3OVZA

Cathepsin k in complex with a covalent inhibitor with a ketoamide warhead
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Trifluoromethylphenyl as P2 for ketoamide-based cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ovzA00
1ITOA 1CV8A 1U5IA 1CS8A 4QRGA 3I06A 3P5VA 2FT2A 2G7YA 1GLOA 2FRQA 2AVWA 2DC9A 1ICFA 1YALA 2DZYA 3BPFA 4FJCA 1CTEA 1F2BA 3OF9A 3P5WA 1VSNA 4G54A 3ERVA 3RVVA 3TNXA 1XKGA 2GHUA 3O1GA 2XU3A 4YYUA 1U9XA 1CQDA 1CB5A 1FH0A 2DCBA 1KHQA 2DC6A 1KHPA 3PBHA 2H7JA 3BWKA 3OVZA 1PPNA 4BSQA 1ZIVA 2C0YA 1IWDA 4X6HA 3S3QA 4I04A 4MSXA 8PCHA 2FUDA 3PDFA 3RVXA 3V6EA 1PPPA 3O0UA 3CBKA 4CZWA 2XU1A 3LFYA 2HD5A 2IPPB 2E02A 2AYOA 4OEMA 2FTDA 3D6SA 4QH6A 3BOWA 3CBJA 1NLJA 4XUIA 3F75A 4DMYA 1ME3A 2DJGB 3N3KA 3H8CA 1K3BB 2CB5A 4KLBA 2WBFX 3KW9A 2PADA 2YJ2A 3HWNA 2ACTA 2F1GA 2DC8A 2E03A 1DEUA 1KFUL 3ZUAA 4MZOA 2DCDA 1BGOA 3LXSA 2DJFB 2R6NA 1S4VA 3QJ3A 4RY2A 3CH3X 4P6GA 1HUCB 4QRXA 3KX1A 2P86A 1NB5A 1TLOA 1EF7A 2B1MA 1O0EA 1QOLA 2DCCA 3H6SA 2P7UA 5EGWA 1CSBB 1AU3A 1CVZA 1ME4A 5CHVA 1EWMA 4PI3A 2Y6EA 4PP2E 1U9WA 2VHSA 1MHWA 4YYWA 2PREA 3E1ZB 5PADA 2HH5A 4CDDB 2PBHA 1EWOA 4MZSA 3KFQA 2JQGR 1F2CA 3NHEA 2G6DA 1THEA 2R9MA 4YYSA 1PIPA 2YJCA 5F02A 2R9CA 3IV2A 3B79A 4FK5A 4BQVA 1BY8A 3AI8A 3HHAA 2YJ9A 4OELA 1AU0A 2NQDB 1BP4A 3HD3A 2GFOA 3IEJA 1PADA 2FQ9A 1MS6A 3H7DA 1PBHA 1AU2A 1BQIA 3IMAA 1VJVA 2AUZA 3MHSA 1TU6A 3V6CA 7PCKA 3HHIA 4N79A 3OF8A 1Y08A 4AXMA 2AIMA 1SNKA 5CHTA 1GCBA 4YYRA 2DZZA 2FRAA 2NQGA 2FYEA 9PAPA 5JA7A 5CVOB 2IBIA 1PE6A 3S3RA 1AYUA 1KFXL 2ARYA 3MHHA 1YK8A 1GECE 1AYVA 3QSDA 4YVAA 3H8BA 4K7CA 1YK7A 3USVA 4W5CA 1AECA 1PXVA 1DF0A 5K16A 2NQAA 5JH3A 1AIMA 1GMYA 1PPOA 3WXGA 2R9NA 3DF0A 2BDLA 4DMXA 3KKUA 4N4ZA 4W5BA 4YYVA 4BS6A 4YYQA 4CDFB 4BPVA 1MIRA 4BS5A 3BC3A 3H89A 1JQPA 3WXFA 4N8WA 4Q8GA 1STFE 3QT4A 3KSEA 2DCAA 1QDQA 1ATKA 2E00A 3U8EA 2OULA 2HXZA 4WA6A 4AXLA 2G8JA 3RVWA 4I07A 4QBBA 1U9VA 3WXEA 3K8UA 3OVXA 2AYNA 1MDWA 1YT7A 2OZ2A 5FPWA 3BPMA 2R9OA 3I3TA 3CH2X 3P5UA 4PP1A 1MEGA 1NPZA 2YJ8A 2FO5A 2CIOA 4PADA 1AU4A 1A6RA 1PPDA 1YVBA 2DC7A 3PW3A 4HWYA 5J94A 2XU4A 4CDCB 4P6EA 3MORA 1Y4HA 1NB3A 4W4UA 1EWPA 3C9EA 4CDEB 3KWBX 3N4CA 3MTNA 1M6DA 3M99A 3KWZA 3PNRA 4ZUXU 3K9MA 3BCNA 1MEMA 2E01A 1X9YA 2R9FA 3P5XA 2XU5A 1AYWA 2Y5BA 4Q8HA 2F7DA 2YJBA 1PCIA 1NQCA 5CVMA 3IUTA 3GCBA 1Q6KA 1F2AA 6PADA 2PNSA 1NL6A 3N3GA 2AS8A 2G8EA 2ATOA 1KXRA 1CPJA 2VHFA 3K24A 1ZCMA 2OP3A 1QMYA 2NQIA 4I05A 5EF4A 5A24A 2JQFR 1CJLA 2P0RA 4X6JA 1EWLA 3F5VA 3IOQA 2B1NA 2AUXA 3IHPA 1SP4B 1U9QX 5CVNB 4QRVA 1POPA 4XR7A 4FIPA 1QXPA 1TL9A 2HHNA 2AU1A 4X6IA 1F29A 2BDZA 2O6XA 3OISA 4YV8A
chains in the Genus database with same CATH superfamily
1ITOA 1CV8A 1U5IA 1CS8A 4QRGA 3I06A 4OW0A 3P5VA 3C0RA 2FT2A 1YZBA 2G7YA 3TMPA 5EZQA 1GLOA 2FRQA 2AVWA 2DC9A 4D8IA 1ICFA 1YALA 2DZYA 3BPFA 4FJCA 1CTEA 1F2BA 3OF9A 3P5WA 1VSNA 4G54A 3ERVA 3RVVA 3TNXA 1XKGA 2GHUA 3O1GA 2XU3A 4YYUA 1U9XA 1CQDA 1CB5A 1FH0A 2DCBA 1KHQA 5JZEA 2DC6A 1KHPA 3PBHA 2H7JA 3BWKA 3OVZA 1PPNA 4BSQA 1ZIVA 2C0YA 1IWDA 4P16A 4X6HA 3S3QA 4I04A 4MSXA 2HWKA 8PCHA 2FUDA 3PDFA 3RVXA 3V6EA 2BTWA 1PPPA 3O0UA 2UZJA 3CBKA 4CZWA 2XU1A 3LFYA 4RF1A 2HD5A 4M0WA 2IPPB 5EZSA 2E02A 2AYOA 4OEMA 4OVZB 2J7QA 2FTDA 3D6SA 3ZNHA 2J7QC 4QH6A 3BOWA 3CBJA 1NLJA 4XUIA 3F75A 4DMYA 1ME3A 2DJGB 3N3KA 3H8CA 1K3BB 2CB5A 4KLBA 2WBFX 4PT5A 3KW9A 2PADA 2YJ2A 4MI7A 3HWNA 2ACTA 2F1GA 3PHWA 2JRIA 2DC8A 2E03A 1DEUA 1KFUL 3ZUAA 4MZOA 2FE8A 2DCDA 1BGOA 3LXSA 2DJFB 2R6NA 1S4VA 2AGAA 3QJ3A 3MTVA 1PVJA 4RY2A 3CH3X 4P6GA 1HUCB 4QRXA 1DKIA 3KX1A 2P86A 1NB5A 1TLOA 1EF7A 4MM3B 3RNVA 2B1MA 4RF0A 1O0EA 1QOLA 2DCCA 3H6SA 2P7UA 5EGWA 1CSBB 1AU3A 1CVZA 1ME4A 5CHVA 3MJ5A 1EWMA 4PI3A 2Y6EA 4PP2E 1U9WA 2VHSA 1MHWA 4YYWA 2PREA 3E1ZB 5PADA 2HH5A 4CDDB 2PBHA 3E9SA 3IFUA 1EWOA 4MZSA 3KFQA 2JQGR 1F2CA 3NHEA 2G6DA 1THEA 2R9MA 4YYSA 1PIPA 2YJCA 5F02A 4BOQA 2R9CA 4XZXA 3IV2A 3B79A 4FK5A 4BQVA 1BY8A 3AI8A 3HHAA 2YJ9A 4OELA 1AU0A 2NQDB 4REZA 1BP4A 3HD3A 2GFOA 3IEJA 4ZTBA 1PADA 2FQ9A 1MS6A 3H7DA 3BB7A 1PBHA 4BOUA 3PSEA 1AU2A 1BQIA 3IMAA 3BBAA 1VJVA 2AUZA 3MHSA 1TU6A 3V6CA 7PCKA 3HHIA 4N79A 3OF8A 1Y08A 4AXMA 2AIMA 1SNKA 4OVZA 1GCBA 5CHTA 4YYRA 2DZZA 2FRAA 3MP2A 4HXDB 2NQGA 5KO3A 2FYEA 9PAPA 5E6JA 3PHXA 5JA7A 5CVOB 3O65A 3B21A 4BOSA 4D8EA 2IBIA 1PE6A 3S3RA 1AYUA 1KFXL 2ARYA 4R3DA 3MHHA 1YK8A 3PT2A 1GECE 1AYVA 3QSDA 4BOZA 4YVAA 3H8BA 4K7CA 1YK7A 3USVA 4W5CA 1AECA 1PXVA 3PRPA 1DF0A 5K16A 2NQAA 5JH3A 1AIMA 1GMYA 1PPOA 3WXGA 2R9NA 3DF0A 2BDLA 4DMXA 3KKUA 4N4ZA 4W5BA 4YYVA 4BS6A 4YYQA 4CDFB 4BPVA 1MIRA 4BS5A 3BC3A 3H89A 1JQPA 2Z84A 3WXFA 4D8BA 4N8WA 4Q8GA 4RNAA 1STFE 3QT4A 3KSEA 2DCAA 1QDQA 1ATKA 2E00A 3W30A 3U8EA 2OULA 2HXZA 4WA6A 4AXLA 2G8JA 3RVWA 3W31A 4I07A 4QBBA 1U9VA 3WXEA 3K8UA 3OVXA 2AYNA 1MDWA 1YT7A 3PRMA 2OZ2A 5FPWA 3BPMA 2R9OA 2BU3A 3I3TA 3CH2X 3P5UA 4PP1A 1MEGA 1NPZA 2YJ8A 2FO5A 2CIOA 4PADA 1AU4A 1A6RA 1PPDA 1YVBA 2BTWB 2DC7A 3PW3A 4HWYA 5J94A 2XU4A 4CDCB 4IUMA 4P6EA 3MORA 1Y4HA 1NB3A 4A5UA 4W4UA 1EWPA 3C9EA 4CDEB 3KWBX 3N4CA 3MTNA 1M6DA 3M99A 3KWZA 4IP3A 3PNRA 3TRKA 4ZUXU 3K9MA 3BCNA 1MEMA 2E01A 1X9YA 2R9FA 3P5XA 2XU5A 1AYWA 2Y5BA 4Q8HA 2F7DA 2YJBA 1PCIA 1NQCA 5CVMA 4RKXA 3IUTA 3GCBA 1Q6KA 3PHUA 1F2AA 2JTCA 6PADA 3OQCA 2PNSA 1NL6A 3N3GA 2AS8A 2G8EA 2ATOA 1KXRA 4WURA 1CPJA 2VHFA 3K24A 1ZCMA 2DOSA 2OP3A 1QMYA 2NQIA 4I05A 5EF4A 5A24A 2JQFR 1CJLA 2P0RA 4X6JA 1EWLA 3F5VA 3IOQA 2B1NA 1UKFA 2AUXA 3IHPA 4GUAA 1SP4B 1U9QX 5CVNB 4QRVA 1POPA 4XR7A 4FIPA 1QXPA 1TL9A 2HHNA 2AU1A 3BY4A 4X6IA 1F29A 4BOPA 2BDZA 2O6XA 3OISA 4YV8A
chains in the Genus database with same CATH topology
1ITOA 1CV8A 1U5IA 1CS8A 4QRGA 3I06A 3P5VA 2FT2A 2G7YA 1GLOA 2FRQA 2AVWA 2DC9A 1ICFA 1YALA 2DZYA 3BPFA 4FJCA 1CTEA 1F2BA 3OF9A 3P5WA 1VSNA 4G54A 3ERVA 3RVVA 3TNXA 1XKGA 2GHUA 3O1GA 2VFBA 2XU3A 4YYUA 1U9XA 1CQDA 1CB5A 1FH0A 2DCBA 1KHQA 2DC6A 1KHPA 3PBHA 2H7JA 3BWKA 3OVZA 1PPNA 4BSQA 1ZIVA 4B55A 2C0YA 1IWDA 4X6HA 3S3QA 4I04A 4MSXA 8PCHA 2FUDA 3PDFA 3RVXA 3V6EA 1PPPA 3O0UA 3CBKA 4CZWA 2XU1A 3LFYA 2HD5A 2IPPB 1W4TA 2E02A 2AYOA 4OEMA 2FTDA 3D6SA 4QH6A 3BOWA 3CBJA 1NLJA 4XUIA 3F75A 4DMYA 1ME3A 2DJGB 3N3KA 3H8CA 1K3BB 2CB5A 4KLBA 2WBFX 3KW9A 2PADA 2YJ2A 3HWNA 2ACTA 2F1GA 2DC8A 2E03A 1DEUA 1KFUL 3ZUAA 4MZOA 2DCDA 1BGOA 3LXSA 2DJFB 2R6NA 1S4VA 3QJ3A 4RY2A 3CH3X 4P6GA 1HUCB 4QRXA 3KX1A 2P86A 1NB5A 1TLOA 1EF7A 2B1MA 1O0EA 1QOLA 2DCCA 3H6SA 2P7UA 5EGWA 1CSBB 1AU3A 1CVZA 1ME4A 5CHVA 4C5PA 1EWMA 4PI3A 2Y6EA 4PP2E 1U9WA 2VHSA 1MHWA 4YYWA 2PREA 3E1ZB 5PADA 2HH5A 4CDDB 2PBHA 1EWOA 4MZSA 3KFQA 2JQGR 1F2CA 3NHEA 2G6DA 1THEA 2R9MA 4YYSA 1PIPA 2YJCA 5F02A 2R9CA 3IV2A 3B79A 4FK5A 4BQVA 1BY8A 3AI8A 3HHAA 2YJ9A 4OELA 1AU0A 2NQDB 1BP4A 4NV7A 3HD3A 2GFOA 3IEJA 2VFCA 1PADA 2FQ9A 1MS6A 3H7DA 1PBHA 1AU2A 1BQIA 3IMAA 1VJVA 2AUZA 3MHSA 1TU6A 3V6CA 7PCKA 3HHIA 4N79A 3OF8A 1Y08A 4AXMA 2AIMA 1SNKA 5CHTA 1GCBA 4YYRA 2DZZA 2FRAA 2NQGA 2FYEA 9PAPA 5JA7A 5CVOB 1W6FA 2IBIA 1PE6A 3S3RA 1AYUA 1KFXL 2ARYA 3MHHA 1YK8A 1GECE 1AYVA 3QSDA 4YVAA 3H8BA 4K7CA 1YK7A 3USVA 4W5CA 1AECA 1PXVA 1DF0A 5K16A 2NQAA 5JH3A 1AIMA 1GMYA 1PPOA 3WXGA 2R9NA 3DF0A 2BDLA 4DMXA 3KKUA 4N4ZA 4W5BA 4YYVA 4BGFA 4BS6A 4YYQA 4CDFB 4BPVA 1GX3A 1MIRA 4BS5A 1W5RA 3BC3A 3H89A 1JQPA 3WXFA 4N8WA 4Q8GA 3D9WA 1STFE 3QT4A 3KSEA 2DCAA 1QDQA 4NV8A 1ATKA 2E00A 3U8EA 2OULA 2HXZA 4WA6A 4AXLA 2G8JA 3RVWA 4I07A 4QBBA 1U9VA 3WXEA 3K8UA 3OVXA 2AYNA 1MDWA 1YT7A 2OZ2A 5FPWA 3BPMA 2R9OA 3I3TA 3CH2X 3P5UA 4PP1A 1MEGA 2BSZA 1NPZA 2YJ8A 2FO5A 2CIOA 4PADA 1AU4A 1A6RA 1PPDA 1YVBA 2DC7A 3PW3A 4HWYA 5J94A 2XU4A 4CDCB 4P6EA 3MORA 1Y4HA 1NB3A 3LTWA 4W4UA 1EWPA 3C9EA 4CDEB 3KWBX 3N4CA 3MTNA 1M6DA 3M99A 3KWZA 3PNRA 4ZUXU 3K9MA 3BCNA 1MEMA 2E01A 1X9YA 2R9FA 3P5XA 2XU5A 1AYWA 2Y5BA 4Q8HA 2F7DA 2YJBA 1PCIA 1NQCA 5CVMA 3IUTA 3GCBA 1Q6KA 1F2AA 6PADA 2PNSA 1NL6A 3N3GA 2AS8A 2G8EA 2ATOA 1KXRA 1CPJA 2VHFA 3K24A 1ZCMA 2OP3A 1QMYA 2NQIA 4GUZA 4I05A 5EF4A 5A24A 2JQFR 1CJLA 2P0RA 4X6JA 1EWLA 3F5VA 3IOQA 1E2TA 2B1NA 2AUXA 3IHPA 1SP4B 1U9QX 5CVNB 4QRVA 1POPA 4XR7A 4FIPA 1QXPA 1TL9A 2HHNA 2AU1A 4X6IA 1F29A 2BDZA 2O6XA 3OISA 4YV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITO A;  1CV8 A;  1U5I A;  1CS8 A;  4QRG A;  3I06 A;  3P5V A;  2FT2 A;  2G7Y A;  1GLO A;  2FRQ A;  2AVW A;  2DC9 A;  1ICF A;  1YAL A;  2DZY A;  3BPF A;  4FJC A;  1CTE A;  1F2B A;  3OF9 A;  3P5W A;  1VSN A;  4G54 A;  3ERV A;  3RVV A;  3TNX A;  1XKG A;  2GHU A;  3O1G A;  2XU3 A;  4YYU A;  1U9X A;  1CQD A;  1CB5 A;  1FH0 A;  2DCB A;  1KHQ A;  2DC6 A;  1KHP A;  3PBH A;  2H7J A;  3BWK A;  3OVZ A;  1PPN A;  4BSQ A;  1ZIV A;  2C0Y A;  1IWD A;  4X6H A;  3S3Q A;  4I04 A;  4MSX A;  8PCH A;  2FUD A;  3PDF A;  3RVX A;  3V6E A;  1PPP A;  3O0U A;  3CBK A;  4CZW A;  2XU1 A;  3LFY A;  2HD5 A;  2IPP B;  2E02 A;  2AYO A;  4OEM A;  2FTD A;  3D6S A;  4QH6 A;  3BOW A;  3CBJ A;  1NLJ A;  4XUI A;  3F75 A;  4DMY A;  1ME3 A;  2DJG B;  3N3K A;  3H8C A;  1K3B B;  2CB5 A;  4KLB A;  2WBF X;  3KW9 A;  2PAD A;  2YJ2 A;  3HWN A;  2ACT A;  2F1G A;  2DC8 A;  2E03 A;  1DEU A;  1KFU L;  3ZUA A;  4MZO A;  2DCD A;  1BGO A;  3LXS A;  2DJF B;  2R6N A;  1S4V A;  3QJ3 A;  4RY2 A;  3CH3 X;  4P6G A;  1HUC B;  4QRX A;  3KX1 A;  2P86 A;  1NB5 A;  1TLO A;  1EF7 A;  2B1M A;  1O0E A;  1QOL A;  2DCC A;  3H6S A;  2P7U A;  5EGW A;  1CSB B;  1AU3 A;  1CVZ A;  1ME4 A;  5CHV A;  1EWM A;  4PI3 A;  2Y6E A;  4PP2 E;  1U9W A;  2VHS A;  1MHW A;  4YYW A;  2PRE A;  3E1Z B;  5PAD A;  2HH5 A;  4CDD B;  2PBH A;  1EWO A;  4MZS A;  3KFQ A;  2JQG R;  1F2C A;  3NHE A;  2G6D A;  1THE A;  2R9M A;  4YYS A;  1PIP A;  2YJC A;  5F02 A;  2R9C A;  3IV2 A;  3B79 A;  4FK5 A;  4BQV A;  1BY8 A;  3AI8 A;  3HHA A;  2YJ9 A;  4OEL A;  1AU0 A;  2NQD B;  1BP4 A;  3HD3 A;  2GFO A;  3IEJ A;  1PAD A;  2FQ9 A;  1MS6 A;  3H7D A;  1PBH A;  1AU2 A;  1BQI A;  3IMA A;  1VJV A;  2AUZ A;  3MHS A;  1TU6 A;  3V6C A;  7PCK A;  3HHI A;  4N79 A;  3OF8 A;  1Y08 A;  4AXM A;  2AIM A;  1SNK A;  5CHT A;  1GCB A;  4YYR A;  2DZZ A;  2FRA A;  2NQG A;  2FYE A;  9PAP A;  5JA7 A;  5CVO B;  2IBI A;  1PE6 A;  3S3R A;  1AYU A;  1KFX L;  2ARY A;  3MHH A;  1YK8 A;  1GEC E;  1AYV A;  3QSD A;  4YVA A;  3H8B A;  4K7C A;  1YK7 A;  3USV A;  4W5C A;  1AEC A;  1PXV A;  1DF0 A;  5K16 A;  2NQA A;  5JH3 A;  1AIM A;  1GMY A;  1PPO A;  3WXG A;  2R9N A;  3DF0 A;  2BDL A;  4DMX A;  3KKU A;  4N4Z A;  4W5B A;  4YYV A;  4BS6 A;  4YYQ A;  4CDF B;  4BPV A;  1MIR A;  4BS5 A;  3BC3 A;  3H89 A;  1JQP A;  3WXF A;  4N8W A;  4Q8G A;  1STF E;  3QT4 A;  3KSE A;  2DCA A;  1QDQ A;  1ATK A;  2E00 A;  3U8E A;  2OUL A;  2HXZ A;  4WA6 A;  4AXL A;  2G8J A;  3RVW A;  4I07 A;  4QBB A;  1U9V A;  3WXE A;  3K8U A;  3OVX A;  2AYN A;  1MDW A;  1YT7 A;  2OZ2 A;  5FPW A;  3BPM A;  2R9O A;  3I3T A;  3CH2 X;  3P5U A;  4PP1 A;  1MEG A;  1NPZ A;  2YJ8 A;  2FO5 A;  2CIO A;  4PAD A;  1AU4 A;  1A6R A;  1PPD A;  1YVB A;  2DC7 A;  3PW3 A;  4HWY A;  5J94 A;  2XU4 A;  4CDC B;  4P6E A;  3MOR A;  1Y4H A;  1NB3 A;  4W4U A;  1EWP A;  3C9E A;  4CDE B;  3KWB X;  3N4C A;  3MTN A;  1M6D A;  3M99 A;  3KWZ A;  3PNR A;  4ZUX U;  3K9M A;  3BCN A;  1MEM A;  2E01 A;  1X9Y A;  2R9F A;  3P5X A;  2XU5 A;  1AYW A;  2Y5B A;  4Q8H A;  2F7D A;  2YJB A;  1PCI A;  1NQC A;  5CVM A;  3IUT A;  3GCB A;  1Q6K A;  1F2A A;  6PAD A;  2PNS A;  1NL6 A;  3N3G A;  2AS8 A;  2G8E A;  2ATO A;  1KXR A;  1CPJ A;  2VHF A;  3K24 A;  1ZCM A;  2OP3 A;  1QMY A;  2NQI A;  4I05 A;  5EF4 A;  5A24 A;  2JQF R;  1CJL A;  2P0R A;  4X6J A;  1EWL A;  3F5V A;  3IOQ A;  2B1N A;  2AUX A;  3IHP A;  1SP4 B;  1U9Q X;  5CVN B;  4QRV A;  1POP A;  4XR7 A;  4FIP A;  1QXP A;  1TL9 A;  2HHN A;  2AU1 A;  4X6I A;  1F29 A;  2BDZ A;  2O6X A;  3OIS A;  4YV8 A; 
#chains in the Genus database with same CATH topology
 1ITO A;  1CV8 A;  1U5I A;  1CS8 A;  4QRG A;  3I06 A;  4OW0 A;  3P5V A;  3C0R A;  2FT2 A;  1YZB A;  2G7Y A;  3TMP A;  5EZQ A;  1GLO A;  2FRQ A;  2AVW A;  2DC9 A;  4D8I A;  1ICF A;  1YAL A;  2DZY A;  3BPF A;  4FJC A;  1CTE A;  1F2B A;  3OF9 A;  3P5W A;  1VSN A;  4G54 A;  3ERV A;  3RVV A;  3TNX A;  1XKG A;  2GHU A;  3O1G A;  2XU3 A;  4YYU A;  1U9X A;  1CQD A;  1CB5 A;  1FH0 A;  2DCB A;  1KHQ A;  5JZE A;  2DC6 A;  1KHP A;  3PBH A;  2H7J A;  3BWK A;  3OVZ A;  1PPN A;  4BSQ A;  1ZIV A;  2C0Y A;  1IWD A;  4P16 A;  4X6H A;  3S3Q A;  4I04 A;  4MSX A;  2HWK A;  8PCH A;  2FUD A;  3PDF A;  3RVX A;  3V6E A;  2BTW A;  1PPP A;  3O0U A;  2UZJ A;  3CBK A;  4CZW A;  2XU1 A;  3LFY A;  4RF1 A;  2HD5 A;  4M0W A;  2IPP B;  5EZS A;  2E02 A;  2AYO A;  4OEM A;  4OVZ B;  2J7Q A;  2FTD A;  3D6S A;  3ZNH A;  2J7Q C;  4QH6 A;  3BOW A;  3CBJ A;  1NLJ A;  4XUI A;  3F75 A;  4DMY A;  1ME3 A;  2DJG B;  3N3K A;  3H8C A;  1K3B B;  2CB5 A;  4KLB A;  2WBF X;  4PT5 A;  3KW9 A;  2PAD A;  2YJ2 A;  4MI7 A;  3HWN A;  2ACT A;  2F1G A;  3PHW A;  2JRI A;  2DC8 A;  2E03 A;  1DEU A;  1KFU L;  3ZUA A;  4MZO A;  2FE8 A;  2DCD A;  1BGO A;  3LXS A;  2DJF B;  2R6N A;  1S4V A;  2AGA A;  3QJ3 A;  3MTV A;  1PVJ A;  4RY2 A;  3CH3 X;  4P6G A;  1HUC B;  4QRX A;  1DKI A;  3KX1 A;  2P86 A;  1NB5 A;  1TLO A;  1EF7 A;  4MM3 B;  3RNV A;  2B1M A;  4RF0 A;  1O0E A;  1QOL A;  2DCC A;  3H6S A;  2P7U A;  5EGW A;  1CSB B;  1AU3 A;  1CVZ A;  1ME4 A;  5CHV A;  3MJ5 A;  1EWM A;  4PI3 A;  2Y6E A;  4PP2 E;  1U9W A;  2VHS A;  1MHW A;  4YYW A;  2PRE A;  3E1Z B;  5PAD A;  2HH5 A;  4CDD B;  2PBH A;  3E9S A;  3IFU A;  1EWO A;  4MZS A;  3KFQ A;  2JQG R;  1F2C A;  3NHE A;  2G6D A;  1THE A;  2R9M A;  4YYS A;  1PIP A;  2YJC A;  5F02 A;  4BOQ A;  2R9C A;  4XZX A;  3IV2 A;  3B79 A;  4FK5 A;  4BQV A;  1BY8 A;  3AI8 A;  3HHA A;  2YJ9 A;  4OEL A;  1AU0 A;  2NQD B;  4REZ A;  1BP4 A;  3HD3 A;  2GFO A;  3IEJ A;  4ZTB A;  1PAD A;  2FQ9 A;  1MS6 A;  3H7D A;  3BB7 A;  1PBH A;  4BOU A;  3PSE A;  1AU2 A;  1BQI A;  3IMA A;  3BBA A;  1VJV A;  2AUZ A;  3MHS A;  1TU6 A;  3V6C A;  7PCK A;  3HHI A;  4N79 A;  3OF8 A;  1Y08 A;  4AXM A;  2AIM A;  1SNK A;  4OVZ A;  1GCB A;  5CHT A;  4YYR A;  2DZZ A;  2FRA A;  3MP2 A;  4HXD B;  2NQG A;  5KO3 A;  2FYE A;  9PAP A;  5E6J A;  3PHX A;  5JA7 A;  5CVO B;  3O65 A;  3B21 A;  4BOS A;  4D8E A;  2IBI A;  1PE6 A;  3S3R A;  1AYU A;  1KFX L;  2ARY A;  4R3D A;  3MHH A;  1YK8 A;  3PT2 A;  1GEC E;  1AYV A;  3QSD A;  4BOZ A;  4YVA A;  3H8B A;  4K7C A;  1YK7 A;  3USV A;  4W5C A;  1AEC A;  1PXV A;  3PRP A;  1DF0 A;  5K16 A;  2NQA A;  5JH3 A;  1AIM A;  1GMY A;  1PPO A;  3WXG A;  2R9N A;  3DF0 A;  2BDL A;  4DMX A;  3KKU A;  4N4Z A;  4W5B A;  4YYV A;  4BS6 A;  4YYQ A;  4CDF B;  4BPV A;  1MIR A;  4BS5 A;  3BC3 A;  3H89 A;  1JQP A;  2Z84 A;  3WXF A;  4D8B A;  4N8W A;  4Q8G A;  4RNA A;  1STF E;  3QT4 A;  3KSE A;  2DCA A;  1QDQ A;  1ATK A;  2E00 A;  3W30 A;  3U8E A;  2OUL A;  2HXZ A;  4WA6 A;  4AXL A;  2G8J A;  3RVW A;  3W31 A;  4I07 A;  4QBB A;  1U9V A;  3WXE A;  3K8U A;  3OVX A;  2AYN A;  1MDW A;  1YT7 A;  3PRM A;  2OZ2 A;  5FPW A;  3BPM A;  2R9O A;  2BU3 A;  3I3T A;  3CH2 X;  3P5U A;  4PP1 A;  1MEG A;  1NPZ A;  2YJ8 A;  2FO5 A;  2CIO A;  4PAD A;  1AU4 A;  1A6R A;  1PPD A;  1YVB A;  2BTW B;  2DC7 A;  3PW3 A;  4HWY A;  5J94 A;  2XU4 A;  4CDC B;  4IUM A;  4P6E A;  3MOR A;  1Y4H A;  1NB3 A;  4A5U A;  4W4U A;  1EWP A;  3C9E A;  4CDE B;  3KWB X;  3N4C A;  3MTN A;  1M6D A;  3M99 A;  3KWZ A;  4IP3 A;  3PNR A;  3TRK A;  4ZUX U;  3K9M A;  3BCN A;  1MEM A;  2E01 A;  1X9Y A;  2R9F A;  3P5X A;  2XU5 A;  1AYW A;  2Y5B A;  4Q8H A;  2F7D A;  2YJB A;  1PCI A;  1NQC A;  5CVM A;  4RKX A;  3IUT A;  3GCB A;  1Q6K A;  3PHU A;  1F2A A;  2JTC A;  6PAD A;  3OQC A;  2PNS A;  1NL6 A;  3N3G A;  2AS8 A;  2G8E A;  2ATO A;  1KXR A;  4WUR A;  1CPJ A;  2VHF A;  3K24 A;  1ZCM A;  2DOS A;  2OP3 A;  1QMY A;  2NQI A;  4I05 A;  5EF4 A;  5A24 A;  2JQF R;  1CJL A;  2P0R A;  4X6J A;  1EWL A;  3F5V A;  3IOQ A;  2B1N A;  1UKF A;  2AUX A;  3IHP A;  4GUA A;  1SP4 B;  1U9Q X;  5CVN B;  4QRV A;  1POP A;  4XR7 A;  4FIP A;  1QXP A;  1TL9 A;  2HHN A;  2AU1 A;  3BY4 A;  4X6I A;  1F29 A;  4BOP A;  2BDZ A;  2O6X A;  3OIS A;  4YV8 A; 
#chains in the Genus database with same CATH homology
 1ITO A;  1CV8 A;  1U5I A;  1CS8 A;  4QRG A;  3I06 A;  3P5V A;  2FT2 A;  2G7Y A;  1GLO A;  2FRQ A;  2AVW A;  2DC9 A;  1ICF A;  1YAL A;  2DZY A;  3BPF A;  4FJC A;  1CTE A;  1F2B A;  3OF9 A;  3P5W A;  1VSN A;  4G54 A;  3ERV A;  3RVV A;  3TNX A;  1XKG A;  2GHU A;  3O1G A;  2VFB A;  2XU3 A;  4YYU A;  1U9X A;  1CQD A;  1CB5 A;  1FH0 A;  2DCB A;  1KHQ A;  2DC6 A;  1KHP A;  3PBH A;  2H7J A;  3BWK A;  3OVZ A;  1PPN A;  4BSQ A;  1ZIV A;  4B55 A;  2C0Y A;  1IWD A;  4X6H A;  3S3Q A;  4I04 A;  4MSX A;  8PCH A;  2FUD A;  3PDF A;  3RVX A;  3V6E A;  1PPP A;  3O0U A;  3CBK A;  4CZW A;  2XU1 A;  3LFY A;  2HD5 A;  2IPP B;  1W4T A;  2E02 A;  2AYO A;  4OEM A;  2FTD A;  3D6S A;  4QH6 A;  3BOW A;  3CBJ A;  1NLJ A;  4XUI A;  3F75 A;  4DMY A;  1ME3 A;  2DJG B;  3N3K A;  3H8C A;  1K3B B;  2CB5 A;  4KLB A;  2WBF X;  3KW9 A;  2PAD A;  2YJ2 A;  3HWN A;  2ACT A;  2F1G A;  2DC8 A;  2E03 A;  1DEU A;  1KFU L;  3ZUA A;  4MZO A;  2DCD A;  1BGO A;  3LXS A;  2DJF B;  2R6N A;  1S4V A;  3QJ3 A;  4RY2 A;  3CH3 X;  4P6G A;  1HUC B;  4QRX A;  3KX1 A;  2P86 A;  1NB5 A;  1TLO A;  1EF7 A;  2B1M A;  1O0E A;  1QOL A;  2DCC A;  3H6S A;  2P7U A;  5EGW A;  1CSB B;  1AU3 A;  1CVZ A;  1ME4 A;  5CHV A;  4C5P A;  1EWM A;  4PI3 A;  2Y6E A;  4PP2 E;  1U9W A;  2VHS A;  1MHW A;  4YYW A;  2PRE A;  3E1Z B;  5PAD A;  2HH5 A;  4CDD B;  2PBH A;  1EWO A;  4MZS A;  3KFQ A;  2JQG R;  1F2C A;  3NHE A;  2G6D A;  1THE A;  2R9M A;  4YYS A;  1PIP A;  2YJC A;  5F02 A;  2R9C A;  3IV2 A;  3B79 A;  4FK5 A;  4BQV A;  1BY8 A;  3AI8 A;  3HHA A;  2YJ9 A;  4OEL A;  1AU0 A;  2NQD B;  1BP4 A;  4NV7 A;  3HD3 A;  2GFO A;  3IEJ A;  2VFC A;  1PAD A;  2FQ9 A;  1MS6 A;  3H7D A;  1PBH A;  1AU2 A;  1BQI A;  3IMA A;  1VJV A;  2AUZ A;  3MHS A;  1TU6 A;  3V6C A;  7PCK A;  3HHI A;  4N79 A;  3OF8 A;  1Y08 A;  4AXM A;  2AIM A;  1SNK A;  5CHT A;  1GCB A;  4YYR A;  2DZZ A;  2FRA A;  2NQG A;  2FYE A;  9PAP A;  5JA7 A;  5CVO B;  1W6F A;  2IBI A;  1PE6 A;  3S3R A;  1AYU A;  1KFX L;  2ARY A;  3MHH A;  1YK8 A;  1GEC E;  1AYV A;  3QSD A;  4YVA A;  3H8B A;  4K7C A;  1YK7 A;  3USV A;  4W5C A;  1AEC A;  1PXV A;  1DF0 A;  5K16 A;  2NQA A;  5JH3 A;  1AIM A;  1GMY A;  1PPO A;  3WXG A;  2R9N A;  3DF0 A;  2BDL A;  4DMX A;  3KKU A;  4N4Z A;  4W5B A;  4YYV A;  4BGF A;  4BS6 A;  4YYQ A;  4CDF B;  4BPV A;  1GX3 A;  1MIR A;  4BS5 A;  1W5R A;  3BC3 A;  3H89 A;  1JQP A;  3WXF A;  4N8W A;  4Q8G A;  3D9W A;  1STF E;  3QT4 A;  3KSE A;  2DCA A;  1QDQ A;  4NV8 A;  1ATK A;  2E00 A;  3U8E A;  2OUL A;  2HXZ A;  4WA6 A;  4AXL A;  2G8J A;  3RVW A;  4I07 A;  4QBB A;  1U9V A;  3WXE A;  3K8U A;  3OVX A;  2AYN A;  1MDW A;  1YT7 A;  2OZ2 A;  5FPW A;  3BPM A;  2R9O A;  3I3T A;  3CH2 X;  3P5U A;  4PP1 A;  1MEG A;  2BSZ A;  1NPZ A;  2YJ8 A;  2FO5 A;  2CIO A;  4PAD A;  1AU4 A;  1A6R A;  1PPD A;  1YVB A;  2DC7 A;  3PW3 A;  4HWY A;  5J94 A;  2XU4 A;  4CDC B;  4P6E A;  3MOR A;  1Y4H A;  1NB3 A;  3LTW A;  4W4U A;  1EWP A;  3C9E A;  4CDE B;  3KWB X;  3N4C A;  3MTN A;  1M6D A;  3M99 A;  3KWZ A;  3PNR A;  4ZUX U;  3K9M A;  3BCN A;  1MEM A;  2E01 A;  1X9Y A;  2R9F A;  3P5X A;  2XU5 A;  1AYW A;  2Y5B A;  4Q8H A;  2F7D A;  2YJB A;  1PCI A;  1NQC A;  5CVM A;  3IUT A;  3GCB A;  1Q6K A;  1F2A A;  6PAD A;  2PNS A;  1NL6 A;  3N3G A;  2AS8 A;  2G8E A;  2ATO A;  1KXR A;  1CPJ A;  2VHF A;  3K24 A;  1ZCM A;  2OP3 A;  1QMY A;  2NQI A;  4GUZ A;  4I05 A;  5EF4 A;  5A24 A;  2JQF R;  1CJL A;  2P0R A;  4X6J A;  1EWL A;  3F5V A;  3IOQ A;  1E2T A;  2B1N A;  2AUX A;  3IHP A;  1SP4 B;  1U9Q X;  5CVN B;  4QRV A;  1POP A;  4XR7 A;  4FIP A;  1QXP A;  1TL9 A;  2HHN A;  2AU1 A;  4X6I A;  1F29 A;  2BDZ A;  2O6X A;  3OIS A;  4YV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...