4BOSA

Structure of otud2 otu domain in complex with ubiquitin k11-linked peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
GPVLTRTVVPADNSALFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN THIOESTERASE OTU1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bosA00
3PHUA 3PT2A 3PSEA 4BOPA 3TMPA 4BOQA 3PRPA 4BOZA 5JZEA 4BOSA 3PRMA 4BOUA 4HXDB 3BY4A 3PHWA 3C0RA 3PHXA 3ZNHA
chains in the Genus database with same CATH superfamily
3MP2A 3KWBX 4M0WA 2DCBA 2AGAA 2BTWB 3KX1A 1TLOA 1MEGA 3MHSA 3C9EA 4QBBA 4AXLA 2IPPB 3TNXA 1AU2A 4QH6A 2P86A 1FH0A 5CHTA 4BS6A 1CV8A 4D8EA 4YYWA 3NHEA 2OZ2A 3C0RA 2FYEA 1U9QX 3CBJA 3WXGA 1MS6A 2UZJA 1STFE 1ZIVA 1F29A 2JQGR 1PE6A 2YJ2A 2DZYA 1BGOA 3V6EA 1AYUA 1PPOA 4QRVA 2DZZA 2ATOA 1AU3A 1K3BB 2HWKA 3IFUA 1IWDA 3DF0A 3H6SA 1EWMA 4R3DA 4MM3B 4BOPA 2ARYA 2VHSA 1AU4A 2Y6EA 4BOUA 4PT5A 1GECE 1BY8A 3S3QA 5F02A 1PXVA 4IP3A 5CVOB 3KFQA 2AYOA 5JZEA 1AU0A 2R6NA 3O65A 2C0YA 3OVXA 1PCIA 2E03A 4X6HA 4DMYA 1GMYA 4FK5A 5CVMA 1CSBB 2AVWA 2BDLA 3LFYA 1MIRA 1KHPA 2PADA 1PVJA 3RVWA 2F7DA 1DF0A 1MHWA 4WURA 3ZNHA 4D8BA 4YYSA 4W5CA 3ERVA 3HD3A 3B21A 4CDEB 1HUCB 1VJVA 2H7JA 3USVA 4CDFB 6PADA 3U8EA 4QRGA 3H8BA 1S4VA 3W31A 1YALA 1NQCA 4PP2E 4QRXA 3MTVA 2CB5A 3P5VA 3CH3X 3OQCA 2CIOA 4K7CA 4RNAA 1U5IA 4XUIA 1NB3A 2NQAA 4YYRA 4Q8HA 3KWZA 2AUXA 2R9NA 2DCAA 4PP1A 3PDFA 1QXPA 1QOLA 1KXRA 2E00A 3OVZA 1YVBA 3AI8A 2DCDA 3N4CA 1ME3A 3BCNA 9PAPA 4D8IA 4W4UA 2YJ9A 3I06A 1QDQA 2DOSA 3WXFA 3OISA 4YV8A 1JQPA 8PCHA 2AU1A 4MSXA 3BBAA 4XZXA 1GCBA 3E9SA 3IOQA 3MORA 3IUTA 1UKFA 3OF9A 2R9MA 4RF1A 1CB5A 4N79A 1NL6A 3S3RA 2NQDB 1KFUL 4BPVA 2DC9A 2JQFR 3IEJA 4BOQA 4FJCA 3BY4A 1DKIA 3N3KA 3ZUAA 1O0EA 2G8JA 4GUAA 2NQGA 7PCKA 4YVAA 3PNRA 2HH5A 1THEA 2R9FA 5E6JA 3PRMA 3GCBA 4OELA 2FT2A 2HXZA 4CZWA 1NB5A 4ZUXU 3K9MA 2B1MA 4MZSA 4DMXA 4RKXA 2O6XA 4G54A 1X9YA 4X6JA 4PADA 4RF0A 1PADA 2XU1A 4OW0A 5CVNB 4W5BA 1POPA 1ATKA 4BSQA 3IV2A 4YYQA 1EWOA 5PADA 2IBIA 3V6CA 3BB7A 3CH2X 2Z84A 2FO5A 2WBFX 1ICFA 3PRPA 4N8WA 5K16A 1VSNA 5EF4A 2R9OA 3OF8A 1PPDA 2JRIA 4I05A 2F1GA 1CQDA 3LXSA 1F2CA 2YJBA 4OVZA 4PI3A 3PHUA 3H89A 3KW9A 1TU6A 1CPJA 4A5UA 4CDCB 3W30A 1Y4HA 2DJGB 2J7QA 5KO3A 3N3GA 5FPWA 3P5UA 3K8UA 2DJFB 5JH3A 2AYNA 2B1NA 5J94A 2FE8A 2G6DA 3WXEA 3PHXA 1EF7A 2NQIA 2Y5BA 1F2AA 4BQVA 1DEUA 3H7DA 4MZOA 2DC7A 2FUDA 1SP4B 1TL9A 2OULA 3KKUA 2PNSA 4AXMA 3RVXA 1ME4A 1ITOA 3M99A 3E1ZB 1U9WA 5JA7A 2P7UA 2AUZA 1U9XA 3PBHA 3RNVA 1YK7A 4OEMA 4YYVA 1A6RA 2R9CA 3K24A 1CS8A 3IMAA 2J7QC 2OP3A 1YZBA 2BDZA 3F5VA 4P6EA 1Y08A 1F2BA 1NPZA 1BP4A 4REZA 4P16A 2FTDA 2G7YA 5EZSA 4BOSA 4HXDB 3RVVA 3PSEA 3BOWA 1YT7A 1BQIA 3O0UA 1QMYA 2VHFA 5A24A 4OVZB 4X6IA 2E01A 3TMPA 3I3TA 2YJ8A 3HWNA 1SNKA 1XKGA 2GHUA 1CJLA 1KHQA 2GFOA 3BPMA 2DCCA 3HHIA 1CVZA 1CTEA 2ACTA 2PBHA 4FIPA 2BTWA 3IHPA 2FRAA 3F75A 1PIPA 5EZQA 1Q6KA 2DC6A 4HWYA 2FQ9A 5EGWA 1AIMA 4CDDB 3MTNA 2FRQA 1EWPA 4ZTBA 2P0RA 3TRKA 1ZCMA 2BU3A 1EWLA 1U9VA 2G8EA 4I07A 1PBHA 3QT4A 3QSDA 5CHVA 4RY2A 4P6GA 4Q8GA 1MDWA 2HD5A 2XU3A 4BOZA 1YK8A 3PHWA 3H8CA 1NLJA 2YJCA 3B79A 3PW3A 3QJ3A 4I04A 1KFXL 4N4ZA 4WA6A 3CBKA 3P5WA 3BWKA 4KLBA 3O1GA 4XR7A 4IUMA 4BS5A 3P5XA 3PT2A 1GLOA 1PPPA 1AYVA 4MI7A 2XU5A 3BPFA 2AIMA 1AYWA 2AS8A 3D6SA 3KSEA 4YYUA 2E02A 3MJ5A 1MEMA 2PREA 3MHHA 2DC8A 3BC3A 2HHNA 2XU4A 1AECA 1PPNA 2JTCA 1M6DA 3HHAA
chains in the Genus database with same CATH topology
3MP2A 3MTVA 3PSEA 4M0WA 2AGAA 2BTWB 4OW0A 3OQCA 4RNAA 4OVZB 3BB7A 2Z84A 3TMPA 3PRPA 4D8EA 3C0RA 2BTWA 2JRIA 2UZJA 4OVZA 3PHUA 5EZQA 4D8IA 4A5UA 3W30A 2DOSA 4ZTBA 3TRKA 2BU3A 2J7QA 2HWKA 3BBAA 4XZXA 5KO3A 3IFUA 3E9SA 1UKFA 4RF1A 4R3DA 4MM3B 4BOPA 4BOZA 2FE8A 4BOUA 4PT5A 3PHWA 3PHXA 4BOQA 3BY4A 4IP3A 1DKIA 5JZEA 3O65A 4GUAA 4IUMA 3PT2A 5E6JA 4MI7A 3PRMA 3RNVA 1PVJA 4WURA 4D8BA 3MJ5A 3ZNHA 2J7QC 1YZBA 3B21A 4RKXA 4REZA 4P16A 4RF0A 5EZSA 4BOSA 2JTCA 4HXDB 3W31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHU A;  3PT2 A;  3PSE A;  4BOP A;  3TMP A;  4BOQ A;  3PRP A;  4BOZ A;  5JZE A;  4BOS A;  3PRM A;  4BOU A;  4HXD B;  3BY4 A;  3PHW A;  3C0R A;  3PHX A;  3ZNH A; 
#chains in the Genus database with same CATH topology
 3MP2 A;  3KWB X;  4M0W A;  2DCB A;  2AGA A;  2BTW B;  3KX1 A;  1TLO A;  1MEG A;  3MHS A;  3C9E A;  4QBB A;  4AXL A;  2IPP B;  3TNX A;  1AU2 A;  4QH6 A;  2P86 A;  1FH0 A;  5CHT A;  4BS6 A;  1CV8 A;  4D8E A;  4YYW A;  3NHE A;  2OZ2 A;  3C0R A;  2FYE A;  1U9Q X;  3CBJ A;  3WXG A;  1MS6 A;  2UZJ A;  1STF E;  1ZIV A;  1F29 A;  2JQG R;  1PE6 A;  2YJ2 A;  2DZY A;  1BGO A;  3V6E A;  1AYU A;  1PPO A;  4QRV A;  2DZZ A;  2ATO A;  1AU3 A;  1K3B B;  2HWK A;  3IFU A;  1IWD A;  3DF0 A;  3H6S A;  1EWM A;  4R3D A;  4MM3 B;  4BOP A;  2ARY A;  2VHS A;  1AU4 A;  2Y6E A;  4BOU A;  4PT5 A;  1GEC E;  1BY8 A;  3S3Q A;  5F02 A;  1PXV A;  4IP3 A;  5CVO B;  3KFQ A;  2AYO A;  5JZE A;  1AU0 A;  2R6N A;  3O65 A;  2C0Y A;  3OVX A;  1PCI A;  2E03 A;  4X6H A;  4DMY A;  1GMY A;  4FK5 A;  5CVM A;  1CSB B;  2AVW A;  2BDL A;  3LFY A;  1MIR A;  1KHP A;  2PAD A;  1PVJ A;  3RVW A;  2F7D A;  1DF0 A;  1MHW A;  4WUR A;  3ZNH A;  4D8B A;  4YYS A;  4W5C A;  3ERV A;  3HD3 A;  3B21 A;  4CDE B;  1HUC B;  1VJV A;  2H7J A;  3USV A;  4CDF B;  6PAD A;  3U8E A;  4QRG A;  3H8B A;  1S4V A;  3W31 A;  1YAL A;  1NQC A;  4PP2 E;  4QRX A;  3MTV A;  2CB5 A;  3P5V A;  3CH3 X;  3OQC A;  2CIO A;  4K7C A;  4RNA A;  1U5I A;  4XUI A;  1NB3 A;  2NQA A;  4YYR A;  4Q8H A;  3KWZ A;  2AUX A;  2R9N A;  2DCA A;  4PP1 A;  3PDF A;  1QXP A;  1QOL A;  1KXR A;  2E00 A;  3OVZ A;  1YVB A;  3AI8 A;  2DCD A;  3N4C A;  1ME3 A;  3BCN A;  9PAP A;  4D8I A;  4W4U A;  2YJ9 A;  3I06 A;  1QDQ A;  2DOS A;  3WXF A;  3OIS A;  4YV8 A;  1JQP A;  8PCH A;  2AU1 A;  4MSX A;  3BBA A;  4XZX A;  1GCB A;  3E9S A;  3IOQ A;  3MOR A;  3IUT A;  1UKF A;  3OF9 A;  2R9M A;  4RF1 A;  1CB5 A;  4N79 A;  1NL6 A;  3S3R A;  2NQD B;  1KFU L;  4BPV A;  2DC9 A;  2JQF R;  3IEJ A;  4BOQ A;  4FJC A;  3BY4 A;  1DKI A;  3N3K A;  3ZUA A;  1O0E A;  2G8J A;  4GUA A;  2NQG A;  7PCK A;  4YVA A;  3PNR A;  2HH5 A;  1THE A;  2R9F A;  5E6J A;  3PRM A;  3GCB A;  4OEL A;  2FT2 A;  2HXZ A;  4CZW A;  1NB5 A;  4ZUX U;  3K9M A;  2B1M A;  4MZS A;  4DMX A;  4RKX A;  2O6X A;  4G54 A;  1X9Y A;  4X6J A;  4PAD A;  4RF0 A;  1PAD A;  2XU1 A;  4OW0 A;  5CVN B;  4W5B A;  1POP A;  1ATK A;  4BSQ A;  3IV2 A;  4YYQ A;  1EWO A;  5PAD A;  2IBI A;  3V6C A;  3BB7 A;  3CH2 X;  2Z84 A;  2FO5 A;  2WBF X;  1ICF A;  3PRP A;  4N8W A;  5K16 A;  1VSN A;  5EF4 A;  2R9O A;  3OF8 A;  1PPD A;  2JRI A;  4I05 A;  2F1G A;  1CQD A;  3LXS A;  1F2C A;  2YJB A;  4OVZ A;  4PI3 A;  3PHU A;  3H89 A;  3KW9 A;  1TU6 A;  1CPJ A;  4A5U A;  4CDC B;  3W30 A;  1Y4H A;  2DJG B;  2J7Q A;  5KO3 A;  3N3G A;  5FPW A;  3P5U A;  3K8U A;  2DJF B;  5JH3 A;  2AYN A;  2B1N A;  5J94 A;  2FE8 A;  2G6D A;  3WXE A;  3PHX A;  1EF7 A;  2NQI A;  2Y5B A;  1F2A A;  4BQV A;  1DEU A;  3H7D A;  4MZO A;  2DC7 A;  2FUD A;  1SP4 B;  1TL9 A;  2OUL A;  3KKU A;  2PNS A;  4AXM A;  3RVX A;  1ME4 A;  1ITO A;  3M99 A;  3E1Z B;  1U9W A;  5JA7 A;  2P7U A;  2AUZ A;  1U9X A;  3PBH A;  3RNV A;  1YK7 A;  4OEM A;  4YYV A;  1A6R A;  2R9C A;  3K24 A;  1CS8 A;  3IMA A;  2J7Q C;  2OP3 A;  1YZB A;  2BDZ A;  3F5V A;  4P6E A;  1Y08 A;  1F2B A;  1NPZ A;  1BP4 A;  4REZ A;  4P16 A;  2FTD A;  2G7Y A;  5EZS A;  4BOS A;  4HXD B;  3RVV A;  3PSE A;  3BOW A;  1YT7 A;  1BQI A;  3O0U A;  1QMY A;  2VHF A;  5A24 A;  4OVZ B;  4X6I A;  2E01 A;  3TMP A;  3I3T A;  2YJ8 A;  3HWN A;  1SNK A;  1XKG A;  2GHU A;  1CJL A;  1KHQ A;  2GFO A;  3BPM A;  2DCC A;  3HHI A;  1CVZ A;  1CTE A;  2ACT A;  2PBH A;  4FIP A;  2BTW A;  3IHP A;  2FRA A;  3F75 A;  1PIP A;  5EZQ A;  1Q6K A;  2DC6 A;  4HWY A;  2FQ9 A;  5EGW A;  1AIM A;  4CDD B;  3MTN A;  2FRQ A;  1EWP A;  4ZTB A;  2P0R A;  3TRK A;  1ZCM A;  2BU3 A;  1EWL A;  1U9V A;  2G8E A;  4I07 A;  1PBH A;  3QT4 A;  3QSD A;  5CHV A;  4RY2 A;  4P6G A;  4Q8G A;  1MDW A;  2HD5 A;  2XU3 A;  4BOZ A;  1YK8 A;  3PHW A;  3H8C A;  1NLJ A;  2YJC A;  3B79 A;  3PW3 A;  3QJ3 A;  4I04 A;  1KFX L;  4N4Z A;  4WA6 A;  3CBK A;  3P5W A;  3BWK A;  4KLB A;  3O1G A;  4XR7 A;  4IUM A;  4BS5 A;  3P5X A;  3PT2 A;  1GLO A;  1PPP A;  1AYV A;  4MI7 A;  2XU5 A;  3BPF A;  2AIM A;  1AYW A;  2AS8 A;  3D6S A;  3KSE A;  4YYU A;  2E02 A;  3MJ5 A;  1MEM A;  2PRE A;  3MHH A;  2DC8 A;  3BC3 A;  2HHN A;  2XU4 A;  1AEC A;  1PPN A;  2JTC A;  1M6D A;  3HHA A; 
#chains in the Genus database with same CATH homology
 3MP2 A;  3MTV A;  3PSE A;  4M0W A;  2AGA A;  2BTW B;  4OW0 A;  3OQC A;  4RNA A;  4OVZ B;  3BB7 A;  2Z84 A;  3TMP A;  3PRP A;  4D8E A;  3C0R A;  2BTW A;  2JRI A;  2UZJ A;  4OVZ A;  3PHU A;  5EZQ A;  4D8I A;  4A5U A;  3W30 A;  2DOS A;  4ZTB A;  3TRK A;  2BU3 A;  2J7Q A;  2HWK A;  3BBA A;  4XZX A;  5KO3 A;  3IFU A;  3E9S A;  1UKF A;  4RF1 A;  4R3D A;  4MM3 B;  4BOP A;  4BOZ A;  2FE8 A;  4BOU A;  4PT5 A;  3PHW A;  3PHX A;  4BOQ A;  3BY4 A;  4IP3 A;  1DKI A;  5JZE A;  3O65 A;  4GUA A;  4IUM A;  3PT2 A;  5E6J A;  4MI7 A;  3PRM A;  3RNV A;  1PVJ A;  4WUR A;  4D8B A;  3MJ5 A;  3ZNH A;  2J7Q C;  1YZB A;  3B21 A;  4RKX A;  4REZ A;  4P16 A;  4RF0 A;  5EZS A;  4BOS A;  2JTC A;  4HXD B;  3W31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...