3MHHA

Structure of the saga ubp8/sgf11/sus1/sgf73 dub module
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
473
structure length
433
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTTSTNRQTGFIYLLTCAWKINSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQGECNAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly and function of the SAGA deubiquitinating module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 127
structure length 433
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3mhhA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3mhhA02
2YJ8A 4X3GA 2E01A 1POPA 4B7YC 4YBMA 1M6DA 2B1NA 2F6NA 2DC9A 3M62A 1WEUA 2AVWA 2VPGA 2YHOA 3LQJA 4GNFA 1SNKA 3KFQA 4QRXA 3O1GA 2ACTA 2LDRA 2UZGA 2YQMA 2CB5A 3P5UA 3O37A 2DCBA 4I7BA 4CA1A 2F6JA 4YAXA 5G04B 3HD3A 1JQPA 2HD5A 3F5VA 4FO9A 3CH2X 5LKUA 1KHQA 2L75A 1Q6KA 2FRQA 2EODA 5D1LB 3WXEA 1PPPA 1MHWA 5D1KB 4GNGA 1NLJA 2QIZA 2RI7A 2XEUA 3RPGC 2DJGB 5CVOB 2LGVA 2MD7B 4YBTA 2F42A 3HHIA 3HCUA 2PUYA 1CVZA 4YV8A 1PIPA 3ZVYA 3QZVA 3KNVA 2LXHC 4GNEA 3HTKC 1BY8A 3MORA 1K3BB 3RVVA 3KV5A 4WZ3B 4BSQA 1WEQA 5A24A 3IHPA 2M3HA 1MEMA 1NL6A 3CBJA 2GHUA 1TL9A 2NQDB 4YABA 2NQGA 1O0EA 3MHHA 4L7XA 4W4UA 1YALA 4FIPA 1WEPA 1YVBA 3LXSA 3USVA 5JA7A 5EF4A 3ZVZB 4AXMA 1LDJB 2E00A 2KYUA 1YK7A 3N9QA 5AITA 2KWOA 3MTNA 3C9EA 1AU0A 4N79A 2G45A 2CT2A 8PCHA 1PPNA 4K7CA 2R6NA 2IBIA 2M6MA 1ZCMA 1KFUL 1F62A 1QOLA 5TBNA 2DCDA 4CDEB 2E02A 2RSDA 2K16A 2MUMA 2FRAA 1CJLA 2KWNA 2DX8A 2FQ9A 5CHTA 3IV2A 3GL6A 1ATKA 5LKTA 2LN0A 1QXPA 5PADA 2HHNA 2C0YA 4YYUA 3H89A 2G8EA 4I7DA 2MNYA 4Q6FA 3T7LA 1WE9A 4DMYA 1A6RA 2G43A 4XUIA 1KXRA 2YJ9A 3U5OA 2PADA 3CBKA 4I04A 5TDRA 3C6WA 5LKZA 1XWHA 2QICA 2YSMA 3KKUA 5B79A 4BS5A 2R9MA 2DC8A 3KWBX 2E6SA 3I3TA 1CS8A 2FTDA 3O36A 4A4BA 1GCBA 3OISA 3U5PA 2P7UA 2H7JA 3H8CA 1AYVA 3MHSA 4N4FA 3BOWA 4S3OB 4V3KC 1U9WA 5G05B 4G54A 4PP1A 1PADA 3T6RA 3N3GA 2YJBA 4HWYA 1DVPA 2FYEA 2YJ2A 4IC2A 5B75A 2YHNA 3K8UA 5C13A 4MZSA 3N9OA 1RMDA 1CTEA 3BWKA 1ITOA 5EGWA 3O70A 4NN2A 2K1JA 3QJ3A 2IDAA 2P0RA 1TU6A 3KSEA 4YATA 2FO5A 1CSBB 3OVZA 4CDCB 4LK9A 1NB3A 2L80A 2VHFA 5JG6A 2AU1A 2XB1A 2EA6A 1CPJA 3SOUA 4C9ZA 1DEUA 4KLBA 5DINA 2OP3A 2XU5A 4V3LC 1N87A 4N3WA 2EGPA 1ME4A 4GNDA 2AYOA 4ZDTA 2JMJA 2K4DA 2L43A 1AIMA 1F2AA 1MEGA 2Y5BA 4AVXA 4I7CA 2ECJA 2KFTA 3LQHA 3K9MA 2G6DA 3C5KA 4W5BA 1FBVA 1VYXA 1MIRA 1X9YA 2FUDA 2JQFR 4PTBA 4A4CA 2L0BA 2IPPB 1WEOA 2CKLB 2MA6A 1CQDA 4QBBA 1X4IA 2LV9A 2OXQC 2VPBA 2R9FA 2MA5A 4LKAA 4BHWA 2LQ6A 3RVWA 3SHBA 4OEMA 1WFKA 3ZNIA 2H0DB 3QT4A 1ZIVA 3OF8A 2KIZA 3ZYQA 4ZQLA 3RTRB 3NHEA 1WESA 1BORA 2YSJA 5G0FA 1WEWA 1Z60A 1XKGA 1QDQA 2XU4A 1EWOA 2JQGR 3IMAA 3P5WA 1X4JA 1DF0A 5CHVA 4S3OC 1GLOA 3FL2A 1JOCA 5J94A 1U5IA 5H1VA 4AUQB 5FERA 4MSXA 1HUCB 3DF0A 4A0CD 1EF7A 4BPVA 5C11A 1S4VA 4CCGX 2FUUA 1WEEA 3V6CA 1F29A 5EYAF 3WXGA 1V87A 1EWPA 2F7DA 2YW8A 1EWLA 3P5XA 4YYRA 2M85A 1T1HA 5B76A 4YYQA 2YYRA 1CHCA 2R9CA 3O7AA 1U6GB 2YJCA 2VJFB 3H8BA 5CVNB 2LGGA 2JMDA 5DKAA 1BGOA 3BC3A 4QRGA 4P6EA 4GB0A 1FH0A 3KWZA 3LFYA 2L5UA 4PP2E 2CSZA 4B86C 3B79A 4YYSA 3N9NA 1AYUA 4P6GA 1KFXL 1PPOA 2ECWA 1AU4A 4WZ0A 4X6HA 5KH3A 1ICFA 2G6QA 4LADB 4R7EA 2VJEA 3ASLA 3N9MA 1AYWA 4UP0A 2GFOA 4W5CA 4UI9B 4YC9A 9PAPA 5F02A 3GV4A 1AU3A 2JRJA 4XI1A 4QF3A 2VJEB 1STFE 2AS8A 4UP5A 3O35A 2YU4A 3ZPV1 1F2BA 1VFYA 2DC6A 3P5VA 2F1GA 2KE1A 5FPWA 2CKLA 3PURA 4QH6A 3I2DA 3M63A 4FK5A 2AUZA 2AN6A 1WILA 1WENA 2YUCA 3NG2A 3CH3X 3L1XA 4I07A 1JM7B 1BP4A 1IWDA 3I06A 2MIQA 1NPZA 5D1MB 1HYIA 1F2CA 1U9VA 2VHSA 3S3QA 4AYCB 4CZWA 4YADA 2E6RA 1THEA 4BQVA 3RVXA 3O0UA 4LJNA 4O64A 4X6JA 3WXFA 1LDKC 4TKPB 1HYJA 3O33A 5H1TA 4BBQA 1SP4B 4PADA 4AXLA 2Y1NA 2OULA 4A49A 1NQCA 4PI3A 6PADA 2FT2A 2YURA 2HYED 2R9OA 3OF9A 4OELA 1VJVA 4Q8GA 5LKXA 3E1ZB 1PBHA 2AIMA 2ZETC 2DCAA 2VPDA 1PCIA 2DZZA 4BS6A 3LRQA 4X6IA 5KH7A 2JMIA 4AYCA 5FEYA 4FJCA 2VNFA 1GMYA 3BPFA 5TABA 1Z2QA 2G8JA 1NB5A 2CSYA 3IUTA 2BDLA 3BPMA 2Y6EA 1WEMA 1BQIA 3U5MA 2H0DA 2M1RA 3KQIA 5TDWA 3U8EA 4YVAA 5J3XA 1CB5A 2XU3A 1CV8A 1ZBDB 3ZUAA 2BAYA 5B78A 2KGGA 1TLOA 3ZPVE 3AI8A 4YBSA 2Y43A 3PNRA 2PREA 2LGKA 2FSAA 2PBHA 5FB1A 2HXZA 2DCCA 4RY2A 1WGMA 1YT7A 3L1ZB 3SOXA 3O34A 2LGLA 1X4UA 4QF2A 5KH9A 2D8SA 4R2YA 5CVMA 3N3KA 5FB0A 4QRVA 4R8PK 1EWMA 2K17A 2ECTA 1MDWA 4YYWA 3PHDA 1ME3A 2R9NA 2E03A 3HCSA 5K16A 5H9MA 1U9XA 2ECVA 3OVXA 1VSNA 2G7YA 2MD8C 3L11A 3EB6A 3BCNA 2VP7A 2YREA 5JH3A 1JM7A 1YK8A 3DPLR 1Y4HA 7PCKA 2ECIA 3ZTGA 2ECNA 2AYNA 3D6SA 5B8DA 2LRIC 2ECGA 5AIUA 2KR4A 1WIMA 2DZYA 3U5NA 1PXVA 1AU2A 3M99A 5LCWB 3N4CA 3PW3A 2O6XA 2YQLA 4DMXA 1FP0A 2AUXA 4ZUXU 4CDDB 2OZ2A 3EB5A 2ARYA 2B1MA 3KW9A 2PNSA 3PBHA 3SOWA 2KWJA 2C2LA 4YYVA 1Z6UA 3HCTA 2MT5A 4N8WA 2VJFA 4L58A 1MM2A 2P86A 2HDPA 3HWNA 2BDZA 2YT5A 3H6SA 3GCBA 1AECA 2ATOA 5TRBA 3KV6A 2KGIA 3S3RA 1IYMA 3IEJA 4WA6A 1MM3A 2XU1A 3VK6A 2MNZA 4MVTA 1K2FA 1WEVA 2C2VS 3DQVR 2WBFX 3PUQA 5B77A 1G25A 3RPGB 3IOQA 2PNXA 1Y08A 2KWKA 4P5OB 4XR7A 1KHPA 2I50A 4PPEA 1MS6A 1VD4A 3LQIA 2VPEA 2NQAA 2FUIA 3K24A 1U9QX 2LXPC 3HHAA 3PDFA 4LLBA 2DJFB 2Y1MA 4WZ2A 4IC3A 4F52B 4I05A 4MZOA 3TNXA 2NAAA 1E4UA 2DC7A 1GECE 1PPDA 3F75A 3N9LA 2NQIA 3KX1A 4AP4A 1QMYA 2QJ0A 2CIOA 4Q8HA 1PE6A 5H1UA 4N4ZA 3N9PA 3ERVA 3H7DA 5I3LA 2HH5A 4CDFB 2KREA 2KU3A 3V43A 3V6EA 3QSDA
chains in the Genus database with same CATH superfamily
2YJ8A 4X3GA 2E01A 1POPA 4B7YC 2KKYA 4YBMA 1M6DA 2B1NA 2F6NA 2DC9A 4OVZB 3M62A 1WEUA 5EZQA 2AVWA 2VPGA 2YHOA 3LQJA 4GNFA 3T9KA 1SNKA 3KFQA 4XZXA 4QRXA 3O1GA 2ACTA 2LDRA 2UZGA 2YQMA 2CB5A 3P5UA 2JUNA 3O37A 2DCBA 2JRIA 4I7BA 4CA1A 2F6JA 4YAXA 5G04B 3HD3A 1JQPA 2HD5A 3F5VA 4FO9A 3CH2X 5LKUA 1KHQA 2L75A 4OGEA 1Q6KA 2FRQA 2EODA 5D1LB 3WXEA 5SVIA 1MHWA 5D1KB 4GNGA 1NLJA 2QIZA 1PPPA 2RI7A 2XEUA 3PHXA 3H7HA 3RPGC 2DJGB 2DOSA 5CVOB 2LGVA 2MD7B 4YBTA 2F42A 3HHIA 2E61A 3HCUA 2PUYA 1CVZA 4YV8A 1PIPA 3ZVYA 3QZVA 3KNVA 2LXHC 4O62A 4GNEA 3HTKC 1BY8A 3MORA 1K3BB 3RVVA 3KV5A 4WZ3B 4BSQA 1WEQA 5A24A 3IHPA 2M3HA 5SVIB 1MEMA 1NL6A 3CBJA 2GHUA 1TL9A 4P16A 2NQDB 3MJ5A 4YABA 2NQGA 1O0EA 3IFUA 3MHHA 4L7XA 4W4UA 1YALA 4FIPA 4MM3B 1WEPA 1YVBA 3LXSA 3USVA 5JA7A 2CONA 5EF4A 3ZVZB 4AXMA 1LDJB 2E00A 2KYUA 1YK7A 3N9QA 5AITA 2KWOA 3MTNA 3C9EA 1AU0A 4N79A 2G45A 2CT2A 8PCHA 4IUMA 1PPNA 4R3DA 4K7CA 2R6NA 2IBIA 2M6MA 1ZCMA 1KFUL 1F62A 1QOLA 5TBNA 4HXDB 4F1PA 2DCDA 4CDEB 2E02A 4BOZA 2B0OE 2RSDA 2K16A 2MUMA 2FRAA 1CJLA 2KWNA 2DX8A 2FQ9A 5CHTA 3IV2A 3GL6A 3LVQE 1ATKA 5LKTA 2LN0A 1QXPA 2P57A 5PADA 2HHNA 2C0YA 4YYUA 3H89A 2G8EA 4I7DA 2MNYA 4Q6FA 3T7LA 1WE9A 4DMYA 3PRPA 4D8IA 5SVYA 1A6RA 2G43A 4XUIA 1KXRA 1MBMA 3C0RA 2YJ9A 3FJUB 3U5OA 2PADA 2RR4A 3CBKA 4I04A 5TDRA 3C6WA 5LKZA 1XWHA 2QICA 2YSMA 3KKUA 5B79A 3BY4A 2UZJA 4BS5A 2R9MA 2DC8A 3KWBX 2E6SA 2HWKA 3I3TA 1CS8A 2FTDA 3O36A 4A4BA 1GCBA 3OISA 3U5PA 2P7UA 2H7JA 3H8CA 1AYVA 3MHSA 4N4FA 3BOWA 4S3OB 4V3KC 1U9WA 5G05B 4G54A 4PP1A 1PADA 3T6RA 1YZBA 3N3GA 2YJBA 4HWYA 4D8EA 1DVPA 2FYEA 2YJ2A 4IC2A 5B75A 2YHNA 5SVXA 3K8UA 5C13A 4Z0OA 4MZSA 3N9OA 1RMDA 1CTEA 3BWKA 3E2DA 1ITOA 5EGWA 3BBAA 3O70A 4NN2A 2K1JA 3QJ3A 2D8UA 2IDAA 2P0RA 1TU6A 1DKIA 4YATA 2FO5A 1CSBB 3KSEA 3OVZA 4CDCB 4LK9A 3B21A 1NB3A 2L80A 2VHFA 5JG6A 2AU1A 2XB1A 2EA6A 1CPJA 3SOUA 4C9ZA 1DEUA 4KLBA 5DINA 2OP3A 2XU5A 4V3LC 1N87A 2EXUA 2EGPA 4N3WA 4GNDA 5K3QA 1ME4A 2AYOA 4ZDTA 2JMJA 2K4DA 2L43A 1AIMA 1F2AA 1MEGA 2Y5BA 4AVXA 4I7CA 2ECJA 2KFTA 3LQHA 3K9MA 3JUEA 2G6DA 3C5KA 4W5BA 1FBVA 1VYXA 1MIRA 4PT5A 3FM8C 1X9YA 2FUDA 2JQFR 4PTBA 4A4CA 2L0BA 2LAUA 2BTWB 1WEOA 2CKLB 2MA6A 1CQDA 2IPPB 4QBBA 1X4IA 2LV9A 2OXQC 2VPBA 2R9FA 2MA5A 4GUAA 4LKAA 4BHWA 2LQ6A 3RVWA 3W30A 3SHBA 4OEMA 1WFKA 3ZNIA 2H0DB 3QT4A 1DCQA 1ZIVA 3OF8A 2KIZA 3ZYQA 4ZQLA 3RTRB 3MDBC 1WESA 1BORA 2YSJA 3NHEA 5G0FA 2OWAA 3KDEC 1WEWA 1Z60A 1XKGA 1QDQA 2XU4A 1EWOA 2JQGR 3IMAA 3P5WA 1X4JA 1DF0A 5CHVA 4S3OC 1GLOA 3FL2A 1JOCA 5J94A 1U5IA 5H1VA 4AUQB 5FERA 4MSXA 1HUCB 3DF0A 4A0CD 1EF7A 4BPVA 3MTVA 4REZA 2EGMA 5C11A 1S4VA 4CCGX 2FUUA 1PVJA 1WEEA 3V6CA 1F29A 5EYAF 3WXGA 1V87A 1EWPA 2F7DA 2YW8A 1EWLA 3P5XA 4RF1A 4YYRA 2M85A 1T1HA 5B76A 4YYQA 2YYRA 1CHCA 2R9CA 4IP3A 3O7AA 1U6GB 5JZEA 2YJCA 2VJFB 3SUBA 3H8BA 5CVNB 2L7PA 4BOSA 3FANA 2LGGA 2JMDA 2FD4A 2CSVA 5DKAA 1BGOA 3BC3A 4QRGA 4P6EA 4GB0A 1FH0A 3KWZA 3LFYA 2L5UA 4PP2E 2CSZA 5EZSA 3Q1DA 4RNAA 4B86C 3B79A 4YYSA 3N9NA 1AYUA 2XOYA 4OVZA 4P6GA 1KFXL 1PPOA 2ECWA 1AU4A 4WZ0A 4X6HA 3MP2A 5KH3A 1ICFA 2G6QA 4LADB 4R7EA 2VJEA 3ASLA 3N9MA 1AYWA 4UP0A 2GFOA 4W5CA 4UI9B 4YC9A 9PAPA 5F02A 3GV4A 1AU3A 4D8BA 2JRJA 2YVRA 4XI1A 4QF3A 2VJEB 1STFE 2AS8A 4UP5A 3O35A 2YU4A 4BOPA 3ZPV1 1F2BA 1VFYA 2DC6A 3P5VA 2F1GA 4RF0A 2KE1A 5FPWA 2CKLA 3PURA 4QH6A 3I2DA 3M63A 4FK5A 2J7QA 2AUZA 2AN6A 1WILA 1WENA 2FFWA 2YUCA 3NG2A 3CH3X 3L1XA 4I07A 1JM7B 1BP4A 3E9SA 1IWDA 3I06A 2MIQA 1NPZA 4M0WA 5D1MB 1HYIA 1F2CA 1U9VA 2VHSA 3S3QA 4AYCB 2BU3A 4YADA 3ZNHA 4CZWA 2E6RA 1THEA 4BQVA 3RVXA 3O0UA 4LJNA 4O64A 4X6JA 3WXFA 1LDKC 4TKPB 1HYJA 4Z0RA 3O33A 5H1TA 4BBQA 1SP4B 4PADA 4AXLA 2Y1NA 2OULA 4A49A 1NQCA 4PI3A 6PADA 2FT2A 2M13A 2YURA 2HYED 4OGCA 2R9OA 3OF9A 1VJVA 4OELA 4Q8GA 4A5UA 3TRKA 5LKXA 3E1ZB 1PBHA 2AIMA 2ZETC 2DCAA 2VPDA 1PCIA 2DZZA 4BS6A 2KKXA 3LRQA 4X6IA 5KH7A 2JMIA 4AYCA 5FEYA 4FJCA 2VNFA 4BOQA 1GMYA 3BPFA 5TABA 1Z2QA 2G8JA 1NB5A 2CSYA 3IUTA 2BDLA 3W31A 3BPMA 2Y6EA 3PT2A 1WEMA 1BQIA 3U5MA 2H0DA 2M1RA 3KQIA 3LVRE 5TDWA 3U8EA 4YVAA 2DSMA 5J3XA 1CB5A 2XU3A 1CV8A 1ZBDB 1UKFA 3ZUAA 2BAYA 5B78A 2KGGA 5KO3A 1TLOA 3ZPVE 2CRRA 3AI8A 4YBSA 3M7KA 2Y43A 3PNRA 2PREA 3RNVA 2LGKA 2FSAA 2XP0A 2PBHA 3O47A 5FB1A 2HXZA 2DCCA 4RY2A 1WGMA 1YT7A 3L1ZB 3SOXA 3O34A 4OW0A 2LGLA 3LDYA 4BOUA 1X4UA 4QF2A 5KH9A 2D8SA 4R2YA 5CVMA 3N3KA 5FB0A 4QRVA 4R8PK 1EWMA 4H9DA 3TMPA 3PHUA 2K17A 2XOCA 2BTWA 2ECTA 1MDWA 4YYWA 3PHDA 2JTCA 1ME3A 2R9NA 2E03A 3HCSA 5K16A 5H9MA 1U9XA 2ECVA 3OVXA 1VSNA 5E6JA 2G7YA 2MD8C 3L11A 3EB6A 3BCNA 2VP7A 2XOZA 2YREA 5JH3A 2Z84A 1JM7A 1YK8A 3DPLR 1Y4HA 7PCKA 2ECIA 3ZTGA 2J7QC 2ECNA 2AYNA 3D6SA 5B8DA 2LRIC 2ECGA 5AIUA 4WURA 2KR4A 1WIMA 2JM3A 3U5NA 1PXVA 1AU2A 2DZYA 3M99A 3BB7A 3O65A 4QQ4A 5LCWB 3N4CA 3PW3A 2O6XA 2YQLA 4DMXA 1FP0A 2AUXA 4ZUXU 4CDDB 3FEHA 2OZ2A 3EB5A 3DDTA 2ARYA 2B1MA 3KW9A 2PNSA 3PBHA 3SOWA 2KWJA 2C2LA 4YYVA 1Z6UA 3HCTA 2MT5A 3PHWA 4N8WA 2VJFA 4L58A 1MM2A 2P86A 2HDPA 3HWNA 2BDZA 2YT5A 3H6SA 3GCBA 3DWDA 1AECA 2ATOA 3PRMA 3LJUX 5TRBA 3KV6A 2KGIA 3S3RA 1IYMA 3IEJA 4WA6A 1MM3A 3OQCA 4ZTBA 2XU1A 3VK6A 2MNZA 4MVTA 1K2FA 1WEVA 2C2VS 3DQVR 2WBFX 3PUQA 5B77A 1G25A 3RPGB 3IOQA 2PNXA 1Y08A 2KWKA 4P5OB 4XR7A 1KHPA 2I50A 3FAOA 4PPEA 1MS6A 1VD4A 2AGAA 3LQIA 2VPEA 2NQAA 2FUIA 3K24A 3PSEA 1U9QX 2LXPC 3HHAA 3PDFA 4LLBA 2DJFB 2Y1MA 4WZ2A 4IC3A 4F52B 4I05A 4MZOA 3TNXA 2NAAA 1E4UA 2DC7A 1GECE 1PPDA 3F75A 3N9LA 2NQIA 3KX1A 4AP4A 1QMYA 2IQJA 2QJ0A 2CIOA 4Q8HA 1PE6A 5H1UA 4MI7A 3N9PA 4N4ZA 4RKXA 3ERVA 3H7DA 5I3LA 2MKEA 2HH5A 4CDFB 2FE8A 2CRWA 2KREA 2KU3A 3PLWA 2DJAA 3V43A 3V6EA 3QSDA
chains in the Genus database with same CATH topology
2YJ8A 4X3GA 2E01A 1POPA 4B7YC 4YBMA 1M6DA 2B1NA 2F6NA 2DC9A 3D9WA 3M62A 1WEUA 2AVWA 2VPGA 2YHOA 3LQJA 4GNFA 1SNKA 3KFQA 4NV8A 4QRXA 3O1GA 2ACTA 2LDRA 2UZGA 2YQMA 2CB5A 3P5UA 3O37A 2DCBA 4I7BA 4CA1A 2F6JA 4YAXA 5G04B 3HD3A 1JQPA 2HD5A 3F5VA 4FO9A 3CH2X 5LKUA 1KHQA 2L75A 1Q6KA 2FRQA 2EODA 5D1LB 3WXEA 1PPPA 1MHWA 5D1KB 4GNGA 1NLJA 2QIZA 2RI7A 2XEUA 3RPGC 2DJGB 5CVOB 2LGVA 2MD7B 4YBTA 2F42A 3HHIA 3HCUA 2PUYA 1CVZA 4YV8A 1PIPA 3ZVYA 3QZVA 3KNVA 2LXHC 4GNEA 3HTKC 1BY8A 3MORA 1K3BB 3RVVA 3KV5A 4WZ3B 4BSQA 1WEQA 5A24A 3IHPA 2M3HA 1MEMA 1NL6A 3CBJA 2GHUA 1TL9A 2NQDB 4YABA 2NQGA 1O0EA 3MHHA 4L7XA 4W4UA 1YALA 4FIPA 1WEPA 1YVBA 3LXSA 3USVA 5JA7A 5EF4A 3ZVZB 4AXMA 1LDJB 2E00A 2KYUA 1YK7A 3N9QA 5AITA 2KWOA 3MTNA 3C9EA 1AU0A 4N79A 2G45A 2CT2A 8PCHA 1PPNA 4K7CA 2R6NA 2IBIA 2M6MA 1ZCMA 1KFUL 1F62A 1QOLA 5TBNA 1E2TA 2DCDA 4CDEB 2E02A 2RSDA 2K16A 2MUMA 2BSZA 2FRAA 1CJLA 2KWNA 2DX8A 2FQ9A 5CHTA 3IV2A 3GL6A 1ATKA 5LKTA 2LN0A 1QXPA 5PADA 2HHNA 2C0YA 4YYUA 3H89A 2G8EA 4I7DA 2MNYA 4Q6FA 3T7LA 1WE9A 4DMYA 1A6RA 2G43A 4XUIA 1KXRA 2YJ9A 3U5OA 2PADA 3CBKA 4I04A 5TDRA 3C6WA 5LKZA 1XWHA 2QICA 2YSMA 3KKUA 5B79A 4BS5A 2R9MA 2DC8A 3KWBX 2E6SA 3I3TA 1CS8A 2FTDA 3O36A 4A4BA 1GCBA 3OISA 3U5PA 2P7UA 2H7JA 3H8CA 1AYVA 3MHSA 4N4FA 3BOWA 4S3OB 4V3KC 1U9WA 5G05B 4G54A 4PP1A 1PADA 3T6RA 3N3GA 2YJBA 4HWYA 1DVPA 2FYEA 2YJ2A 4IC2A 5B75A 2YHNA 3K8UA 5C13A 4MZSA 3N9OA 1RMDA 1CTEA 3BWKA 1ITOA 5EGWA 3O70A 4NN2A 2K1JA 3QJ3A 2IDAA 2P0RA 1TU6A 3KSEA 4YATA 2FO5A 1CSBB 3OVZA 4CDCB 4LK9A 1NB3A 2L80A 2VHFA 1W6FA 5JG6A 2AU1A 2XB1A 2EA6A 1CPJA 3SOUA 4C9ZA 1DEUA 4KLBA 5DINA 2OP3A 2XU5A 4V3LC 1N87A 4N3WA 2EGPA 1ME4A 4GNDA 2AYOA 4ZDTA 2JMJA 2K4DA 2L43A 1AIMA 1F2AA 1MEGA 2Y5BA 4AVXA 4I7CA 2ECJA 2KFTA 3LQHA 3K9MA 2G6DA 3C5KA 4W5BA 1FBVA 1VYXA 1MIRA 1X9YA 2FUDA 2JQFR 4PTBA 4A4CA 2L0BA 2IPPB 1WEOA 2CKLB 2MA6A 1CQDA 4QBBA 1X4IA 2LV9A 2OXQC 2VPBA 2R9FA 2MA5A 4C5PA 4LKAA 4BHWA 2LQ6A 3RVWA 3SHBA 4OEMA 1WFKA 3ZNIA 2H0DB 3QT4A 1ZIVA 3OF8A 2KIZA 3ZYQA 4ZQLA 3RTRB 3NHEA 1WESA 1BORA 2YSJA 5G0FA 1WEWA 1Z60A 1XKGA 1QDQA 2XU4A 1EWOA 2JQGR 3IMAA 3P5WA 1X4JA 1DF0A 5CHVA 4S3OC 1GLOA 3FL2A 1JOCA 5J94A 1U5IA 5H1VA 4AUQB 5FERA 4MSXA 1HUCB 3DF0A 4A0CD 1EF7A 4BPVA 5C11A 1S4VA 4CCGX 2FUUA 1WEEA 3V6CA 1F29A 5EYAF 3WXGA 1V87A 1EWPA 2F7DA 2YW8A 1EWLA 3P5XA 4YYRA 2M85A 1T1HA 5B76A 4GUZA 4YYQA 2YYRA 1CHCA 2R9CA 3O7AA 1U6GB 2YJCA 2VJFB 3H8BA 5CVNB 2LGGA 2JMDA 5DKAA 1BGOA 3BC3A 4QRGA 4P6EA 4GB0A 1FH0A 3KWZA 3LFYA 2L5UA 4PP2E 2CSZA 4B86C 3B79A 4YYSA 3N9NA 1AYUA 4P6GA 1KFXL 1PPOA 2ECWA 1AU4A 4WZ0A 2VFCA 4X6HA 3LTWA 5KH3A 1ICFA 2G6QA 4LADB 4R7EA 2VJEA 3ASLA 3N9MA 1AYWA 4UP0A 2GFOA 4W5CA 4UI9B 4YC9A 9PAPA 5F02A 3GV4A 1AU3A 2JRJA 4XI1A 4QF3A 2VJEB 1STFE 2AS8A 4UP5A 3O35A 2YU4A 3ZPV1 1F2BA 1VFYA 1W4TA 2DC6A 2F1GA 3P5VA 2KE1A 5FPWA 2CKLA 3PURA 4QH6A 3I2DA 3M63A 4FK5A 2AUZA 2AN6A 1WILA 1WENA 2YUCA 3NG2A 3CH3X 3L1XA 4I07A 1JM7B 1BP4A 1IWDA 3I06A 2MIQA 1NPZA 5D1MB 1HYIA 1F2CA 1U9VA 2VHSA 3S3QA 4AYCB 4CZWA 4YADA 2E6RA 1THEA 4BQVA 3RVXA 3O0UA 4LJNA 4BGFA 4O64A 4X6JA 3WXFA 1LDKC 4TKPB 1HYJA 3O33A 5H1TA 4BBQA 1SP4B 4PADA 1W5RA 2Y1NA 2OULA 4AXLA 4A49A 1NQCA 4PI3A 6PADA 2FT2A 2YURA 2HYED 2R9OA 3OF9A 4OELA 1VJVA 4Q8GA 5LKXA 3E1ZB 1PBHA 2AIMA 2ZETC 2DCAA 2VPDA 1PCIA 2DZZA 4BS6A 3LRQA 4X6IA 5KH7A 2JMIA 2VFBA 4AYCA 5FEYA 4FJCA 2VNFA 1GMYA 3BPFA 5TABA 1Z2QA 2G8JA 1NB5A 2CSYA 3IUTA 2BDLA 3BPMA 2Y6EA 1WEMA 1BQIA 3U5MA 2H0DA 2M1RA 3KQIA 5TDWA 3U8EA 4YVAA 5J3XA 1CB5A 2XU3A 1CV8A 1ZBDB 3ZUAA 2BAYA 5B78A 2KGGA 1TLOA 3ZPVE 3AI8A 4YBSA 2Y43A 3PNRA 2PREA 2LGKA 2FSAA 2PBHA 5FB1A 2HXZA 2DCCA 4RY2A 1WGMA 1YT7A 3L1ZB 3SOXA 3O34A 2LGLA 1X4UA 4QF2A 5KH9A 2D8SA 4R2YA 5CVMA 3N3KA 5FB0A 4QRVA 4R8PK 1EWMA 2K17A 2ECTA 1MDWA 4YYWA 3PHDA 1ME3A 2R9NA 2E03A 3HCSA 5K16A 5H9MA 1U9XA 2ECVA 3OVXA 1VSNA 2G7YA 2MD8C 3L11A 3EB6A 3BCNA 2VP7A 2YREA 5JH3A 1JM7A 1YK8A 3DPLR 1Y4HA 7PCKA 2ECIA 3ZTGA 2ECNA 2AYNA 3D6SA 5B8DA 2LRIC 2ECGA 5AIUA 2KR4A 1WIMA 2DZYA 3U5NA 1PXVA 1AU2A 3M99A 5LCWB 3N4CA 3PW3A 2O6XA 2YQLA 4DMXA 1FP0A 2AUXA 4ZUXU 4NV7A 4CDDB 2OZ2A 3EB5A 2ARYA 2B1MA 3KW9A 2PNSA 3PBHA 3SOWA 2KWJA 2C2LA 4YYVA 1Z6UA 3HCTA 2MT5A 4N8WA 2VJFA 4L58A 1MM2A 2P86A 2HDPA 3HWNA 2BDZA 2YT5A 3H6SA 3GCBA 1AECA 2ATOA 5TRBA 3KV6A 2KGIA 3S3RA 1IYMA 3IEJA 4WA6A 1MM3A 2XU1A 3VK6A 2MNZA 4MVTA 1K2FA 1WEVA 2C2VS 3DQVR 2WBFX 3PUQA 5B77A 1G25A 3RPGB 3IOQA 2PNXA 1Y08A 2KWKA 4P5OB 4XR7A 1KHPA 2I50A 4PPEA 1MS6A 1VD4A 3LQIA 2VPEA 2NQAA 2FUIA 3K24A 1U9QX 2LXPC 3HHAA 1GX3A 3PDFA 4LLBA 2DJFB 2Y1MA 4WZ2A 4IC3A 4F52B 4I05A 4MZOA 3TNXA 2NAAA 1E4UA 2DC7A 1GECE 1PPDA 3F75A 3N9LA 2NQIA 3KX1A 4AP4A 1QMYA 2QJ0A 2CIOA 4Q8HA 1PE6A 5H1UA 4N4ZA 3N9PA 3ERVA 3H7DA 5I3LA 2HH5A 4CDFB 2KREA 2KU3A 4B55A 3V43A 3V6EA 3QSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ8 A;  4X3G A;  2E01 A;  1POP A;  4B7Y C;  4YBM A;  1M6D A;  2B1N A;  2F6N A;  2DC9 A;  3M62 A;  1WEU A;  2AVW A;  2VPG A;  2YHO A;  3LQJ A;  4GNF A;  1SNK A;  3KFQ A;  4QRX A;  3O1G A;  2ACT A;  2LDR A;  2UZG A;  2YQM A;  2CB5 A;  3P5U A;  3O37 A;  2DCB A;  4I7B A;  4CA1 A;  2F6J A;  4YAX A;  5G04 B;  3HD3 A;  1JQP A;  2HD5 A;  3F5V A;  4FO9 A;  3CH2 X;  5LKU A;  1KHQ A;  2L75 A;  1Q6K A;  2FRQ A;  2EOD A;  5D1L B;  3WXE A;  1PPP A;  1MHW A;  5D1K B;  4GNG A;  1NLJ A;  2QIZ A;  2RI7 A;  2XEU A;  3RPG C;  2DJG B;  5CVO B;  2LGV A;  2MD7 B;  4YBT A;  2F42 A;  3HHI A;  3HCU A;  2PUY A;  1CVZ A;  4YV8 A;  1PIP A;  3ZVY A;  3QZV A;  3KNV A;  2LXH C;  4GNE A;  3HTK C;  1BY8 A;  3MOR A;  1K3B B;  3RVV A;  3KV5 A;  4WZ3 B;  4BSQ A;  1WEQ A;  5A24 A;  3IHP A;  2M3H A;  1MEM A;  1NL6 A;  3CBJ A;  2GHU A;  1TL9 A;  2NQD B;  4YAB A;  2NQG A;  1O0E A;  3MHH A;  4L7X A;  4W4U A;  1YAL A;  4FIP A;  1WEP A;  1YVB A;  3LXS A;  3USV A;  5JA7 A;  5EF4 A;  3ZVZ B;  4AXM A;  1LDJ B;  2E00 A;  2KYU A;  1YK7 A;  3N9Q A;  5AIT A;  2KWO A;  3MTN A;  3C9E A;  1AU0 A;  4N79 A;  2G45 A;  2CT2 A;  8PCH A;  1PPN A;  4K7C A;  2R6N A;  2IBI A;  2M6M A;  1ZCM A;  1KFU L;  1F62 A;  1QOL A;  5TBN A;  2DCD A;  4CDE B;  2E02 A;  2RSD A;  2K16 A;  2MUM A;  2FRA A;  1CJL A;  2KWN A;  2DX8 A;  2FQ9 A;  5CHT A;  3IV2 A;  3GL6 A;  1ATK A;  5LKT A;  2LN0 A;  1QXP A;  5PAD A;  2HHN A;  2C0Y A;  4YYU A;  3H89 A;  2G8E A;  4I7D A;  2MNY A;  4Q6F A;  3T7L A;  1WE9 A;  4DMY A;  1A6R A;  2G43 A;  4XUI A;  1KXR A;  2YJ9 A;  3U5O A;  2PAD A;  3CBK A;  4I04 A;  5TDR A;  3C6W A;  5LKZ A;  1XWH A;  2QIC A;  2YSM A;  3KKU A;  5B79 A;  4BS5 A;  2R9M A;  2DC8 A;  3KWB X;  2E6S A;  3I3T A;  1CS8 A;  2FTD A;  3O36 A;  4A4B A;  1GCB A;  3OIS A;  3U5P A;  2P7U A;  2H7J A;  3H8C A;  1AYV A;  3MHS A;  4N4F A;  3BOW A;  4S3O B;  4V3K C;  1U9W A;  5G05 B;  4G54 A;  4PP1 A;  1PAD A;  3T6R A;  3N3G A;  2YJB A;  4HWY A;  1DVP A;  2FYE A;  2YJ2 A;  4IC2 A;  5B75 A;  2YHN A;  3K8U A;  5C13 A;  4MZS A;  3N9O A;  1RMD A;  1CTE A;  3BWK A;  1ITO A;  5EGW A;  3O70 A;  4NN2 A;  2K1J A;  3QJ3 A;  2IDA A;  2P0R A;  1TU6 A;  3KSE A;  4YAT A;  2FO5 A;  1CSB B;  3OVZ A;  4CDC B;  4LK9 A;  1NB3 A;  2L80 A;  2VHF A;  5JG6 A;  2AU1 A;  2XB1 A;  2EA6 A;  1CPJ A;  3SOU A;  4C9Z A;  1DEU A;  4KLB A;  5DIN A;  2OP3 A;  2XU5 A;  4V3L C;  1N87 A;  4N3W A;  2EGP A;  1ME4 A;  4GND A;  2AYO A;  4ZDT A;  2JMJ A;  2K4D A;  2L43 A;  1AIM A;  1F2A A;  1MEG A;  2Y5B A;  4AVX A;  4I7C A;  2ECJ A;  2KFT A;  3LQH A;  3K9M A;  2G6D A;  3C5K A;  4W5B A;  1FBV A;  1VYX A;  1MIR A;  1X9Y A;  2FUD A;  2JQF R;  4PTB A;  4A4C A;  2L0B A;  2IPP B;  1WEO A;  2CKL B;  2MA6 A;  1CQD A;  4QBB A;  1X4I A;  2LV9 A;  2OXQ C;  2VPB A;  2R9F A;  2MA5 A;  4LKA A;  4BHW A;  2LQ6 A;  3RVW A;  3SHB A;  4OEM A;  1WFK A;  3ZNI A;  2H0D B;  3QT4 A;  1ZIV A;  3OF8 A;  2KIZ A;  3ZYQ A;  4ZQL A;  3RTR B;  3NHE A;  1WES A;  1BOR A;  2YSJ A;  5G0F A;  1WEW A;  1Z60 A;  1XKG A;  1QDQ A;  2XU4 A;  1EWO A;  2JQG R;  3IMA A;  3P5W A;  1X4J A;  1DF0 A;  5CHV A;  4S3O C;  1GLO A;  3FL2 A;  1JOC A;  5J94 A;  1U5I A;  5H1V A;  4AUQ B;  5FER A;  4MSX A;  1HUC B;  3DF0 A;  4A0C D;  1EF7 A;  4BPV A;  5C11 A;  1S4V A;  4CCG X;  2FUU A;  1WEE A;  3V6C A;  1F29 A;  5EYA F;  3WXG A;  1V87 A;  1EWP A;  2F7D A;  2YW8 A;  1EWL A;  3P5X A;  4YYR A;  2M85 A;  1T1H A;  5B76 A;  4YYQ A;  2YYR A;  1CHC A;  2R9C A;  3O7A A;  1U6G B;  2YJC A;  2VJF B;  3H8B A;  5CVN B;  2LGG A;  2JMD A;  5DKA A;  1BGO A;  3BC3 A;  4QRG A;  4P6E A;  4GB0 A;  1FH0 A;  3KWZ A;  3LFY A;  2L5U A;  4PP2 E;  2CSZ A;  4B86 C;  3B79 A;  4YYS A;  3N9N A;  1AYU A;  4P6G A;  1KFX L;  1PPO A;  2ECW A;  1AU4 A;  4WZ0 A;  4X6H A;  5KH3 A;  1ICF A;  2G6Q A;  4LAD B;  4R7E A;  2VJE A;  3ASL A;  3N9M A;  1AYW A;  4UP0 A;  2GFO A;  4W5C A;  4UI9 B;  4YC9 A;  9PAP A;  5F02 A;  3GV4 A;  1AU3 A;  2JRJ A;  4XI1 A;  4QF3 A;  2VJE B;  1STF E;  2AS8 A;  4UP5 A;  3O35 A;  2YU4 A;  3ZPV 1;  1F2B A;  1VFY A;  2DC6 A;  3P5V A;  2F1G A;  2KE1 A;  5FPW A;  2CKL A;  3PUR A;  4QH6 A;  3I2D A;  3M63 A;  4FK5 A;  2AUZ A;  2AN6 A;  1WIL A;  1WEN A;  2YUC A;  3NG2 A;  3CH3 X;  3L1X A;  4I07 A;  1JM7 B;  1BP4 A;  1IWD A;  3I06 A;  2MIQ A;  1NPZ A;  5D1M B;  1HYI A;  1F2C A;  1U9V A;  2VHS A;  3S3Q A;  4AYC B;  4CZW A;  4YAD A;  2E6R A;  1THE A;  4BQV A;  3RVX A;  3O0U A;  4LJN A;  4O64 A;  4X6J A;  3WXF A;  1LDK C;  4TKP B;  1HYJ A;  3O33 A;  5H1T A;  4BBQ A;  1SP4 B;  4PAD A;  4AXL A;  2Y1N A;  2OUL A;  4A49 A;  1NQC A;  4PI3 A;  6PAD A;  2FT2 A;  2YUR A;  2HYE D;  2R9O A;  3OF9 A;  4OEL A;  1VJV A;  4Q8G A;  5LKX A;  3E1Z B;  1PBH A;  2AIM A;  2ZET C;  2DCA A;  2VPD A;  1PCI A;  2DZZ A;  4BS6 A;  3LRQ A;  4X6I A;  5KH7 A;  2JMI A;  4AYC A;  5FEY A;  4FJC A;  2VNF A;  1GMY A;  3BPF A;  5TAB A;  1Z2Q A;  2G8J A;  1NB5 A;  2CSY A;  3IUT A;  2BDL A;  3BPM A;  2Y6E A;  1WEM A;  1BQI A;  3U5M A;  2H0D A;  2M1R A;  3KQI A;  5TDW A;  3U8E A;  4YVA A;  5J3X A;  1CB5 A;  2XU3 A;  1CV8 A;  1ZBD B;  3ZUA A;  2BAY A;  5B78 A;  2KGG A;  1TLO A;  3ZPV E;  3AI8 A;  4YBS A;  2Y43 A;  3PNR A;  2PRE A;  2LGK A;  2FSA A;  2PBH A;  5FB1 A;  2HXZ A;  2DCC A;  4RY2 A;  1WGM A;  1YT7 A;  3L1Z B;  3SOX A;  3O34 A;  2LGL A;  1X4U A;  4QF2 A;  5KH9 A;  2D8S A;  4R2Y A;  5CVM A;  3N3K A;  5FB0 A;  4QRV A;  4R8P K;  1EWM A;  2K17 A;  2ECT A;  1MDW A;  4YYW A;  3PHD A;  1ME3 A;  2R9N A;  2E03 A;  3HCS A;  5K16 A;  5H9M A;  1U9X A;  2ECV A;  3OVX A;  1VSN A;  2G7Y A;  2MD8 C;  3L11 A;  3EB6 A;  3BCN A;  2VP7 A;  2YRE A;  5JH3 A;  1JM7 A;  1YK8 A;  3DPL R;  1Y4H A;  7PCK A;  2ECI A;  3ZTG A;  2ECN A;  2AYN A;  3D6S A;  5B8D A;  2LRI C;  2ECG A;  5AIU A;  2KR4 A;  1WIM A;  2DZY A;  3U5N A;  1PXV A;  1AU2 A;  3M99 A;  5LCW B;  3N4C A;  3PW3 A;  2O6X A;  2YQL A;  4DMX A;  1FP0 A;  2AUX A;  4ZUX U;  4CDD B;  2OZ2 A;  3EB5 A;  2ARY A;  2B1M A;  3KW9 A;  2PNS A;  3PBH A;  3SOW A;  2KWJ A;  2C2L A;  4YYV A;  1Z6U A;  3HCT A;  2MT5 A;  4N8W A;  2VJF A;  4L58 A;  1MM2 A;  2P86 A;  2HDP A;  3HWN A;  2BDZ A;  2YT5 A;  3H6S A;  3GCB A;  1AEC A;  2ATO A;  5TRB A;  3KV6 A;  2KGI A;  3S3R A;  1IYM A;  3IEJ A;  4WA6 A;  1MM3 A;  2XU1 A;  3VK6 A;  2MNZ A;  4MVT A;  1K2F A;  1WEV A;  2C2V S;  3DQV R;  2WBF X;  3PUQ A;  5B77 A;  1G25 A;  3RPG B;  3IOQ A;  2PNX A;  1Y08 A;  2KWK A;  4P5O B;  4XR7 A;  1KHP A;  2I50 A;  4PPE A;  1MS6 A;  1VD4 A;  3LQI A;  2VPE A;  2NQA A;  2FUI A;  3K24 A;  1U9Q X;  2LXP C;  3HHA A;  3PDF A;  4LLB A;  2DJF B;  2Y1M A;  4WZ2 A;  4IC3 A;  4F52 B;  4I05 A;  4MZO A;  3TNX A;  2NAA A;  1E4U A;  2DC7 A;  1GEC E;  1PPD A;  3F75 A;  3N9L A;  2NQI A;  3KX1 A;  4AP4 A;  1QMY A;  2QJ0 A;  2CIO A;  4Q8H A;  1PE6 A;  5H1U A;  4N4Z A;  3N9P A;  3ERV A;  3H7D A;  5I3L A;  2HH5 A;  4CDF B;  2KRE A;  2KU3 A;  3V43 A;  3V6E A;  3QSD A; 
#chains in the Genus database with same CATH topology
 2YJ8 A;  4X3G A;  2E01 A;  1POP A;  4B7Y C;  2KKY A;  4YBM A;  1M6D A;  2B1N A;  2F6N A;  2DC9 A;  4OVZ B;  3M62 A;  1WEU A;  5EZQ A;  2AVW A;  2VPG A;  2YHO A;  3LQJ A;  4GNF A;  3T9K A;  1SNK A;  3KFQ A;  4XZX A;  4QRX A;  3O1G A;  2ACT A;  2LDR A;  2UZG A;  2YQM A;  2CB5 A;  3P5U A;  2JUN A;  3O37 A;  2DCB A;  2JRI A;  4I7B A;  4CA1 A;  2F6J A;  4YAX A;  5G04 B;  3HD3 A;  1JQP A;  2HD5 A;  3F5V A;  4FO9 A;  3CH2 X;  5LKU A;  1KHQ A;  2L75 A;  4OGE A;  1Q6K A;  2FRQ A;  2EOD A;  5D1L B;  3WXE A;  5SVI A;  1MHW A;  5D1K B;  4GNG A;  1NLJ A;  2QIZ A;  1PPP A;  2RI7 A;  2XEU A;  3PHX A;  3H7H A;  3RPG C;  2DJG B;  2DOS A;  5CVO B;  2LGV A;  2MD7 B;  4YBT A;  2F42 A;  3HHI A;  2E61 A;  3HCU A;  2PUY A;  1CVZ A;  4YV8 A;  1PIP A;  3ZVY A;  3QZV A;  3KNV A;  2LXH C;  4O62 A;  4GNE A;  3HTK C;  1BY8 A;  3MOR A;  1K3B B;  3RVV A;  3KV5 A;  4WZ3 B;  4BSQ A;  1WEQ A;  5A24 A;  3IHP A;  2M3H A;  5SVI B;  1MEM A;  1NL6 A;  3CBJ A;  2GHU A;  1TL9 A;  4P16 A;  2NQD B;  3MJ5 A;  4YAB A;  2NQG A;  1O0E A;  3IFU A;  3MHH A;  4L7X A;  4W4U A;  1YAL A;  4FIP A;  4MM3 B;  1WEP A;  1YVB A;  3LXS A;  3USV A;  5JA7 A;  2CON A;  5EF4 A;  3ZVZ B;  4AXM A;  1LDJ B;  2E00 A;  2KYU A;  1YK7 A;  3N9Q A;  5AIT A;  2KWO A;  3MTN A;  3C9E A;  1AU0 A;  4N79 A;  2G45 A;  2CT2 A;  8PCH A;  4IUM A;  1PPN A;  4R3D A;  4K7C A;  2R6N A;  2IBI A;  2M6M A;  1ZCM A;  1KFU L;  1F62 A;  1QOL A;  5TBN A;  4HXD B;  4F1P A;  2DCD A;  4CDE B;  2E02 A;  4BOZ A;  2B0O E;  2RSD A;  2K16 A;  2MUM A;  2FRA A;  1CJL A;  2KWN A;  2DX8 A;  2FQ9 A;  5CHT A;  3IV2 A;  3GL6 A;  3LVQ E;  1ATK A;  5LKT A;  2LN0 A;  1QXP A;  2P57 A;  5PAD A;  2HHN A;  2C0Y A;  4YYU A;  3H89 A;  2G8E A;  4I7D A;  2MNY A;  4Q6F A;  3T7L A;  1WE9 A;  4DMY A;  3PRP A;  4D8I A;  5SVY A;  1A6R A;  2G43 A;  4XUI A;  1KXR A;  1MBM A;  3C0R A;  2YJ9 A;  3FJU B;  3U5O A;  2PAD A;  2RR4 A;  3CBK A;  4I04 A;  5TDR A;  3C6W A;  5LKZ A;  1XWH A;  2QIC A;  2YSM A;  3KKU A;  5B79 A;  3BY4 A;  2UZJ A;  4BS5 A;  2R9M A;  2DC8 A;  3KWB X;  2E6S A;  2HWK A;  3I3T A;  1CS8 A;  2FTD A;  3O36 A;  4A4B A;  1GCB A;  3OIS A;  3U5P A;  2P7U A;  2H7J A;  3H8C A;  1AYV A;  3MHS A;  4N4F A;  3BOW A;  4S3O B;  4V3K C;  1U9W A;  5G05 B;  4G54 A;  4PP1 A;  1PAD A;  3T6R A;  1YZB A;  3N3G A;  2YJB A;  4HWY A;  4D8E A;  1DVP A;  2FYE A;  2YJ2 A;  4IC2 A;  5B75 A;  2YHN A;  5SVX A;  3K8U A;  5C13 A;  4Z0O A;  4MZS A;  3N9O A;  1RMD A;  1CTE A;  3BWK A;  3E2D A;  1ITO A;  5EGW A;  3BBA A;  3O70 A;  4NN2 A;  2K1J A;  3QJ3 A;  2D8U A;  2IDA A;  2P0R A;  1TU6 A;  1DKI A;  4YAT A;  2FO5 A;  1CSB B;  3KSE A;  3OVZ A;  4CDC B;  4LK9 A;  3B21 A;  1NB3 A;  2L80 A;  2VHF A;  5JG6 A;  2AU1 A;  2XB1 A;  2EA6 A;  1CPJ A;  3SOU A;  4C9Z A;  1DEU A;  4KLB A;  5DIN A;  2OP3 A;  2XU5 A;  4V3L C;  1N87 A;  2EXU A;  2EGP A;  4N3W A;  4GND A;  5K3Q A;  1ME4 A;  2AYO A;  4ZDT A;  2JMJ A;  2K4D A;  2L43 A;  1AIM A;  1F2A A;  1MEG A;  2Y5B A;  4AVX A;  4I7C A;  2ECJ A;  2KFT A;  3LQH A;  3K9M A;  3JUE A;  2G6D A;  3C5K A;  4W5B A;  1FBV A;  1VYX A;  1MIR A;  4PT5 A;  3FM8 C;  1X9Y A;  2FUD A;  2JQF R;  4PTB A;  4A4C A;  2L0B A;  2LAU A;  2BTW B;  1WEO A;  2CKL B;  2MA6 A;  1CQD A;  2IPP B;  4QBB A;  1X4I A;  2LV9 A;  2OXQ C;  2VPB A;  2R9F A;  2MA5 A;  4GUA A;  4LKA A;  4BHW A;  2LQ6 A;  3RVW A;  3W30 A;  3SHB A;  4OEM A;  1WFK A;  3ZNI A;  2H0D B;  3QT4 A;  1DCQ A;  1ZIV A;  3OF8 A;  2KIZ A;  3ZYQ A;  4ZQL A;  3RTR B;  3MDB C;  1WES A;  1BOR A;  2YSJ A;  3NHE A;  5G0F A;  2OWA A;  3KDE C;  1WEW A;  1Z60 A;  1XKG A;  1QDQ A;  2XU4 A;  1EWO A;  2JQG R;  3IMA A;  3P5W A;  1X4J A;  1DF0 A;  5CHV A;  4S3O C;  1GLO A;  3FL2 A;  1JOC A;  5J94 A;  1U5I A;  5H1V A;  4AUQ B;  5FER A;  4MSX A;  1HUC B;  3DF0 A;  4A0C D;  1EF7 A;  4BPV A;  3MTV A;  4REZ A;  2EGM A;  5C11 A;  1S4V A;  4CCG X;  2FUU A;  1PVJ A;  1WEE A;  3V6C A;  1F29 A;  5EYA F;  3WXG A;  1V87 A;  1EWP A;  2F7D A;  2YW8 A;  1EWL A;  3P5X A;  4RF1 A;  4YYR A;  2M85 A;  1T1H A;  5B76 A;  4YYQ A;  2YYR A;  1CHC A;  2R9C A;  4IP3 A;  3O7A A;  1U6G B;  5JZE A;  2YJC A;  2VJF B;  3SUB A;  3H8B A;  5CVN B;  2L7P A;  4BOS A;  3FAN A;  2LGG A;  2JMD A;  2FD4 A;  2CSV A;  5DKA A;  1BGO A;  3BC3 A;  4QRG A;  4P6E A;  4GB0 A;  1FH0 A;  3KWZ A;  3LFY A;  2L5U A;  4PP2 E;  2CSZ A;  5EZS A;  3Q1D A;  4RNA A;  4B86 C;  3B79 A;  4YYS A;  3N9N A;  1AYU A;  2XOY A;  4OVZ A;  4P6G A;  1KFX L;  1PPO A;  2ECW A;  1AU4 A;  4WZ0 A;  4X6H A;  3MP2 A;  5KH3 A;  1ICF A;  2G6Q A;  4LAD B;  4R7E A;  2VJE A;  3ASL A;  3N9M A;  1AYW A;  4UP0 A;  2GFO A;  4W5C A;  4UI9 B;  4YC9 A;  9PAP A;  5F02 A;  3GV4 A;  1AU3 A;  4D8B A;  2JRJ A;  2YVR A;  4XI1 A;  4QF3 A;  2VJE B;  1STF E;  2AS8 A;  4UP5 A;  3O35 A;  2YU4 A;  4BOP A;  3ZPV 1;  1F2B A;  1VFY A;  2DC6 A;  3P5V A;  2F1G A;  4RF0 A;  2KE1 A;  5FPW A;  2CKL A;  3PUR A;  4QH6 A;  3I2D A;  3M63 A;  4FK5 A;  2J7Q A;  2AUZ A;  2AN6 A;  1WIL A;  1WEN A;  2FFW A;  2YUC A;  3NG2 A;  3CH3 X;  3L1X A;  4I07 A;  1JM7 B;  1BP4 A;  3E9S A;  1IWD A;  3I06 A;  2MIQ A;  1NPZ A;  4M0W A;  5D1M B;  1HYI A;  1F2C A;  1U9V A;  2VHS A;  3S3Q A;  4AYC B;  2BU3 A;  4YAD A;  3ZNH A;  4CZW A;  2E6R A;  1THE A;  4BQV A;  3RVX A;  3O0U A;  4LJN A;  4O64 A;  4X6J A;  3WXF A;  1LDK C;  4TKP B;  1HYJ A;  4Z0R A;  3O33 A;  5H1T A;  4BBQ A;  1SP4 B;  4PAD A;  4AXL A;  2Y1N A;  2OUL A;  4A49 A;  1NQC A;  4PI3 A;  6PAD A;  2FT2 A;  2M13 A;  2YUR A;  2HYE D;  4OGC A;  2R9O A;  3OF9 A;  1VJV A;  4OEL A;  4Q8G A;  4A5U A;  3TRK A;  5LKX A;  3E1Z B;  1PBH A;  2AIM A;  2ZET C;  2DCA A;  2VPD A;  1PCI A;  2DZZ A;  4BS6 A;  2KKX A;  3LRQ A;  4X6I A;  5KH7 A;  2JMI A;  4AYC A;  5FEY A;  4FJC A;  2VNF A;  4BOQ A;  1GMY A;  3BPF A;  5TAB A;  1Z2Q A;  2G8J A;  1NB5 A;  2CSY A;  3IUT A;  2BDL A;  3W31 A;  3BPM A;  2Y6E A;  3PT2 A;  1WEM A;  1BQI A;  3U5M A;  2H0D A;  2M1R A;  3KQI A;  3LVR E;  5TDW A;  3U8E A;  4YVA A;  2DSM A;  5J3X A;  1CB5 A;  2XU3 A;  1CV8 A;  1ZBD B;  1UKF A;  3ZUA A;  2BAY A;  5B78 A;  2KGG A;  5KO3 A;  1TLO A;  3ZPV E;  2CRR A;  3AI8 A;  4YBS A;  3M7K A;  2Y43 A;  3PNR A;  2PRE A;  3RNV A;  2LGK A;  2FSA A;  2XP0 A;  2PBH A;  3O47 A;  5FB1 A;  2HXZ A;  2DCC A;  4RY2 A;  1WGM A;  1YT7 A;  3L1Z B;  3SOX A;  3O34 A;  4OW0 A;  2LGL A;  3LDY A;  4BOU A;  1X4U A;  4QF2 A;  5KH9 A;  2D8S A;  4R2Y A;  5CVM A;  3N3K A;  5FB0 A;  4QRV A;  4R8P K;  1EWM A;  4H9D A;  3TMP A;  3PHU A;  2K17 A;  2XOC A;  2BTW A;  2ECT A;  1MDW A;  4YYW A;  3PHD A;  2JTC A;  1ME3 A;  2R9N A;  2E03 A;  3HCS A;  5K16 A;  5H9M A;  1U9X A;  2ECV A;  3OVX A;  1VSN A;  5E6J A;  2G7Y A;  2MD8 C;  3L11 A;  3EB6 A;  3BCN A;  2VP7 A;  2XOZ A;  2YRE A;  5JH3 A;  2Z84 A;  1JM7 A;  1YK8 A;  3DPL R;  1Y4H A;  7PCK A;  2ECI A;  3ZTG A;  2J7Q C;  2ECN A;  2AYN A;  3D6S A;  5B8D A;  2LRI C;  2ECG A;  5AIU A;  4WUR A;  2KR4 A;  1WIM A;  2JM3 A;  3U5N A;  1PXV A;  1AU2 A;  2DZY A;  3M99 A;  3BB7 A;  3O65 A;  4QQ4 A;  5LCW B;  3N4C A;  3PW3 A;  2O6X A;  2YQL A;  4DMX A;  1FP0 A;  2AUX A;  4ZUX U;  4CDD B;  3FEH A;  2OZ2 A;  3EB5 A;  3DDT A;  2ARY A;  2B1M A;  3KW9 A;  2PNS A;  3PBH A;  3SOW A;  2KWJ A;  2C2L A;  4YYV A;  1Z6U A;  3HCT A;  2MT5 A;  3PHW A;  4N8W A;  2VJF A;  4L58 A;  1MM2 A;  2P86 A;  2HDP A;  3HWN A;  2BDZ A;  2YT5 A;  3H6S A;  3GCB A;  3DWD A;  1AEC A;  2ATO A;  3PRM A;  3LJU X;  5TRB A;  3KV6 A;  2KGI A;  3S3R A;  1IYM A;  3IEJ A;  4WA6 A;  1MM3 A;  3OQC A;  4ZTB A;  2XU1 A;  3VK6 A;  2MNZ A;  4MVT A;  1K2F A;  1WEV A;  2C2V S;  3DQV R;  2WBF X;  3PUQ A;  5B77 A;  1G25 A;  3RPG B;  3IOQ A;  2PNX A;  1Y08 A;  2KWK A;  4P5O B;  4XR7 A;  1KHP A;  2I50 A;  3FAO A;  4PPE A;  1MS6 A;  1VD4 A;  2AGA A;  3LQI A;  2VPE A;  2NQA A;  2FUI A;  3K24 A;  3PSE A;  1U9Q X;  2LXP C;  3HHA A;  3PDF A;  4LLB A;  2DJF B;  2Y1M A;  4WZ2 A;  4IC3 A;  4F52 B;  4I05 A;  4MZO A;  3TNX A;  2NAA A;  1E4U A;  2DC7 A;  1GEC E;  1PPD A;  3F75 A;  3N9L A;  2NQI A;  3KX1 A;  4AP4 A;  1QMY A;  2IQJ A;  2QJ0 A;  2CIO A;  4Q8H A;  1PE6 A;  5H1U A;  4MI7 A;  3N9P A;  4N4Z A;  4RKX A;  3ERV A;  3H7D A;  5I3L A;  2MKE A;  2HH5 A;  4CDF B;  2FE8 A;  2CRW A;  2KRE A;  2KU3 A;  3PLW A;  2DJA A;  3V43 A;  3V6E A;  3QSD A; 
#chains in the Genus database with same CATH homology
 2YJ8 A;  4X3G A;  2E01 A;  1POP A;  4B7Y C;  4YBM A;  1M6D A;  2B1N A;  2F6N A;  2DC9 A;  3D9W A;  3M62 A;  1WEU A;  2AVW A;  2VPG A;  2YHO A;  3LQJ A;  4GNF A;  1SNK A;  3KFQ A;  4NV8 A;  4QRX A;  3O1G A;  2ACT A;  2LDR A;  2UZG A;  2YQM A;  2CB5 A;  3P5U A;  3O37 A;  2DCB A;  4I7B A;  4CA1 A;  2F6J A;  4YAX A;  5G04 B;  3HD3 A;  1JQP A;  2HD5 A;  3F5V A;  4FO9 A;  3CH2 X;  5LKU A;  1KHQ A;  2L75 A;  1Q6K A;  2FRQ A;  2EOD A;  5D1L B;  3WXE A;  1PPP A;  1MHW A;  5D1K B;  4GNG A;  1NLJ A;  2QIZ A;  2RI7 A;  2XEU A;  3RPG C;  2DJG B;  5CVO B;  2LGV A;  2MD7 B;  4YBT A;  2F42 A;  3HHI A;  3HCU A;  2PUY A;  1CVZ A;  4YV8 A;  1PIP A;  3ZVY A;  3QZV A;  3KNV A;  2LXH C;  4GNE A;  3HTK C;  1BY8 A;  3MOR A;  1K3B B;  3RVV A;  3KV5 A;  4WZ3 B;  4BSQ A;  1WEQ A;  5A24 A;  3IHP A;  2M3H A;  1MEM A;  1NL6 A;  3CBJ A;  2GHU A;  1TL9 A;  2NQD B;  4YAB A;  2NQG A;  1O0E A;  3MHH A;  4L7X A;  4W4U A;  1YAL A;  4FIP A;  1WEP A;  1YVB A;  3LXS A;  3USV A;  5JA7 A;  5EF4 A;  3ZVZ B;  4AXM A;  1LDJ B;  2E00 A;  2KYU A;  1YK7 A;  3N9Q A;  5AIT A;  2KWO A;  3MTN A;  3C9E A;  1AU0 A;  4N79 A;  2G45 A;  2CT2 A;  8PCH A;  1PPN A;  4K7C A;  2R6N A;  2IBI A;  2M6M A;  1ZCM A;  1KFU L;  1F62 A;  1QOL A;  5TBN A;  1E2T A;  2DCD A;  4CDE B;  2E02 A;  2RSD A;  2K16 A;  2MUM A;  2BSZ A;  2FRA A;  1CJL A;  2KWN A;  2DX8 A;  2FQ9 A;  5CHT A;  3IV2 A;  3GL6 A;  1ATK A;  5LKT A;  2LN0 A;  1QXP A;  5PAD A;  2HHN A;  2C0Y A;  4YYU A;  3H89 A;  2G8E A;  4I7D A;  2MNY A;  4Q6F A;  3T7L A;  1WE9 A;  4DMY A;  1A6R A;  2G43 A;  4XUI A;  1KXR A;  2YJ9 A;  3U5O A;  2PAD A;  3CBK A;  4I04 A;  5TDR A;  3C6W A;  5LKZ A;  1XWH A;  2QIC A;  2YSM A;  3KKU A;  5B79 A;  4BS5 A;  2R9M A;  2DC8 A;  3KWB X;  2E6S A;  3I3T A;  1CS8 A;  2FTD A;  3O36 A;  4A4B A;  1GCB A;  3OIS A;  3U5P A;  2P7U A;  2H7J A;  3H8C A;  1AYV A;  3MHS A;  4N4F A;  3BOW A;  4S3O B;  4V3K C;  1U9W A;  5G05 B;  4G54 A;  4PP1 A;  1PAD A;  3T6R A;  3N3G A;  2YJB A;  4HWY A;  1DVP A;  2FYE A;  2YJ2 A;  4IC2 A;  5B75 A;  2YHN A;  3K8U A;  5C13 A;  4MZS A;  3N9O A;  1RMD A;  1CTE A;  3BWK A;  1ITO A;  5EGW A;  3O70 A;  4NN2 A;  2K1J A;  3QJ3 A;  2IDA A;  2P0R A;  1TU6 A;  3KSE A;  4YAT A;  2FO5 A;  1CSB B;  3OVZ A;  4CDC B;  4LK9 A;  1NB3 A;  2L80 A;  2VHF A;  1W6F A;  5JG6 A;  2AU1 A;  2XB1 A;  2EA6 A;  1CPJ A;  3SOU A;  4C9Z A;  1DEU A;  4KLB A;  5DIN A;  2OP3 A;  2XU5 A;  4V3L C;  1N87 A;  4N3W A;  2EGP A;  1ME4 A;  4GND A;  2AYO A;  4ZDT A;  2JMJ A;  2K4D A;  2L43 A;  1AIM A;  1F2A A;  1MEG A;  2Y5B A;  4AVX A;  4I7C A;  2ECJ A;  2KFT A;  3LQH A;  3K9M A;  2G6D A;  3C5K A;  4W5B A;  1FBV A;  1VYX A;  1MIR A;  1X9Y A;  2FUD A;  2JQF R;  4PTB A;  4A4C A;  2L0B A;  2IPP B;  1WEO A;  2CKL B;  2MA6 A;  1CQD A;  4QBB A;  1X4I A;  2LV9 A;  2OXQ C;  2VPB A;  2R9F A;  2MA5 A;  4C5P A;  4LKA A;  4BHW A;  2LQ6 A;  3RVW A;  3SHB A;  4OEM A;  1WFK A;  3ZNI A;  2H0D B;  3QT4 A;  1ZIV A;  3OF8 A;  2KIZ A;  3ZYQ A;  4ZQL A;  3RTR B;  3NHE A;  1WES A;  1BOR A;  2YSJ A;  5G0F A;  1WEW A;  1Z60 A;  1XKG A;  1QDQ A;  2XU4 A;  1EWO A;  2JQG R;  3IMA A;  3P5W A;  1X4J A;  1DF0 A;  5CHV A;  4S3O C;  1GLO A;  3FL2 A;  1JOC A;  5J94 A;  1U5I A;  5H1V A;  4AUQ B;  5FER A;  4MSX A;  1HUC B;  3DF0 A;  4A0C D;  1EF7 A;  4BPV A;  5C11 A;  1S4V A;  4CCG X;  2FUU A;  1WEE A;  3V6C A;  1F29 A;  5EYA F;  3WXG A;  1V87 A;  1EWP A;  2F7D A;  2YW8 A;  1EWL A;  3P5X A;  4YYR A;  2M85 A;  1T1H A;  5B76 A;  4GUZ A;  4YYQ A;  2YYR A;  1CHC A;  2R9C A;  3O7A A;  1U6G B;  2YJC A;  2VJF B;  3H8B A;  5CVN B;  2LGG A;  2JMD A;  5DKA A;  1BGO A;  3BC3 A;  4QRG A;  4P6E A;  4GB0 A;  1FH0 A;  3KWZ A;  3LFY A;  2L5U A;  4PP2 E;  2CSZ A;  4B86 C;  3B79 A;  4YYS A;  3N9N A;  1AYU A;  4P6G A;  1KFX L;  1PPO A;  2ECW A;  1AU4 A;  4WZ0 A;  2VFC A;  4X6H A;  3LTW A;  5KH3 A;  1ICF A;  2G6Q A;  4LAD B;  4R7E A;  2VJE A;  3ASL A;  3N9M A;  1AYW A;  4UP0 A;  2GFO A;  4W5C A;  4UI9 B;  4YC9 A;  9PAP A;  5F02 A;  3GV4 A;  1AU3 A;  2JRJ A;  4XI1 A;  4QF3 A;  2VJE B;  1STF E;  2AS8 A;  4UP5 A;  3O35 A;  2YU4 A;  3ZPV 1;  1F2B A;  1VFY A;  1W4T A;  2DC6 A;  2F1G A;  3P5V A;  2KE1 A;  5FPW A;  2CKL A;  3PUR A;  4QH6 A;  3I2D A;  3M63 A;  4FK5 A;  2AUZ A;  2AN6 A;  1WIL A;  1WEN A;  2YUC A;  3NG2 A;  3CH3 X;  3L1X A;  4I07 A;  1JM7 B;  1BP4 A;  1IWD A;  3I06 A;  2MIQ A;  1NPZ A;  5D1M B;  1HYI A;  1F2C A;  1U9V A;  2VHS A;  3S3Q A;  4AYC B;  4CZW A;  4YAD A;  2E6R A;  1THE A;  4BQV A;  3RVX A;  3O0U A;  4LJN A;  4BGF A;  4O64 A;  4X6J A;  3WXF A;  1LDK C;  4TKP B;  1HYJ A;  3O33 A;  5H1T A;  4BBQ A;  1SP4 B;  4PAD A;  1W5R A;  2Y1N A;  2OUL A;  4AXL A;  4A49 A;  1NQC A;  4PI3 A;  6PAD A;  2FT2 A;  2YUR A;  2HYE D;  2R9O A;  3OF9 A;  4OEL A;  1VJV A;  4Q8G A;  5LKX A;  3E1Z B;  1PBH A;  2AIM A;  2ZET C;  2DCA A;  2VPD A;  1PCI A;  2DZZ A;  4BS6 A;  3LRQ A;  4X6I A;  5KH7 A;  2JMI A;  2VFB A;  4AYC A;  5FEY A;  4FJC A;  2VNF A;  1GMY A;  3BPF A;  5TAB A;  1Z2Q A;  2G8J A;  1NB5 A;  2CSY A;  3IUT A;  2BDL A;  3BPM A;  2Y6E A;  1WEM A;  1BQI A;  3U5M A;  2H0D A;  2M1R A;  3KQI A;  5TDW A;  3U8E A;  4YVA A;  5J3X A;  1CB5 A;  2XU3 A;  1CV8 A;  1ZBD B;  3ZUA A;  2BAY A;  5B78 A;  2KGG A;  1TLO A;  3ZPV E;  3AI8 A;  4YBS A;  2Y43 A;  3PNR A;  2PRE A;  2LGK A;  2FSA A;  2PBH A;  5FB1 A;  2HXZ A;  2DCC A;  4RY2 A;  1WGM A;  1YT7 A;  3L1Z B;  3SOX A;  3O34 A;  2LGL A;  1X4U A;  4QF2 A;  5KH9 A;  2D8S A;  4R2Y A;  5CVM A;  3N3K A;  5FB0 A;  4QRV A;  4R8P K;  1EWM A;  2K17 A;  2ECT A;  1MDW A;  4YYW A;  3PHD A;  1ME3 A;  2R9N A;  2E03 A;  3HCS A;  5K16 A;  5H9M A;  1U9X A;  2ECV A;  3OVX A;  1VSN A;  2G7Y A;  2MD8 C;  3L11 A;  3EB6 A;  3BCN A;  2VP7 A;  2YRE A;  5JH3 A;  1JM7 A;  1YK8 A;  3DPL R;  1Y4H A;  7PCK A;  2ECI A;  3ZTG A;  2ECN A;  2AYN A;  3D6S A;  5B8D A;  2LRI C;  2ECG A;  5AIU A;  2KR4 A;  1WIM A;  2DZY A;  3U5N A;  1PXV A;  1AU2 A;  3M99 A;  5LCW B;  3N4C A;  3PW3 A;  2O6X A;  2YQL A;  4DMX A;  1FP0 A;  2AUX A;  4ZUX U;  4NV7 A;  4CDD B;  2OZ2 A;  3EB5 A;  2ARY A;  2B1M A;  3KW9 A;  2PNS A;  3PBH A;  3SOW A;  2KWJ A;  2C2L A;  4YYV A;  1Z6U A;  3HCT A;  2MT5 A;  4N8W A;  2VJF A;  4L58 A;  1MM2 A;  2P86 A;  2HDP A;  3HWN A;  2BDZ A;  2YT5 A;  3H6S A;  3GCB A;  1AEC A;  2ATO A;  5TRB A;  3KV6 A;  2KGI A;  3S3R A;  1IYM A;  3IEJ A;  4WA6 A;  1MM3 A;  2XU1 A;  3VK6 A;  2MNZ A;  4MVT A;  1K2F A;  1WEV A;  2C2V S;  3DQV R;  2WBF X;  3PUQ A;  5B77 A;  1G25 A;  3RPG B;  3IOQ A;  2PNX A;  1Y08 A;  2KWK A;  4P5O B;  4XR7 A;  1KHP A;  2I50 A;  4PPE A;  1MS6 A;  1VD4 A;  3LQI A;  2VPE A;  2NQA A;  2FUI A;  3K24 A;  1U9Q X;  2LXP C;  3HHA A;  1GX3 A;  3PDF A;  4LLB A;  2DJF B;  2Y1M A;  4WZ2 A;  4IC3 A;  4F52 B;  4I05 A;  4MZO A;  3TNX A;  2NAA A;  1E4U A;  2DC7 A;  1GEC E;  1PPD A;  3F75 A;  3N9L A;  2NQI A;  3KX1 A;  4AP4 A;  1QMY A;  2QJ0 A;  2CIO A;  4Q8H A;  1PE6 A;  5H1U A;  4N4Z A;  3N9P A;  3ERV A;  3H7D A;  5I3L A;  2HH5 A;  4CDF B;  2KRE A;  2KU3 A;  4B55 A;  3V43 A;  3V6E A;  3QSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...