 4LK9A 2VNFA 4YYQA 1SNKA 4YC9A 1WEMA 3ZPV1 2VJFA 5G0FA 4YBMA 4X6JA 2DZZA 2YQLA 1S4VA 2F6NA 1PADA 2FYEA 2CB5A 4ZQLA 1NL6A 1U9XA 3KWZA 3HWNA 2VPDA 5DKAA 4A0CD 2G45A 2ZETC 5CVNB 4BSQA 1VFYA 2IPPB 2BDZA 3KFQA 4QRVA 2D8SA 2KR4A 2P86A 3MHSA 3ASLA 3L1XA 4MZSA 2ECIA 2L75A 3QT4A 4OEMA 4CCGX 3V43A 1PPOA 2QICA 2NQAA 5J94A 2F42A 2C2LA 3TNXA 1BQIA 2FUIA 1N87A 3ZVZB 3K24A 4QRXA 3N9NA 4WZ2A 2MNYA 2LGGA 4PP2E 3P5XA 7PCKA 2LQ6A 4YATA 3KNVA 4B55A 5A24A 1U6GB 3PBHA 2KFTA 1PPPA 5C11A 2VJEB 3ZPVE 3I2DA 4UP0A 4N3WA 3GL6A 5KH3A 2BAYA 2ECVA 4WA6A 5B76A 2DCBA 4WZ3B 2MA5A 4R8PK 4N4ZA 4LKAA 2KREA 1CTEA 2AYNA 3HTKC 3P5UA 2LXPC 2PREA 4YBTA 4UP5A 2LXHC 2Y1NA 1WFKA 1PXVA 1U9WA 1ATKA 2R9OA 4PI3A 2YHOA 2JMJA 3OISA 2G43A 1FBVA 3KV6A 3CH2X 1PBHA 2CKLB 3S3RA 4MZOA 1LDKC 2R9CA 3CBJA 1GLOA 4I7CA 2K16A 2L0BA 1WILA 5KH9A 3MTNA 2FRAA 3KSEA 2M85A 1WEUA 2LRIC 2LDRA 1MS6A 3HCUA 4B7YC 2KWKA 2I50A 3V6CA 2K4DA 1M6DA 2YURA 1EWOA 3ZNIA 2R9NA 1IWDA 5LKXA 4W5BA 2JMDA 3U5PA 3I3TA 5EGWA 4YADA 2G8JA 2FTDA 1U9VA 3O34A 2VJEA 2XU3A 5D1MB 3RPGB 3KKUA 4DMXA 4BHWA 3BPMA 2L80A 4N79A 4BS5A 1K2FA 4MVTA 3FL2A 2AUXA 1V87A 3LQIA 3BOWA 4CDDB 2OZ2A 2YJ8A 2MUMA 4V3KC 2HH5A 2RI7A 4R7EA 5TABA 2KYUA 2AN6A 2YYRA 1THEA 2YT5A 3T7LA 4QBBA 3E1ZB 3U5OA 3BWKA 3MHHA 4KLBA 2WBFX 3K8UA 3M99A 1PCIA 3OVZA 5H1TA 4P6EA 2LGVA 1EWPA 1F29A 1WEEA 1RMDA 5TRBA 3RVWA 3BCNA 2PNSA 2IDAA 4P5OB 1CV8A 1Z60A 4BS6A 3WXFA 3S3QA 2Y6EA 2NAAA 4B86C 3H7DA 3SHBA 1X4IA 2DX8A 3QZVA 1QDQA 2KWNA 4NV8A 2YW8A 1TLOA 4FIPA 3RVXA 3GCBA 3P5WA 3HCTA 5CHTA 3PURA 3QSDA 3LRQA 2DC9A 4N8WA 1KFXL 2R9FA 2YJCA 5B75A 2LGKA 2P7UA 5G04B 4X6IA 2UZGA 5LKUA 4Q8GA 3IV2A 2ECJA 1F2AA 4HWYA 2G8EA 1MHWA 4A4CA 1AYVA 2R6NA 1AYWA 2VHSA 3CBKA 5DINA 2LN0A 1MDWA 2JMIA 4MSXA 3SOWA 2ARYA 3HHIA 5LKTA 3D6SA 1FH0A 2C2VS 5H1UA 3H6SA 3M63A 1VJVA 2FUUA 1GX3A 3RVVA 2GHUA 4A4BA 2KWOA 2YUCA 2Y43A 3EB5A 3DPLR 1NQCA 3C6WA 3K9MA 4XI1A 4AXMA 2MA6A 1HYIA 1XWHA 2QIZA 6PADA 5LCWB 5FPWA 2F1GA 4PPEA 2JRJA 5FEYA 1HUCB 2FO5A 3AI8A 3F5VA 4XR7A 2E01A 2Y5BA 2H0DB 2ATOA 4G54A 3P5VA 3CH3X 1ZIVA 1JM7A 2AYOA 2BSZA 4YYSA 4V3LC 2OP3A 2CKLA 1BGOA 3NG2A 5CVMA 5JG6A 4L7XA 2XB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPV A;  3SOX A;  4F52 B;  2MD7 B;  2C0Y A;  8PCH A;  5AIU A;  1JOC A;  2E02 A;  9PAP A;  4YYW A;  2NQI A;  4YBS A;  4YAB A;  3PDF A;  2DCC A;  3PNR A;  5CHV A;  1TL9 A;  4CDF B;  1NLJ A;  3L11 A;  2DJF B;  2F6J A;  2HDP A;  1A6R A;  2AUZ A;  2ECG A;  4P6G A;  4C9Z A;  2JQF R;  1TU6 A;  2KGG A;  3O33 A;  1Z2Q A;  3BPF A;  2LGL A;  2XU4 A;  4PP1 A;  4N4F A;  1AU4 A;  2YQM A;  3N3G A;  4FO9 A;  1PPN A;  2YJ9 A;  2E03 A;  2ACT A;  4QH6 A;  1DEU A;  2M6M A;  1YVB A;  1XKG A;  2AS8 A;  4S3O B;  3KQI A;  3B79 A;  3KX1 A;  5D1K B;  1E4U A;  2KGI A;  3LQJ A;  3O35 A;  1GEC E;  4W4U A;  4AYC A;  2DCD A;  2FUD A;  3LXS A;  5PAD A;  5J3X A;  1G25 A;  2CT2 A;  4FJC A;  4L58 A;  1VD4 A;  1WEP A;  1LDJ B;  5D1L B;  4UI9 B;  2PBH A;  3WXG A;  3ERV A;  2YU4 A;  2ECW A;  1U5I A;  2DC7 A;  3N9M A;  3O36 A;  3T6R A;  2AU1 A;  3ZUA A;  3M62 A;  2KE1 A;  3IMA A;  3IHP A;  3U8E A;  1POP A;  1Y4H A;  1MM2 A;  3VK6 A;  1DF0 A;  3KV5 A;  2HHN A;  3PW3 A;  4I04 A;  4QRG A;  3N9P A;  3H8C A;  1Y08 A;  5F02 A;  2CSY A;  1AIM A;  4ZDT A;  2Y1M A;  4A49 A;  2CSZ A;  4I7D A;  4X3G A;  2FRQ A;  1MM3 A;  1EWL A;  3N9Q A;  2MT5 A;  1GCB A;  2O6X A;  2M1R A;  4I07 A;  3ZTG A;  3O37 A;  3HHA A;  3ZVY A;  1AU0 A;  2KWJ A;  2PNX A;  1WEN A;  1ICF A;  1F2C A;  1CHC A;  2H0D A;  2EOD A;  3QJ3 A;  1JM7 B;  1CS8 A;  3OF8 A;  1ME3 A;  3V6E A;  1AU3 A;  3KWB X;  4GNF A;  4GND A;  2ECT A;  1ITO A;  1BY8 A;  2MNZ A;  2HYE D;  1WEO A;  1PE6 A;  1QMY A;  1CVZ A;  2R9M A;  4BQV A;  2M3H A;  2OUL A;  1BOR A;  3O70 A;  4LAD B;  4BBQ A;  3I06 A;  2YJB A;  2YSM A;  5JH3 A;  4K7C A;  1K3B B;  2IBI A;  5G05 B;  4PTB A;  2YRE A;  1WES A;  4WZ0 A;  1QOL A;  2YJ2 A;  5TDW A;  2QJ0 A;  1AU2 A;  2DC6 A;  2L5U A;  3H8B A;  2VJF B;  5K16 A;  4S3O C;  3RPG C;  1BP4 A;  1O0E A;  3N9O A;  1PIP A;  4RY2 A;  2XU5 A;  2G7Y A;  1F2B A;  2OXQ C;  1NPZ A;  1Z6U A;  4Q6F A;  1WE9 A;  2VPB A;  2CIO A;  1WIM A;  2AIM A;  1SP4 B;  1YAL A;  3DQV R;  2DJG B;  3N3K A;  1F62 A;  4DMY A;  2NQD B;  1VYX A;  1X9Y A;  2L43 A;  3N4C A;  2RSD A;  2FT2 A;  1YK8 A;  2JQG R;  1X4U A;  1EWM A;  1Q6K A;  1KHP A;  1ZCM A;  5CVO B;  5B78 A;  2HD5 A;  4YV8 A;  1T1H A;  4W5C A;  4AP4 A;  2KIZ A;  1JQP A;  1WEQ A;  3DF0 A;  2H7J A;  3IUT A;  3ZYQ A;  5B79 A;  5TBN A;  3HD3 A;  1NB5 A;  1STF E;  3H89 A;  4YYR A;  2HXZ A;  2LV9 A;  2B1M A;  3LQH A;  4CZW A;  3USV A;  1U9Q X;  1AYU A;  2EA6 A;  3KW9 A;  3MOR A;  3OVX A;  3WXE A;  3LFY A;  2KU3 A;  5H1V A;  2VPG A;  1CSB B;  4OEL A;  2VPE A;  3C9E A;  4TKP B;  1YK7 A;  5B8D A;  3L1Z B;  4R2Y A;  2FSA A;  5B77 A;  2EGP A;  1MEG A;  4PAD A;  4YAX A;  3IOQ A;  4YYV A;  2YSJ A;  1CPJ A;  4LJN A;  4X6H A;  1CJL A;  1MIR A;  5EYA F;  5EF4 A;  4AUQ B;  1WEV A;  4IC2 A;  2K1J A;  3PHD A;  1HYJ A;  4I7B A;  1CB5 A;  2DC8 A;  3F75 A;  4CA1 A;  4Q8H A;  1ME4 A;  4GB0 A;  5FB0 A;  2G6Q A;  5TDR A;  1KXR A;  2MIQ A;  3RTR B;  4YVA A;  1YT7 A;  3PUQ A;  1IYM A;  3EB6 A;  5FER A;  3BC3 A;  2XEU A;  5C13 A;  2FQ9 A;  2DZY A;  4LLB A;  2VP7 A;  1CQD A;  1KFU L;  3O7A A;  1X4J A;  5LKZ A;  2DCA A;  3U5M A;  2PUY A;  1QXP A;  2E00 A;  5AIT A;  4O64 A;  5KH7 A;  1WGM A;  2E6R A;  3O0U A;  4YYU A;  3HCS A;  4FK5 A;  2ECN A;  4NN2 A;  4AVX A;  1EF7 A;  4QF3 A;  1MEM A;  2AVW A;  1FP0 A;  2XU1 A;  4ZUX U;  5H9M A;  1NB3 A;  4GNG A;  1GMY A;  4CDE B;  2F7D A;  3OF9 A;  2B1N A;  2PAD A;  4CDC B;  1ZBD B;  4AYC B;  4XUI A;  1WEW A;  2NQG A;  3SOU A;  5I3L A;  1VSN A;  2YHN A;  3IEJ A;  1KHQ A;  3N9L A;  2E6S A;  4AXL A;  3C5K A;  3GV4 A;  1DVP A;  2K17 A;  1AEC A;  4IC3 A;  4QF2 A;  1PPD A;  2MD8 C;  3U5N A;  3NHE A;  4I05 A;  2VHF A;  2GFO A;  5JA7 A;  2G6D A;  2P0R A;  2BDL A;  3O1G A;  4GNE A;  5FB1 A;  4LK9 A;  2VNF A;  4YYQ A;  1SNK A;  4YC9 A;  1WEM A;  3ZPV 1;  2VJF A;  5G0F A;  4YBM A;  4X6J A;  2DZZ A;  2YQL A;  1S4V A;  2F6N A;  1PAD A;  2FYE A;  2CB5 A;  4ZQL A;  1NL6 A;  1U9X A;  3KWZ A;  3HWN A;  2VPD A;  5DKA A;  4A0C D;  2G45 A;  2ZET C;  5CVN B;  4BSQ A;  1VFY A;  2IPP B;  2BDZ A;  3KFQ A;  4QRV A;  2D8S A;  2KR4 A;  2P86 A;  3MHS A;  3ASL A;  3L1X A;  4MZS A;  2ECI A;  2L75 A;  3QT4 A;  4OEM A;  4CCG X;  3V43 A;  1PPO A;  2QIC A;  2NQA A;  5J94 A;  2F42 A;  2C2L A;  3TNX A;  1BQI A;  2FUI A;  1N87 A;  3ZVZ B;  3K24 A;  4QRX A;  3N9N A;  4WZ2 A;  2MNY A;  2LGG A;  4PP2 E;  3P5X A;  7PCK A;  2LQ6 A;  4YAT A;  3KNV A;  5A24 A;  1U6G B;  3PBH A;  2KFT A;  1PPP A;  5C11 A;  2VJE B;  3ZPV E;  3I2D A;  4UP0 A;  4N3W A;  3GL6 A;  5KH3 A;  2BAY A;  2ECV A;  4WA6 A;  5B76 A;  2DCB A;  4WZ3 B;  2MA5 A;  4R8P K;  4N4Z A;  4LKA A;  2KRE A;  1CTE A;  2AYN A;  3HTK C;  3P5U A;  2LXP C;  2PRE A;  4YBT A;  4UP5 A;  2LXH C;  2Y1N A;  1WFK A;  1PXV A;  1U9W A;  1ATK A;  2R9O A;  4PI3 A;  2YHO A;  2JMJ A;  3OIS A;  2G43 A;  1FBV A;  3KV6 A;  3CH2 X;  1PBH A;  2CKL B;  3S3R A;  4MZO A;  1LDK C;  2R9C A;  3CBJ A;  1GLO A;  4I7C A;  2K16 A;  2L0B A;  1WIL A;  5KH9 A;  3MTN A;  2FRA A;  3KSE A;  2M85 A;  1WEU A;  2LRI C;  2LDR A;  1MS6 A;  3HCU A;  4B7Y C;  2KWK A;  2I50 A;  3V6C A;  2K4D A;  1M6D A;  2YUR A;  1EWO A;  3ZNI A;  2R9N A;  1IWD A;  5LKX A;  4W5B A;  2JMD A;  3U5P A;  3I3T A;  5EGW A;  4YAD A;  2G8J A;  2FTD A;  1U9V A;  3O34 A;  2VJE A;  2XU3 A;  5D1M B;  3RPG B;  3KKU A;  4DMX A;  4BHW A;  3BPM A;  2L80 A;  4N79 A;  4BS5 A;  1K2F A;  4MVT A;  3FL2 A;  2AUX A;  1V87 A;  3LQI A;  3BOW A;  4CDD B;  2OZ2 A;  2YJ8 A;  2MUM A;  4V3K C;  2HH5 A;  2RI7 A;  4R7E A;  5TAB A;  2KYU A;  2AN6 A;  2YYR A;  1THE A;  2YT5 A;  3T7L A;  4QBB A;  3E1Z B;  3U5O A;  3BWK A;  3MHH A;  4KLB A;  2WBF X;  3K8U A;  3M99 A;  1PCI A;  3OVZ A;  5H1T A;  4P6E A;  2LGV A;  1EWP A;  1F29 A;  1WEE A;  1RMD A;  5TRB A;  3RVW A;  3BCN A;  2PNS A;  2IDA A;  4P5O B;  1CV8 A;  1Z60 A;  4BS6 A;  3WXF A;  3S3Q A;  2Y6E A;  2NAA A;  4B86 C;  3H7D A;  3SHB A;  1X4I A;  2DX8 A;  3QZV A;  1QDQ A;  2KWN A;  2YW8 A;  1TLO A;  4FIP A;  3RVX A;  3GCB A;  3P5W A;  3HCT A;  5CHT A;  3PUR A;  3QSD A;  3LRQ A;  2DC9 A;  4N8W A;  1KFX L;  2R9F A;  2YJC A;  5B75 A;  2LGK A;  2P7U A;  5G04 B;  4X6I A;  2UZG A;  5LKU A;  4Q8G A;  3IV2 A;  2ECJ A;  1F2A A;  4HWY A;  2G8E A;  1MHW A;  4A4C A;  1AYV A;  2R6N A;  1AYW A;  2VHS A;  3CBK A;  5DIN A;  2LN0 A;  1MDW A;  2JMI A;  4MSX A;  3SOW A;  2ARY A;  3HHI A;  5LKT A;  3D6S A;  1FH0 A;  2C2V S;  5H1U A;  3H6S A;  3M63 A;  1VJV A;  2FUU A;  3RVV A;  2GHU A;  4A4B A;  2KWO A;  2YUC A;  2Y43 A;  3EB5 A;  3DPL R;  1NQC A;  3C6W A;  3K9M A;  4XI1 A;  4AXM A;  2MA6 A;  1HYI A;  1XWH A;  2QIZ A;  6PAD A;  5LCW B;  5FPW A;  2F1G A;  4PPE A;  2JRJ A;  5FEY A;  1HUC B;  2FO5 A;  3AI8 A;  3F5V A;  4XR7 A;  2E01 A;  2Y5B A;  2H0D B;  2ATO A;  4G54 A;  3P5V A;  3CH3 X;  1ZIV A;  1JM7 A;  2AYO A;  4YYS A;  4V3L C;  2OP3 A;  2CKL A;  1BGO A;  3NG2 A;  5CVM A;  5JG6 A;  4L7X A;  2XB1 A; 
#chains in the Genus database with same CATH topology
 4BPV A;  3SOX A;  2EGM A;  4F52 B;  2MD7 B;  3H7H A;  2C0Y A;  3LVR E;  8PCH A;  5AIU A;  5CVM A;  1JOC A;  2E02 A;  9PAP A;  4YYW A;  3C0R A;  2NQI A;  4YBS A;  4YAB A;  3PDF A;  2DCC A;  3PNR A;  5CHV A;  1TL9 A;  4CDF B;  3TMP A;  1NLJ A;  3L11 A;  2DJF B;  2F6J A;  2HDP A;  1A6R A;  2AUZ A;  4BOZ A;  2ECG A;  4P6G A;  4C9Z A;  2JQF R;  4BOP A;  1TU6 A;  2KGG A;  3O33 A;  1Z2Q A;  2JUN A;  2LGL A;  2XU4 A;  3BPF A;  1PVJ A;  4PP1 A;  4N4F A;  2BU3 A;  1AU4 A;  4A5U A;  2YQM A;  3N3G A;  4FO9 A;  1PPN A;  2YJ9 A;  4M0W A;  2E03 A;  2ACT A;  4QH6 A;  1DEU A;  2M6M A;  1YVB A;  1XKG A;  2AS8 A;  3DDT A;  4S3O B;  3KQI A;  2UZJ A;  3B79 A;  3KX1 A;  5D1K B;  1E4U A;  2KGI A;  3LQJ A;  3O35 A;  1GEC E;  4W4U A;  2KKX A;  4AYC A;  2DCD A;  2FUD A;  3LXS A;  5PAD A;  5J3X A;  1G25 A;  2CT2 A;  3PT2 A;  4FJC A;  4L58 A;  1VD4 A;  1WEP A;  1LDJ B;  5D1L B;  2BTW B;  4UI9 B;  2PBH A;  3WXG A;  3ERV A;  2YU4 A;  2ECW A;  3PHW A;  1U5I A;  2DC7 A;  3N9M A;  3OQC A;  3O36 A;  3T6R A;  2AU1 A;  3ZUA A;  3M62 A;  2KE1 A;  3IMA A;  3IHP A;  3U8E A;  1POP A;  1Y4H A;  1MM2 A;  3VK6 A;  2J7Q C;  1DF0 A;  3KV5 A;  2HHN A;  3PW3 A;  4I04 A;  4QRG A;  3N9P A;  3H8C A;  1Y08 A;  5F02 A;  2CSY A;  1AIM A;  4ZDT A;  2Y1M A;  4A49 A;  2CSZ A;  4I7D A;  4X3G A;  2FRQ A;  1MM3 A;  1EWL A;  2JM3 A;  3N9Q A;  2MT5 A;  1GCB A;  2O6X A;  2M1R A;  4I07 A;  3ZTG A;  3O37 A;  3HHA A;  2HWK A;  3ZVY A;  1AU0 A;  2KWJ A;  2PNX A;  1WEN A;  1ICF A;  1F2C A;  1CHC A;  2H0D A;  2EOD A;  3QJ3 A;  1JM7 B;  1CS8 A;  3IFU A;  3OF8 A;  1ME3 A;  3V6E A;  1AU3 A;  3KWB X;  4GNF A;  4GND A;  2ECT A;  1ITO A;  1BY8 A;  2MNZ A;  2HYE D;  1WEO A;  1PE6 A;  1QMY A;  1CVZ A;  2R9M A;  3LJU X;  4BQV A;  2M3H A;  2OUL A;  3JUE A;  3ZNH A;  1BOR A;  3O70 A;  4LAD B;  3LVQ E;  4BBQ A;  2YJB A;  2YSM A;  3I06 A;  4K7C A;  5JH3 A;  1K3B B;  2IBI A;  5G05 B;  4PTB A;  4WZ0 A;  2YRE A;  1WES A;  1QOL A;  2YJ2 A;  5TDW A;  2QJ0 A;  1AU2 A;  2DC6 A;  2L5U A;  3H8B A;  2VJF B;  5K16 A;  4S3O C;  3MTV A;  4BOU A;  3RPG C;  5SVX A;  1BP4 A;  1O0E A;  3N9O A;  1PIP A;  4RY2 A;  2XU5 A;  2G7Y A;  2DJA A;  3B21 A;  1F2B A;  2OXQ C;  1NPZ A;  4RKX A;  1Z6U A;  4Q6F A;  1WE9 A;  2VPB A;  2CIO A;  1WIM A;  2AIM A;  1SP4 B;  1YAL A;  3DQV R;  2DJG B;  3N3K A;  1F62 A;  4DMY A;  2NQD B;  1VYX A;  1X9Y A;  2L43 A;  3N4C A;  2RSD A;  2FT2 A;  1YK8 A;  3PRP A;  2JQG R;  1X4U A;  1EWM A;  1Q6K A;  1KHP A;  2EXU A;  1ZCM A;  5CVO B;  5B78 A;  2HD5 A;  2BTW A;  4YV8 A;  1T1H A;  4W5C A;  4AP4 A;  2KIZ A;  1JQP A;  1WEQ A;  3DF0 A;  2H7J A;  3IUT A;  3ZYQ A;  5B79 A;  5TBN A;  3HD3 A;  1NB5 A;  1STF E;  3H89 A;  4YYR A;  2HXZ A;  2LV9 A;  2B1M A;  3LQH A;  4CZW A;  3USV A;  2CRR A;  1U9Q X;  1AYU A;  2EA6 A;  3KW9 A;  3MOR A;  3OVX A;  2CON A;  5SVI A;  3WXE A;  3LFY A;  2KU3 A;  5H1V A;  2VPG A;  4P16 A;  1MBM A;  2B0O E;  1CSB B;  2VPE A;  4OEL A;  3C9E A;  4TKP B;  1YK7 A;  4PT5 A;  4OVZ A;  5B8D A;  3L1Z B;  4R2Y A;  2FSA A;  5B77 A;  2EGP A;  1MEG A;  4RNA A;  4PAD A;  3MJ5 A;  4YAX A;  3IOQ A;  4YYV A;  2YSJ A;  3FAO A;  1CPJ A;  4LJN A;  4X6H A;  4MI7 A;  1CJL A;  2D8U A;  1MIR A;  2LAU A;  5EYA F;  5EF4 A;  4AUQ B;  1WEV A;  4IP3 A;  4IC2 A;  2K1J A;  3PHD A;  1HYJ A;  4I7B A;  1CB5 A;  2DC8 A;  3F75 A;  4CA1 A;  2OWA A;  4Q8H A;  1ME4 A;  4GB0 A;  4H9D A;  5FB0 A;  4Z0O A;  5EZS A;  2G6Q A;  5TDR A;  1KXR A;  3W30 A;  2MIQ A;  3RTR B;  4YVA A;  1YT7 A;  3PUQ A;  1IYM A;  3EB6 A;  5FER A;  3BC3 A;  2XEU A;  5C13 A;  2FQ9 A;  2DZY A;  3SUB A;  4LLB A;  4WUR A;  2VP7 A;  1CQD A;  1KFU L;  3O7A A;  1X4J A;  5LKZ A;  2DCA A;  3U5M A;  2PUY A;  1QXP A;  2E00 A;  5AIT A;  4O64 A;  5KH7 A;  1WGM A;  4OGC A;  5SVI B;  4IUM A;  2E6R A;  3O0U A;  4QQ4 A;  4YYU A;  3HCS A;  4FK5 A;  2ECN A;  4NN2 A;  4AVX A;  1EF7 A;  4QF3 A;  1MEM A;  2AVW A;  1FP0 A;  2XU1 A;  4ZUX U;  5H9M A;  1NB3 A;  4GNG A;  1GMY A;  4CDE B;  2F7D A;  3LDY A;  3OF9 A;  2B1N A;  2PAD A;  3BBA A;  4CDC B;  1ZBD B;  4AYC B;  4XUI A;  1WEW A;  2NQG A;  2YVR A;  3SOU A;  5E6J A;  5I3L A;  1VSN A;  3FAN A;  2YHN A;  2DSM A;  3IEJ A;  1KHQ A;  3N9L A;  2E6S A;  4AXL A;  3C5K A;  3GV4 A;  1DVP A;  2K17 A;  1AEC A;  4IC3 A;  4QF2 A;  1PPD A;  2MD8 C;  2CSV A;  3U5N A;  3NHE A;  3BB7 A;  4I05 A;  2VHF A;  3FM8 C;  2GFO A;  1DKI A;  2E61 A;  5JA7 A;  2G6D A;  2P0R A;  2BDL A;  3O1G A;  4GNE A;  5EZQ A;  5FB1 A;  4LK9 A;  2VNF A;  4YYQ A;  1SNK A;  4YC9 A;  1WEM A;  3ZPV 1;  2VJF A;  4R3D A;  2J7Q A;  5G0F A;  4YBM A;  4X6J A;  2DZZ A;  4O62 A;  2YQL A;  3PLW A;  1S4V A;  2F6N A;  3MDB C;  1PAD A;  2FYE A;  2CB5 A;  5SVY A;  4ZQL A;  4BOQ A;  1NL6 A;  1U9X A;  3KWZ A;  3HWN A;  2VPD A;  5DKA A;  4A0C D;  2G45 A;  2ZET C;  5CVN B;  4BSQ A;  4ZTB A;  1VFY A;  2IPP B;  2BDZ A;  3KFQ A;  4QRV A;  2D8S A;  2KR4 A;  2P86 A;  2XOC A;  3MHS A;  3ASL A;  3L1X A;  4MZS A;  2ECI A;  2L75 A;  3QT4 A;  4OEM A;  4CCG X;  4HXD B;  3V43 A;  5K3Q A;  1PPO A;  2QIC A;  2NQA A;  5J94 A;  2F42 A;  2C2L A;  4F1P A;  3TNX A;  1BQI A;  2FUI A;  1N87 A;  3ZVZ B;  3K24 A;  4QRX A;  3N9N A;  4WZ2 A;  2MNY A;  2LGG A;  4PP2 E;  3P5X A;  7PCK A;  2JTC A;  2LQ6 A;  4YAT A;  3KNV A;  3KDE C;  5A24 A;  1U6G B;  3PBH A;  2KFT A;  1PPP A;  5C11 A;  2VJE B;  3ZPV E;  2P57 A;  3I2D A;  4UP0 A;  3M7K A;  4N3W A;  3GL6 A;  2FE8 A;  5KH3 A;  2BAY A;  1DCQ A;  2ECV A;  4WA6 A;  5B76 A;  2DCB A;  4WZ3 B;  2MA5 A;  4R8P K;  4N4Z A;  4LKA A;  2KRE A;  1CTE A;  2AYN A;  3HTK C;  3P5U A;  2LXP C;  2PRE A;  2KKY A;  4YBT A;  4UP5 A;  2AGA A;  2LXH C;  2Y1N A;  1WFK A;  3TRK A;  4BOS A;  1PXV A;  1U9W A;  1ATK A;  2R9O A;  4PI3 A;  2YHO A;  2JMJ A;  3OIS A;  2G43 A;  1FBV A;  3KV6 A;  3CH2 X;  1PBH A;  2CKL B;  2Z84 A;  3S3R A;  2DOS A;  4MZO A;  1LDK C;  3T9K A;  2R9C A;  3CBJ A;  3MP2 A;  1GLO A;  4I7C A;  2K16 A;  2L0B A;  1WIL A;  5KH9 A;  3MTN A;  2FRA A;  2IQJ A;  3KSE A;  2M85 A;  1WEU A;  2LRI C;  2LDR A;  1MS6 A;  3HCU A;  4B7Y C;  2KWK A;  2I50 A;  4REZ A;  3V6C A;  2K4D A;  1M6D A;  2YUR A;  1EWO A;  3ZNI A;  2R9N A;  1IWD A;  2MKE A;  5LKX A;  1UKF A;  4W5B A;  2JMD A;  3U5P A;  3I3T A;  5EGW A;  4YAD A;  2G8J A;  2FTD A;  1U9V A;  3FJU B;  3O34 A;  2VJE A;  2XU3 A;  5D1M B;  2L7P A;  3RPG B;  3KKU A;  4DMX A;  4BHW A;  3BPM A;  2L80 A;  4N79 A;  4BS5 A;  1K2F A;  3FEH A;  3E9S A;  4MVT A;  3PSE A;  3FL2 A;  2XP0 A;  2AUX A;  1V87 A;  3PRM A;  3LQI A;  3BOW A;  4RF1 A;  4CDD B;  2OZ2 A;  2YJ8 A;  2MUM A;  4V3K C;  2HH5 A;  2RI7 A;  4R7E A;  4RF0 A;  5TAB A;  2KYU A;  2AN6 A;  2YYR A;  1THE A;  2YT5 A;  3T7L A;  4QBB A;  3E1Z B;  3U5O A;  3BWK A;  3O47 A;  3MHH A;  4KLB A;  2WBF X;  3K8U A;  3M99 A;  1PCI A;  3OVZ A;  5H1T A;  3Q1D A;  3O65 A;  4P6E A;  2LGV A;  2FFW A;  1EWP A;  1F29 A;  1WEE A;  3PHU A;  4MM3 B;  3W31 A;  1RMD A;  5TRB A;  3RVW A;  3BCN A;  2PNS A;  2IDA A;  4P5O B;  1CV8 A;  1Z60 A;  4BS6 A;  3WXF A;  3S3Q A;  2Y6E A;  2NAA A;  4B86 C;  3H7D A;  3SHB A;  1X4I A;  2DX8 A;  3QZV A;  1QDQ A;  2KWN A;  2YW8 A;  1TLO A;  4FIP A;  3RVX A;  3GCB A;  3P5W A;  3HCT A;  2M13 A;  3PUR A;  3QSD A;  5CHT A;  3LRQ A;  2DC9 A;  4N8W A;  3RNV A;  1KFX L;  2R9F A;  2YJC A;  5B75 A;  2LGK A;  2P7U A;  5G04 B;  4X6I A;  2UZG A;  5LKU A;  1YZB A;  4Q8G A;  2JRI A;  3IV2 A;  2ECJ A;  1F2A A;  4HWY A;  4D8B A;  2G8E A;  1MHW A;  4OW0 A;  4A4C A;  1AYV A;  2R6N A;  1AYW A;  2VHS A;  3CBK A;  3BY4 A;  5DIN A;  2LN0 A;  1MDW A;  2JMI A;  4MSX A;  3SOW A;  2FD4 A;  2ARY A;  3HHI A;  5LKT A;  3D6S A;  4D8E A;  1FH0 A;  2C2V S;  5H1U A;  3H6S A;  3M63 A;  1VJV A;  2FUU A;  3RVV A;  2GHU A;  4Z0R A;  4A4B A;  2KWO A;  2YUC A;  4D8I A;  2Y43 A;  3EB5 A;  3DPL R;  2CRW A;  1NQC A;  3C6W A;  3K9M A;  4XI1 A;  4AXM A;  5KO3 A;  2MA6 A;  1HYI A;  1XWH A;  4OVZ B;  2QIZ A;  4XZX A;  4GUA A;  5LCW B;  5FPW A;  2F1G A;  6PAD A;  4PPE A;  2RR4 A;  2JRJ A;  5FEY A;  1HUC B;  2FO5 A;  3AI8 A;  3F5V A;  4XR7 A;  2E01 A;  2XOY A;  4OGE A;  2Y5B A;  2H0D B;  2ATO A;  4G54 A;  3P5V A;  3CH3 X;  3DWD A;  1ZIV A;  1JM7 A;  2AYO A;  4YYS A;  4V3L C;  2XOZ A;  2OP3 A;  2CKL A;  1BGO A;  3NG2 A;  3E2D A;  3PHX A;  5JG6 A;  4L7X A;  2XB1 A;  5JZE A; 
#chains in the Genus database with same CATH homology
 4BPV A;  3SOX A;  4F52 B;  2MD7 B;  2C0Y A;  8PCH A;  5AIU A;  1JOC A;  2E02 A;  9PAP A;  4YYW A;  2NQI A;  4YBS A;  4YAB A;  3PDF A;  2DCC A;  3PNR A;  5CHV A;  1TL9 A;  4CDF B;  1NLJ A;  3L11 A;  2DJF B;  2F6J A;  2HDP A;  1A6R A;  2AUZ A;  4GUZ A;  2ECG A;  4P6G A;  4C9Z A;  2JQF R;  1TU6 A;  2KGG A;  3O33 A;  1Z2Q A;  3BPF A;  2LGL A;  2XU4 A;  4PP1 A;  1E2T A;  4N4F A;  1AU4 A;  2YQM A;  3N3G A;  4FO9 A;  1PPN A;  2YJ9 A;  2E03 A;  2ACT A;  4QH6 A;  1DEU A;  2M6M A;  1YVB A;  1XKG A;  2AS8 A;  4S3O B;  3KQI A;  3B79 A;  3KX1 A;  5D1K B;  1E4U A;  2KGI A;  3LQJ A;  3O35 A;  1GEC E;  4W4U A;  4AYC A;  2DCD A;  2FUD A;  3LXS A;  5PAD A;  5J3X A;  1G25 A;  2CT2 A;  4FJC A;  4L58 A;  1VD4 A;  1WEP A;  1LDJ B;  5D1L B;  4UI9 B;  2PBH A;  3WXG A;  3ERV A;  2YU4 A;  2ECW A;  2VFC A;  1U5I A;  2DC7 A;  3N9M A;  4C5P A;  3O36 A;  3T6R A;  2AU1 A;  3ZUA A;  3M62 A;  2KE1 A;  3IMA A;  3IHP A;  2VFB A;  3U8E A;  1POP A;  1Y4H A;  1MM2 A;  3VK6 A;  1DF0 A;  3KV5 A;  2HHN A;  3PW3 A;  4I04 A;  4QRG A;  3N9P A;  3H8C A;  1Y08 A;  5F02 A;  2CSY A;  1AIM A;  4ZDT A;  2Y1M A;  4A49 A;  2CSZ A;  4I7D A;  4X3G A;  2FRQ A;  1MM3 A;  1EWL A;  3N9Q A;  2MT5 A;  1GCB A;  2O6X A;  2M1R A;  4I07 A;  3ZTG A;  3O37 A;  3HHA A;  3ZVY A;  1AU0 A;  2KWJ A;  2PNX A;  1WEN A;  1ICF A;  1F2C A;  1CHC A;  2H0D A;  2EOD A;  3QJ3 A;  1JM7 B;  1CS8 A;  3OF8 A;  1ME3 A;  3V6E A;  1AU3 A;  3KWB X;  4GNF A;  4GND A;  2ECT A;  1ITO A;  1BY8 A;  2MNZ A;  2HYE D;  1WEO A;  1PE6 A;  1QMY A;  1CVZ A;  2R9M A;  4BQV A;  2M3H A;  2OUL A;  1BOR A;  3O70 A;  4LAD B;  4BBQ A;  3I06 A;  2YJB A;  2YSM A;  5JH3 A;  4K7C A;  1K3B B;  2IBI A;  5G05 B;  4PTB A;  2YRE A;  1WES A;  4WZ0 A;  1QOL A;  2YJ2 A;  5TDW A;  2QJ0 A;  1AU2 A;  2DC6 A;  2L5U A;  3H8B A;  2VJF B;  5K16 A;  4S3O C;  3RPG C;  1BP4 A;  1O0E A;  3N9O A;  1PIP A;  4RY2 A;  2XU5 A;  2G7Y A;  1F2B A;  2OXQ C;  1NPZ A;  1Z6U A;  4Q6F A;  1WE9 A;  2VPB A;  2CIO A;  1WIM A;  2AIM A;  1SP4 B;  1YAL A;  3DQV R;  2DJG B;  3N3K A;  1F62 A;  4DMY A;  2NQD B;  1VYX A;  1X9Y A;  2L43 A;  3N4C A;  2RSD A;  2FT2 A;  1YK8 A;  2JQG R;  1X4U A;  1EWM A;  1Q6K A;  1KHP A;  1ZCM A;  5CVO B;  5B78 A;  2HD5 A;  4YV8 A;  1W4T A;  1T1H A;  4W5C A;  4AP4 A;  2KIZ A;  1JQP A;  1WEQ A;  3DF0 A;  2H7J A;  3IUT A;  3ZYQ A;  5B79 A;  5TBN A;  3HD3 A;  1NB5 A;  1STF E;  3H89 A;  4YYR A;  2HXZ A;  2LV9 A;  2B1M A;  3LQH A;  4CZW A;  3USV A;  1U9Q X;  1AYU A;  2EA6 A;  3KW9 A;  3MOR A;  3OVX A;  3WXE A;  3LFY A;  2KU3 A;  5H1V A;  2VPG A;  1CSB B;  4OEL A;  2VPE A;  3C9E A;  4TKP B;  1YK7 A;  5B8D A;  3L1Z B;  4R2Y A;  2FSA A;  5B77 A;  2EGP A;  1MEG A;  4PAD A;  4YAX A;  3IOQ A;  1W6F A;  4YYV A;  2YSJ A;  1CPJ A;  4LJN A;  4NV7 A;  4X6H A;  1CJL A;  1MIR A;  5EYA F;  5EF4 A;  3D9W A;  4AUQ B;  1WEV A;  4IC2 A;  2K1J A;  3PHD A;  1HYJ A;  4I7B A;  1CB5 A;  2DC8 A;  3F75 A;  4CA1 A;  4Q8H A;  1ME4 A;  4GB0 A;  5FB0 A;  2G6Q A;  5TDR A;  1KXR A;  2MIQ A;  3RTR B;  4YVA A;  1YT7 A;  3PUQ A;  1IYM A;  3EB6 A;  5FER A;  3BC3 A;  2XEU A;  5C13 A;  4BGF A;  2FQ9 A;  2DZY A;  4LLB A;  1W5R A;  2VP7 A;  1CQD A;  1KFU L;  3O7A A;  1X4J A;  5LKZ A;  2DCA A;  3U5M A;  2PUY A;  1QXP A;  2E00 A;  5AIT A;  4O64 A;  5KH7 A;  1WGM A;  2E6R A;  3O0U A;  4YYU A;  3HCS A;  4FK5 A;  2ECN A;  4NN2 A;  4AVX A;  1EF7 A;  4QF3 A;  1MEM A;  2AVW A;  1FP0 A;  2XU1 A;  4ZUX U;  5H9M A;  1NB3 A;  4GNG A;  1GMY A;  4CDE B;  2F7D A;  3OF9 A;  2B1N A;  2PAD A;  4CDC B;  1ZBD B;  4AYC B;  4XUI A;  1WEW A;  2NQG A;  3SOU A;  5I3L A;  1VSN A;  2YHN A;  3IEJ A;  1KHQ A;  3N9L A;  2E6S A;  4AXL A;  3C5K A;  3GV4 A;  1DVP A;  2K17 A;  1AEC A;  4IC3 A;  4QF2 A;  1PPD A;  2MD8 C;  3LTW A;  3U5N A;  3NHE A;  4I05 A;  2VHF A;  2GFO A;  5JA7 A;  2G6D A;  2P0R A;  2BDL A;  3O1G A;  4GNE A;  5FB1 A;  4LK9 A;  2VNF A;  4YYQ A;  1SNK A;  4YC9 A;  1WEM A;  3ZPV 1;  2VJF A;  5G0F A;  4YBM A;  4X6J A;  2DZZ A;  2YQL A;  1S4V A;  2F6N A;  1PAD A;  2FYE A;  2CB5 A;  4ZQL A;  1NL6 A;  1U9X A;  3KWZ A;  3HWN A;  2VPD A;  5DKA A;  4A0C D;  2G45 A;  2ZET C;  5CVN B;  4BSQ A;  1VFY A;  2IPP B;  2BDZ A;  3KFQ A;  4QRV A;  2D8S A;  2KR4 A;  2P86 A;  3MHS A;  3ASL A;  3L1X A;  4MZS A;  2ECI A;  2L75 A;  3QT4 A;  4OEM A;  4CCG X;  3V43 A;  1PPO A;  2QIC A;  2NQA A;  5J94 A;  2F42 A;  2C2L A;  3TNX A;  1BQI A;  2FUI A;  1N87 A;  3ZVZ B;  3K24 A;  4QRX A;  3N9N A;  4WZ2 A;  2MNY A;  2LGG A;  4PP2 E;  3P5X A;  7PCK A;  2LQ6 A;  4YAT A;  3KNV A;  4B55 A;  5A24 A;  1U6G B;  3PBH A;  2KFT A;  1PPP A;  5C11 A;  2VJE B;  3ZPV E;  3I2D A;  4UP0 A;  4N3W A;  3GL6 A;  5KH3 A;  2BAY A;  2ECV A;  4WA6 A;  5B76 A;  2DCB A;  4WZ3 B;  2MA5 A;  4R8P K;  4N4Z A;  4LKA A;  2KRE A;  1CTE A;  2AYN A;  3HTK C;  3P5U A;  2LXP C;  2PRE A;  4YBT A;  4UP5 A;  2LXH C;  2Y1N A;  1WFK A;  1PXV A;  1U9W A;  1ATK A;  2R9O A;  4PI3 A;  2YHO A;  2JMJ A;  3OIS A;  2G43 A;  1FBV A;  3KV6 A;  3CH2 X;  1PBH A;  2CKL B;  3S3R A;  4MZO A;  1LDK C;  2R9C A;  3CBJ A;  1GLO A;  4I7C A;  2K16 A;  2L0B A;  1WIL A;  5KH9 A;  3MTN A;  2FRA A;  3KSE A;  2M85 A;  1WEU A;  2LRI C;  2LDR A;  1MS6 A;  3HCU A;  4B7Y C;  2KWK A;  2I50 A;  3V6C A;  2K4D A;  1M6D A;  2YUR A;  1EWO A;  3ZNI A;  2R9N A;  1IWD A;  5LKX A;  4W5B A;  2JMD A;  3U5P A;  3I3T A;  5EGW A;  4YAD A;  2G8J A;  2FTD A;  1U9V A;  3O34 A;  2VJE A;  2XU3 A;  5D1M B;  3RPG B;  3KKU A;  4DMX A;  4BHW A;  3BPM A;  2L80 A;  4N79 A;  4BS5 A;  1K2F A;  4MVT A;  3FL2 A;  2AUX A;  1V87 A;  3LQI A;  3BOW A;  4CDD B;  2OZ2 A;  2YJ8 A;  2MUM A;  4V3K C;  2HH5 A;  2RI7 A;  4R7E A;  5TAB A;  2KYU A;  2AN6 A;  2YYR A;  1THE A;  2YT5 A;  3T7L A;  4QBB A;  3E1Z B;  3U5O A;  3BWK A;  3MHH A;  4KLB A;  2WBF X;  3K8U A;  3M99 A;  1PCI A;  3OVZ A;  5H1T A;  4P6E A;  2LGV A;  1EWP A;  1F29 A;  1WEE A;  1RMD A;  5TRB A;  3RVW A;  3BCN A;  2PNS A;  2IDA A;  4P5O B;  1CV8 A;  1Z60 A;  4BS6 A;  3WXF A;  3S3Q A;  2Y6E A;  2NAA A;  4B86 C;  3H7D A;  3SHB A;  1X4I A;  2DX8 A;  3QZV A;  1QDQ A;  2KWN A;  4NV8 A;  2YW8 A;  1TLO A;  4FIP A;  3RVX A;  3GCB A;  3P5W A;  3HCT A;  5CHT A;  3PUR A;  3QSD A;  3LRQ A;  2DC9 A;  4N8W A;  1KFX L;  2R9F A;  2YJC A;  5B75 A;  2LGK A;  2P7U A;  5G04 B;  4X6I A;  2UZG A;  5LKU A;  4Q8G A;  3IV2 A;  2ECJ A;  1F2A A;  4HWY A;  2G8E A;  1MHW A;  4A4C A;  1AYV A;  2R6N A;  1AYW A;  2VHS A;  3CBK A;  5DIN A;  2LN0 A;  1MDW A;  2JMI A;  4MSX A;  3SOW A;  2ARY A;  3HHI A;  5LKT A;  3D6S A;  1FH0 A;  2C2V S;  5H1U A;  3H6S A;  3M63 A;  1VJV A;  2FUU A;  1GX3 A;  3RVV A;  2GHU A;  4A4B A;  2KWO A;  2YUC A;  2Y43 A;  3EB5 A;  3DPL R;  1NQC A;  3C6W A;  3K9M A;  4XI1 A;  4AXM A;  2MA6 A;  1HYI A;  1XWH A;  2QIZ A;  6PAD A;  5LCW B;  5FPW A;  2F1G A;  4PPE A;  2JRJ A;  5FEY A;  1HUC B;  2FO5 A;  3AI8 A;  3F5V A;  4XR7 A;  2E01 A;  2Y5B A;  2H0D B;  2ATO A;  4G54 A;  3P5V A;  3CH3 X;  1ZIV A;  1JM7 A;  2AYO A;  2BSZ A;  4YYS A;  4V3L C;  2OP3 A;  2CKL A;  1BGO A;  3NG2 A;  5CVM A;  5JG6 A;  4L7X A;  2XB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...