3OVZA

Cathepsin k in complex with a covalent inhibitor with a ketoamide warhead
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin K
publication title Trifluoromethylphenyl as P2 for ketoamide-based cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ovzA00
2DC7A 3MHSA 3O0UA 4BPVA 3PW3A 1NB5A 1AU0A 1BP4A 4BS5A 5CVNB 3ZUAA 2YJ2A 1NLJA 4W5CA 4CDEB 3OVXA 1CS8A 4OELA 1MIRA 1TLOA 2GFOA 1MDWA 1CTEA 2DJGB 4YYVA 4CDDB 2E02A 5CHTA 4QRVA 3PDFA 1VSNA 1XKGA 3ERVA 2YJ8A 3WXGA 2FTDA 1TU6A 3CBJA 2CB5A 1AU4A 1U9VA 4AXMA 5FPWA 1PPNA 2ATOA 2DCDA 4WA6A 3HHIA 5PADA 1EWPA 3QJ3A 3LFYA 2DJFB 4X6HA 2PBHA 4BS6A 3QT4A 5JA7A 3OF8A 1STFE 1CJLA 3C9EA 3OF9A 1YALA 2FRAA 6PADA 2DC9A 1F2CA 2FO5A 3KKUA 1ATKA 1ME4A 2E00A 2NQAA 4YYUA 2R9CA 1NB3A 3S3QA 1KFUL 4G54A 4QRXA 3V6EA 2DCBA 1VJVA 1ME3A 4FK5A 1ZIVA 1CQDA 1BQIA 2BDLA 3O1GA 2AS8A 3OVZA 3M99A 3I06A 1SNKA 3KW9A 2OP3A 3N3KA 1ZCMA 7PCKA 1YK7A 3HWNA 4X6IA 2PADA 2XU3A 1PPOA 4W5BA 1QXPA 2AYNA 1YK8A 4KLBA 3DF0A 1DEUA 4YYWA 2XU1A 1AU2A 2DZZA 4ZUXU 3QSDA 2FYEA 3IUTA 3P5WA 1M6DA 1KFXL 2FRQA 4I07A 4P6GA 2G7YA 1CV8A 1THEA 2R9FA 1HUCB 3TNXA 3PNRA 1YT7A 4DMYA 1X9YA 1PE6A 3CH3X 4PI3A 2NQIA 1AYUA 1MEGA 4Q8GA 2DCCA 4YVAA 5F02A 2P86A 3KWBX 3AI8A 3HHAA 4YYSA 1PPDA 3H8BA 2Y6EA 8PCHA 2F1GA 1FH0A 2VHFA 2DZYA 3PBHA 1SP4B 3BCNA 1U9WA 9PAPA 2PREA 2YJCA 2NQDB 2C0YA 2G8EA 1PIPA 1Y08A 3BPMA 4HWYA 1PBHA 2DC6A 3V6CA 2HH5A 4FIPA 3BOWA 1NQCA 4OEMA 1O0EA 3H6SA 4W4UA 3HD3A 4FJCA 1NL6A 1S4VA 1TL9A 1YVBA 2JQFR 1EF7A 1MS6A 3IV2A 5CHVA 3RVVA 3BC3A 3K24A 2GHUA 2OULA 1AYVA 1GCBA 4QRGA 4X6JA 4YYRA 2BDZA 3WXEA 2R9OA 2ARYA 1GECE 2B1MA 4YV8A 2FUDA 3LXSA 3RVWA 5EF4A 5EGWA 3MTNA 1U5IA 4CDFB 1BY8A 3GCBA 1POPA 3S3RA 1GLOA 5J94A 3H89A 5A24A 1KHQA 2DCAA 4PP2E 4RY2A 2F7DA 3P5VA 2OZ2A 1MEMA 4XUIA 1PPPA 1EWMA 4YYQA 2P0RA 4I05A 2G6DA 3CH2X 1F2AA 4BSQA 1AU3A 4QH6A 1KHPA 4N4ZA 3H8CA 2AU1A 3F75A 1MHWA 2IPPB 1QOLA 3IOQA 1EWLA 2PNSA 1U9QX 1PXVA 2HHNA 2B1NA 3CBKA 2G8JA 1CVZA 5K16A 3U8EA 3KFQA 4MZSA 4N79A 2R9MA 3H7DA 2FT2A 3I3TA 1KXRA 3USVA 4CDCB 2HD5A 2P7UA 2ACTA 3D6SA 2FQ9A 2AIMA 3NHEA 2IBIA 1EWOA 1NPZA 4N8WA 4CZWA 2E03A 3IHPA 2HXZA 5CVMA 2AVWA 1CB5A 3IMAA 2AUZA 3KX1A 2NQGA 2WBFX 3P5UA 1BGOA 2XU4A 3B79A 1A6RA 5CVOB 1CSBB 1CPJA 2CIOA 4DMXA 5JH3A 2VHSA 3K8UA 2YJBA 2XU5A 4Q8HA 3WXFA 1QMYA 1GMYA 2AUXA 3RVXA 1PCIA 1QDQA 1K3BB 1IWDA 3K9MA 2DC8A 4MZOA 3BWKA 3F5VA 3P5XA 4AXLA 1Y4HA 2AYOA 1JQPA 3N3GA 4QBBA 2YJ9A 2E01A 3E1ZB 3BPFA 2JQGR 1AYWA 4BQVA 3MORA 4K7CA 1F2BA 3OISA 3IEJA 1DF0A 1AIMA 3MHHA 4PADA 3N4CA 1F29A 2Y5BA 4MSXA 1ICFA 3KSEA 1Q6KA 4PP1A 1AECA 4XR7A 1U9XA 2O6XA 2H7JA 2R9NA 3KWZA 4P6EA 4I04A 1PADA 2R6NA 1ITOA
chains in the Genus database with same CATH superfamily
2DC7A 3OQCA 2FE8A 3MHSA 3O0UA 4BOPA 4BPVA 3PW3A 1NB5A 3PRPA 4BOSA 4D8BA 1AU0A 1BP4A 4BS5A 5CVNB 4PT5A 3ZUAA 2YJ2A 1NLJA 4W5CA 4CDEB 3OVXA 1CS8A 4OELA 1MIRA 1TLOA 2GFOA 2J7QA 1MDWA 1CTEA 2DJGB 4YYVA 4CDDB 2E02A 3PSEA 4WURA 5CHTA 4QRVA 3PDFA 1VSNA 1XKGA 3ERVA 2YJ8A 4R3DA 3WXGA 4RF1A 2FTDA 1TU6A 3CBJA 4OVZB 2CB5A 1AU4A 1U9VA 4AXMA 5FPWA 1PPNA 2ATOA 2DCDA 4WA6A 3HHIA 5PADA 1EWPA 3QJ3A 4RKXA 3LFYA 2DJFB 3PHUA 4IP3A 4X6HA 2PBHA 4BS6A 3QT4A 5JA7A 3OF8A 1STFE 1CJLA 3C9EA 3OF9A 1YALA 2FRAA 4HXDB 6PADA 2DC9A 1F2CA 2FO5A 3KKUA 1ATKA 1ME4A 2E00A 2NQAA 4YYUA 2R9CA 1NB3A 3S3QA 1KFUL 4G54A 4RNAA 4QRXA 2BU3A 3V6EA 2DCBA 1VJVA 1ME3A 4FK5A 1ZIVA 1CQDA 1BQIA 2BDLA 3O1GA 2AS8A 3OVZA 3M99A 3I06A 1SNKA 3KW9A 2OP3A 3N3KA 1PVJA 1ZCMA 7PCKA 1YK7A 3HWNA 4X6IA 3PRMA 2PADA 2XU3A 1PPOA 4W5BA 1QXPA 2AYNA 1YK8A 4KLBA 3DF0A 1DEUA 4YYWA 2XU1A 1AU2A 2DZZA 4MI7A 4ZUXU 3QSDA 2FYEA 3IUTA 3P5WA 4IUMA 1M6DA 4MM3B 1KFXL 2FRQA 4I07A 4P6GA 2G7YA 1CV8A 1THEA 2R9FA 1HUCB 5E6JA 2DOSA 3TNXA 3PNRA 1YT7A 5KO3A 4DMYA 1X9YA 1PE6A 3CH3X 4PI3A 2NQIA 1AYUA 1MEGA 4Q8GA 2DCCA 4YVAA 5F02A 2P86A 3KWBX 3AI8A 3HHAA 4YYSA 1PPDA 3H8BA 2Y6EA 3C0RA 4OW0A 8PCHA 2F1GA 1FH0A 2VHFA 2DZYA 3PBHA 1SP4B 3BCNA 1U9WA 4XZXA 9PAPA 2PREA 1YZBA 4GUAA 2YJCA 2NQDB 2C0YA 2G8EA 2JTCA 1PIPA 3BY4A 3E9SA 1Y08A 3BPMA 4HWYA 1PBHA 2DC6A 3V6CA 2HH5A 4FIPA 2UZJA 3BOWA 1NQCA 4OEMA 1O0EA 4D8EA 3H6SA 4W4UA 3HD3A 4FJCA 1NL6A 1S4VA 1TL9A 1YVBA 2JQFR 1EF7A 1MS6A 3IV2A 4BOQA 5CHVA 4P16A 3RVVA 3BC3A 3K24A 2GHUA 5EZSA 2OULA 1AYVA 1GCBA 4QRGA 4X6JA 4YYRA 2BDZA 3W30A 2R9OA 3WXEA 2ARYA 3B21A 1GECE 3W31A 2B1MA 4YV8A 2FUDA 4BOZA 3LXSA 3RVWA 5EF4A 4D8IA 5EGWA 4REZA 3MTNA 1U5IA 2AGAA 4CDFB 1BY8A 3GCBA 4ZTBA 1POPA 3S3RA 1GLOA 5J94A 3H89A 5A24A 1KHQA 2DCAA 4PP2E 4RY2A 2F7DA 3MP2A 3P5VA 2OZ2A 1MEMA 4XUIA 1PPPA 1EWMA 4YYQA 2P0RA 4I05A 2G6DA 3CH2X 1F2AA 5EZQA 4BSQA 1AU3A 4QH6A 1KHPA 4N4ZA 3H8CA 3TMPA 2AU1A 3F75A 1MHWA 2IPPB 1QOLA 3IOQA 3ZNHA 1EWLA 2PNSA 1U9QX 1PXVA 2HHNA 2B1NA 3CBKA 2G8JA 1CVZA 5K16A 3U8EA 3KFQA 4MZSA 4N79A 3IFUA 4M0WA 2R9MA 1UKFA 3H7DA 2FT2A 3I3TA 1KXRA 3USVA 3TRKA 4CDCB 2HD5A 2P7UA 2ACTA 3D6SA 2FQ9A 2AIMA 3NHEA 2IBIA 1EWOA 1NPZA 4N8WA 4CZWA 2E03A 3BBAA 3IHPA 3PT2A 2HXZA 3O65A 3MTVA 5CVMA 2AVWA 1CB5A 3IMAA 3RNVA 2AUZA 3KX1A 2NQGA 2WBFX 3P5UA 1BGOA 2XU4A 3B79A 1A6RA 5CVOB 1CSBB 1CPJA 2CIOA 4DMXA 5JH3A 4BOUA 2VHSA 3K8UA 4OVZA 4RF0A 2YJBA 2XU5A 1DKIA 4Q8HA 3WXFA 2BTWB 1QMYA 1GMYA 2AUXA 3RVXA 1PCIA 3PHXA 1QDQA 1K3BB 1IWDA 3K9MA 5JZEA 2HWKA 2DC8A 3BB7A 4MZOA 3BWKA 3F5VA 3P5XA 4AXLA 1Y4HA 2AYOA 1JQPA 2Z84A 3N3GA 4QBBA 2BTWA 2YJ9A 2E01A 3E1ZB 3BPFA 2JQGR 1AYWA 4BQVA 3MORA 4K7CA 1F2BA 3OISA 3IEJA 4A5UA 1DF0A 1AIMA 3MHHA 4PADA 3N4CA 1F29A 2Y5BA 4MSXA 2JRIA 1ICFA 3KSEA 1Q6KA 4PP1A 3PHWA 1AECA 2J7QC 4XR7A 1U9XA 2O6XA 2H7JA 2R9NA 3KWZA 4P6EA 3MJ5A 4I04A 1PADA 2R6NA 1ITOA
chains in the Genus database with same CATH topology
2DC7A 3MHSA 3O0UA 4BPVA 3PW3A 1NB5A 1AU0A 1BP4A 4BS5A 5CVNB 3ZUAA 2YJ2A 1NLJA 4W5CA 4CDEB 3OVXA 4C5PA 1CS8A 4OELA 1MIRA 1TLOA 2GFOA 1MDWA 1CTEA 2DJGB 4YYVA 4CDDB 2E02A 1W5RA 5CHTA 4QRVA 3PDFA 1VSNA 1XKGA 3ERVA 2YJ8A 1W4TA 3WXGA 2FTDA 1TU6A 3CBJA 2CB5A 1AU4A 1U9VA 4AXMA 5FPWA 1PPNA 2ATOA 2DCDA 4WA6A 3HHIA 5PADA 1EWPA 3QJ3A 3LFYA 2DJFB 1GX3A 4X6HA 2PBHA 4BS6A 3QT4A 5JA7A 3OF8A 1STFE 1CJLA 3C9EA 3OF9A 1YALA 2FRAA 6PADA 2DC9A 1F2CA 2FO5A 3KKUA 1ATKA 1ME4A 2E00A 2NQAA 4YYUA 2R9CA 1NB3A 3S3QA 1KFUL 4G54A 4QRXA 3V6EA 2DCBA 1VJVA 1ME3A 4FK5A 1ZIVA 1CQDA 1BQIA 2BDLA 3O1GA 2AS8A 3OVZA 3M99A 3I06A 1SNKA 3KW9A 2OP3A 3N3KA 2BSZA 1ZCMA 7PCKA 1YK7A 3HWNA 4X6IA 2PADA 2XU3A 1PPOA 4W5BA 1QXPA 2AYNA 1YK8A 4KLBA 3DF0A 1DEUA 4YYWA 2XU1A 1AU2A 2DZZA 1E2TA 4ZUXU 3QSDA 2FYEA 3IUTA 3P5WA 1M6DA 1KFXL 2FRQA 3LTWA 4I07A 4P6GA 2G7YA 1CV8A 1THEA 2R9FA 1HUCB 3TNXA 3PNRA 1YT7A 4DMYA 1X9YA 1PE6A 3CH3X 4PI3A 2NQIA 1AYUA 1MEGA 4Q8GA 2DCCA 4YVAA 5F02A 2P86A 3KWBX 3AI8A 3HHAA 4YYSA 1PPDA 3H8BA 4NV8A 2Y6EA 8PCHA 2F1GA 1FH0A 2VHFA 2DZYA 3PBHA 1SP4B 3BCNA 1U9WA 9PAPA 2PREA 2YJCA 2NQDB 2C0YA 2G8EA 1PIPA 1Y08A 3BPMA 4HWYA 1PBHA 2DC6A 3V6CA 2HH5A 4FIPA 3BOWA 1NQCA 4OEMA 1O0EA 3H6SA 4W4UA 3HD3A 4FJCA 1NL6A 1S4VA 1TL9A 1YVBA 2JQFR 1EF7A 1MS6A 3IV2A 5CHVA 3RVVA 3BC3A 3K24A 2GHUA 4BGFA 2OULA 1AYVA 1GCBA 4QRGA 4X6JA 4YYRA 2BDZA 3WXEA 2R9OA 2ARYA 1GECE 2B1MA 2VFCA 4YV8A 2FUDA 3LXSA 3RVWA 5EF4A 5EGWA 3MTNA 1U5IA 4CDFB 1BY8A 3GCBA 1POPA 3S3RA 1GLOA 5J94A 3H89A 5A24A 1KHQA 2DCAA 1W6FA 2VFBA 4PP2E 4RY2A 2F7DA 3P5VA 2OZ2A 1MEMA 4XUIA 1PPPA 1EWMA 4YYQA 2P0RA 4I05A 2G6DA 3CH2X 1F2AA 4BSQA 1AU3A 4NV7A 4QH6A 1KHPA 4N4ZA 3H8CA 2AU1A 3F75A 1MHWA 2IPPB 1QOLA 3IOQA 1EWLA 2PNSA 1U9QX 1PXVA 2HHNA 2B1NA 3CBKA 2G8JA 1CVZA 5K16A 3U8EA 3KFQA 4MZSA 4N79A 2R9MA 3H7DA 2FT2A 3I3TA 1KXRA 3USVA 4CDCB 2HD5A 2P7UA 2ACTA 3D6SA 2FQ9A 2AIMA 3NHEA 2IBIA 1EWOA 1NPZA 4N8WA 4CZWA 2E03A 3IHPA 2HXZA 5CVMA 2AVWA 1CB5A 3IMAA 2AUZA 3KX1A 2NQGA 2WBFX 3P5UA 1BGOA 2XU4A 3B79A 1A6RA 5CVOB 1CSBB 1CPJA 2CIOA 4DMXA 3D9WA 5JH3A 2VHSA 3K8UA 2YJBA 2XU5A 4Q8HA 3WXFA 1QMYA 1GMYA 2AUXA 3RVXA 1PCIA 1QDQA 1K3BB 1IWDA 3K9MA 4GUZA 2DC8A 4MZOA 3BWKA 3F5VA 3P5XA 4AXLA 1Y4HA 2AYOA 1JQPA 3N3GA 4QBBA 2YJ9A 2E01A 3E1ZB 3BPFA 2JQGR 1AYWA 4BQVA 3MORA 4K7CA 1F2BA 3OISA 3IEJA 1DF0A 1AIMA 3MHHA 4PADA 3N4CA 1F29A 4B55A 2Y5BA 4MSXA 1ICFA 3KSEA 1Q6KA 4PP1A 1AECA 4XR7A 1U9XA 2O6XA 2H7JA 2R9NA 3KWZA 4P6EA 4I04A 1PADA 2R6NA 1ITOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC7 A;  3MHS A;  3O0U A;  4BPV A;  3PW3 A;  1NB5 A;  1AU0 A;  1BP4 A;  4BS5 A;  5CVN B;  3ZUA A;  2YJ2 A;  1NLJ A;  4W5C A;  4CDE B;  3OVX A;  1CS8 A;  4OEL A;  1MIR A;  1TLO A;  2GFO A;  1MDW A;  1CTE A;  2DJG B;  4YYV A;  4CDD B;  2E02 A;  5CHT A;  4QRV A;  3PDF A;  1VSN A;  1XKG A;  3ERV A;  2YJ8 A;  3WXG A;  2FTD A;  1TU6 A;  3CBJ A;  2CB5 A;  1AU4 A;  1U9V A;  4AXM A;  5FPW A;  1PPN A;  2ATO A;  2DCD A;  4WA6 A;  3HHI A;  5PAD A;  1EWP A;  3QJ3 A;  3LFY A;  2DJF B;  4X6H A;  2PBH A;  4BS6 A;  3QT4 A;  5JA7 A;  3OF8 A;  1STF E;  1CJL A;  3C9E A;  3OF9 A;  1YAL A;  2FRA A;  6PAD A;  2DC9 A;  1F2C A;  2FO5 A;  3KKU A;  1ATK A;  1ME4 A;  2E00 A;  2NQA A;  4YYU A;  2R9C A;  1NB3 A;  3S3Q A;  1KFU L;  4G54 A;  4QRX A;  3V6E A;  2DCB A;  1VJV A;  1ME3 A;  4FK5 A;  1ZIV A;  1CQD A;  1BQI A;  2BDL A;  3O1G A;  2AS8 A;  3OVZ A;  3M99 A;  3I06 A;  1SNK A;  3KW9 A;  2OP3 A;  3N3K A;  1ZCM A;  7PCK A;  1YK7 A;  3HWN A;  4X6I A;  2PAD A;  2XU3 A;  1PPO A;  4W5B A;  1QXP A;  2AYN A;  1YK8 A;  4KLB A;  3DF0 A;  1DEU A;  4YYW A;  2XU1 A;  1AU2 A;  2DZZ A;  4ZUX U;  3QSD A;  2FYE A;  3IUT A;  3P5W A;  1M6D A;  1KFX L;  2FRQ A;  4I07 A;  4P6G A;  2G7Y A;  1CV8 A;  1THE A;  2R9F A;  1HUC B;  3TNX A;  3PNR A;  1YT7 A;  4DMY A;  1X9Y A;  1PE6 A;  3CH3 X;  4PI3 A;  2NQI A;  1AYU A;  1MEG A;  4Q8G A;  2DCC A;  4YVA A;  5F02 A;  2P86 A;  3KWB X;  3AI8 A;  3HHA A;  4YYS A;  1PPD A;  3H8B A;  2Y6E A;  8PCH A;  2F1G A;  1FH0 A;  2VHF A;  2DZY A;  3PBH A;  1SP4 B;  3BCN A;  1U9W A;  9PAP A;  2PRE A;  2YJC A;  2NQD B;  2C0Y A;  2G8E A;  1PIP A;  1Y08 A;  3BPM A;  4HWY A;  1PBH A;  2DC6 A;  3V6C A;  2HH5 A;  4FIP A;  3BOW A;  1NQC A;  4OEM A;  1O0E A;  3H6S A;  4W4U A;  3HD3 A;  4FJC A;  1NL6 A;  1S4V A;  1TL9 A;  1YVB A;  2JQF R;  1EF7 A;  1MS6 A;  3IV2 A;  5CHV A;  3RVV A;  3BC3 A;  3K24 A;  2GHU A;  2OUL A;  1AYV A;  1GCB A;  4QRG A;  4X6J A;  4YYR A;  2BDZ A;  3WXE A;  2R9O A;  2ARY A;  1GEC E;  2B1M A;  4YV8 A;  2FUD A;  3LXS A;  3RVW A;  5EF4 A;  5EGW A;  3MTN A;  1U5I A;  4CDF B;  1BY8 A;  3GCB A;  1POP A;  3S3R A;  1GLO A;  5J94 A;  3H89 A;  5A24 A;  1KHQ A;  2DCA A;  4PP2 E;  4RY2 A;  2F7D A;  3P5V A;  2OZ2 A;  1MEM A;  4XUI A;  1PPP A;  1EWM A;  4YYQ A;  2P0R A;  4I05 A;  2G6D A;  3CH2 X;  1F2A A;  4BSQ A;  1AU3 A;  4QH6 A;  1KHP A;  4N4Z A;  3H8C A;  2AU1 A;  3F75 A;  1MHW A;  2IPP B;  1QOL A;  3IOQ A;  1EWL A;  2PNS A;  1U9Q X;  1PXV A;  2HHN A;  2B1N A;  3CBK A;  2G8J A;  1CVZ A;  5K16 A;  3U8E A;  3KFQ A;  4MZS A;  4N79 A;  2R9M A;  3H7D A;  2FT2 A;  3I3T A;  1KXR A;  3USV A;  4CDC B;  2HD5 A;  2P7U A;  2ACT A;  3D6S A;  2FQ9 A;  2AIM A;  3NHE A;  2IBI A;  1EWO A;  1NPZ A;  4N8W A;  4CZW A;  2E03 A;  3IHP A;  2HXZ A;  5CVM A;  2AVW A;  1CB5 A;  3IMA A;  2AUZ A;  3KX1 A;  2NQG A;  2WBF X;  3P5U A;  1BGO A;  2XU4 A;  3B79 A;  1A6R A;  5CVO B;  1CSB B;  1CPJ A;  2CIO A;  4DMX A;  5JH3 A;  2VHS A;  3K8U A;  2YJB A;  2XU5 A;  4Q8H A;  3WXF A;  1QMY A;  1GMY A;  2AUX A;  3RVX A;  1PCI A;  1QDQ A;  1K3B B;  1IWD A;  3K9M A;  2DC8 A;  4MZO A;  3BWK A;  3F5V A;  3P5X A;  4AXL A;  1Y4H A;  2AYO A;  1JQP A;  3N3G A;  4QBB A;  2YJ9 A;  2E01 A;  3E1Z B;  3BPF A;  2JQG R;  1AYW A;  4BQV A;  3MOR A;  4K7C A;  1F2B A;  3OIS A;  3IEJ A;  1DF0 A;  1AIM A;  3MHH A;  4PAD A;  3N4C A;  1F29 A;  2Y5B A;  4MSX A;  1ICF A;  3KSE A;  1Q6K A;  4PP1 A;  1AEC A;  4XR7 A;  1U9X A;  2O6X A;  2H7J A;  2R9N A;  3KWZ A;  4P6E A;  4I04 A;  1PAD A;  2R6N A;  1ITO A; 
#chains in the Genus database with same CATH topology
 2DC7 A;  3OQC A;  2FE8 A;  3MHS A;  3O0U A;  4BOP A;  4BPV A;  3PW3 A;  1NB5 A;  3PRP A;  4BOS A;  4D8B A;  1AU0 A;  1BP4 A;  4BS5 A;  5CVN B;  4PT5 A;  3ZUA A;  2YJ2 A;  1NLJ A;  4W5C A;  4CDE B;  3OVX A;  1CS8 A;  4OEL A;  1MIR A;  1TLO A;  2GFO A;  2J7Q A;  1MDW A;  1CTE A;  2DJG B;  4YYV A;  4CDD B;  2E02 A;  3PSE A;  4WUR A;  5CHT A;  4QRV A;  3PDF A;  1VSN A;  1XKG A;  3ERV A;  2YJ8 A;  4R3D A;  3WXG A;  4RF1 A;  2FTD A;  1TU6 A;  3CBJ A;  4OVZ B;  2CB5 A;  1AU4 A;  1U9V A;  4AXM A;  5FPW A;  1PPN A;  2ATO A;  2DCD A;  4WA6 A;  3HHI A;  5PAD A;  1EWP A;  3QJ3 A;  4RKX A;  3LFY A;  2DJF B;  3PHU A;  4IP3 A;  4X6H A;  2PBH A;  4BS6 A;  3QT4 A;  5JA7 A;  3OF8 A;  1STF E;  1CJL A;  3C9E A;  3OF9 A;  1YAL A;  2FRA A;  4HXD B;  6PAD A;  2DC9 A;  1F2C A;  2FO5 A;  3KKU A;  1ATK A;  1ME4 A;  2E00 A;  2NQA A;  4YYU A;  2R9C A;  1NB3 A;  3S3Q A;  1KFU L;  4G54 A;  4RNA A;  4QRX A;  2BU3 A;  3V6E A;  2DCB A;  1VJV A;  1ME3 A;  4FK5 A;  1ZIV A;  1CQD A;  1BQI A;  2BDL A;  3O1G A;  2AS8 A;  3OVZ A;  3M99 A;  3I06 A;  1SNK A;  3KW9 A;  2OP3 A;  3N3K A;  1PVJ A;  1ZCM A;  7PCK A;  1YK7 A;  3HWN A;  4X6I A;  3PRM A;  2PAD A;  2XU3 A;  1PPO A;  4W5B A;  1QXP A;  2AYN A;  1YK8 A;  4KLB A;  3DF0 A;  1DEU A;  4YYW A;  2XU1 A;  1AU2 A;  2DZZ A;  4MI7 A;  4ZUX U;  3QSD A;  2FYE A;  3IUT A;  3P5W A;  4IUM A;  1M6D A;  4MM3 B;  1KFX L;  2FRQ A;  4I07 A;  4P6G A;  2G7Y A;  1CV8 A;  1THE A;  2R9F A;  1HUC B;  5E6J A;  2DOS A;  3TNX A;  3PNR A;  1YT7 A;  5KO3 A;  4DMY A;  1X9Y A;  1PE6 A;  3CH3 X;  4PI3 A;  2NQI A;  1AYU A;  1MEG A;  4Q8G A;  2DCC A;  4YVA A;  5F02 A;  2P86 A;  3KWB X;  3AI8 A;  3HHA A;  4YYS A;  1PPD A;  3H8B A;  2Y6E A;  3C0R A;  4OW0 A;  8PCH A;  2F1G A;  1FH0 A;  2VHF A;  2DZY A;  3PBH A;  1SP4 B;  3BCN A;  1U9W A;  4XZX A;  9PAP A;  2PRE A;  1YZB A;  4GUA A;  2YJC A;  2NQD B;  2C0Y A;  2G8E A;  2JTC A;  1PIP A;  3BY4 A;  3E9S A;  1Y08 A;  3BPM A;  4HWY A;  1PBH A;  2DC6 A;  3V6C A;  2HH5 A;  4FIP A;  2UZJ A;  3BOW A;  1NQC A;  4OEM A;  1O0E A;  4D8E A;  3H6S A;  4W4U A;  3HD3 A;  4FJC A;  1NL6 A;  1S4V A;  1TL9 A;  1YVB A;  2JQF R;  1EF7 A;  1MS6 A;  3IV2 A;  4BOQ A;  5CHV A;  4P16 A;  3RVV A;  3BC3 A;  3K24 A;  2GHU A;  5EZS A;  2OUL A;  1AYV A;  1GCB A;  4QRG A;  4X6J A;  4YYR A;  2BDZ A;  3W30 A;  2R9O A;  3WXE A;  2ARY A;  3B21 A;  1GEC E;  3W31 A;  2B1M A;  4YV8 A;  2FUD A;  4BOZ A;  3LXS A;  3RVW A;  5EF4 A;  4D8I A;  5EGW A;  4REZ A;  3MTN A;  1U5I A;  2AGA A;  4CDF B;  1BY8 A;  3GCB A;  4ZTB A;  1POP A;  3S3R A;  1GLO A;  5J94 A;  3H89 A;  5A24 A;  1KHQ A;  2DCA A;  4PP2 E;  4RY2 A;  2F7D A;  3MP2 A;  3P5V A;  2OZ2 A;  1MEM A;  4XUI A;  1PPP A;  1EWM A;  4YYQ A;  2P0R A;  4I05 A;  2G6D A;  3CH2 X;  1F2A A;  5EZQ A;  4BSQ A;  1AU3 A;  4QH6 A;  1KHP A;  4N4Z A;  3H8C A;  3TMP A;  2AU1 A;  3F75 A;  1MHW A;  2IPP B;  1QOL A;  3IOQ A;  3ZNH A;  1EWL A;  2PNS A;  1U9Q X;  1PXV A;  2HHN A;  2B1N A;  3CBK A;  2G8J A;  1CVZ A;  5K16 A;  3U8E A;  3KFQ A;  4MZS A;  4N79 A;  3IFU A;  4M0W A;  2R9M A;  1UKF A;  3H7D A;  2FT2 A;  3I3T A;  1KXR A;  3USV A;  3TRK A;  4CDC B;  2HD5 A;  2P7U A;  2ACT A;  3D6S A;  2FQ9 A;  2AIM A;  3NHE A;  2IBI A;  1EWO A;  1NPZ A;  4N8W A;  4CZW A;  2E03 A;  3BBA A;  3IHP A;  3PT2 A;  2HXZ A;  3O65 A;  3MTV A;  5CVM A;  2AVW A;  1CB5 A;  3IMA A;  3RNV A;  2AUZ A;  3KX1 A;  2NQG A;  2WBF X;  3P5U A;  1BGO A;  2XU4 A;  3B79 A;  1A6R A;  5CVO B;  1CSB B;  1CPJ A;  2CIO A;  4DMX A;  5JH3 A;  4BOU A;  2VHS A;  3K8U A;  4OVZ A;  4RF0 A;  2YJB A;  2XU5 A;  1DKI A;  4Q8H A;  3WXF A;  2BTW B;  1QMY A;  1GMY A;  2AUX A;  3RVX A;  1PCI A;  3PHX A;  1QDQ A;  1K3B B;  1IWD A;  3K9M A;  5JZE A;  2HWK A;  2DC8 A;  3BB7 A;  4MZO A;  3BWK A;  3F5V A;  3P5X A;  4AXL A;  1Y4H A;  2AYO A;  1JQP A;  2Z84 A;  3N3G A;  4QBB A;  2BTW A;  2YJ9 A;  2E01 A;  3E1Z B;  3BPF A;  2JQG R;  1AYW A;  4BQV A;  3MOR A;  4K7C A;  1F2B A;  3OIS A;  3IEJ A;  4A5U A;  1DF0 A;  1AIM A;  3MHH A;  4PAD A;  3N4C A;  1F29 A;  2Y5B A;  4MSX A;  2JRI A;  1ICF A;  3KSE A;  1Q6K A;  4PP1 A;  3PHW A;  1AEC A;  2J7Q C;  4XR7 A;  1U9X A;  2O6X A;  2H7J A;  2R9N A;  3KWZ A;  4P6E A;  3MJ5 A;  4I04 A;  1PAD A;  2R6N A;  1ITO A; 
#chains in the Genus database with same CATH homology
 2DC7 A;  3MHS A;  3O0U A;  4BPV A;  3PW3 A;  1NB5 A;  1AU0 A;  1BP4 A;  4BS5 A;  5CVN B;  3ZUA A;  2YJ2 A;  1NLJ A;  4W5C A;  4CDE B;  3OVX A;  4C5P A;  1CS8 A;  4OEL A;  1MIR A;  1TLO A;  2GFO A;  1MDW A;  1CTE A;  2DJG B;  4YYV A;  4CDD B;  2E02 A;  1W5R A;  5CHT A;  4QRV A;  3PDF A;  1VSN A;  1XKG A;  3ERV A;  2YJ8 A;  1W4T A;  3WXG A;  2FTD A;  1TU6 A;  3CBJ A;  2CB5 A;  1AU4 A;  1U9V A;  4AXM A;  5FPW A;  1PPN A;  2ATO A;  2DCD A;  4WA6 A;  3HHI A;  5PAD A;  1EWP A;  3QJ3 A;  3LFY A;  2DJF B;  1GX3 A;  4X6H A;  2PBH A;  4BS6 A;  3QT4 A;  5JA7 A;  3OF8 A;  1STF E;  1CJL A;  3C9E A;  3OF9 A;  1YAL A;  2FRA A;  6PAD A;  2DC9 A;  1F2C A;  2FO5 A;  3KKU A;  1ATK A;  1ME4 A;  2E00 A;  2NQA A;  4YYU A;  2R9C A;  1NB3 A;  3S3Q A;  1KFU L;  4G54 A;  4QRX A;  3V6E A;  2DCB A;  1VJV A;  1ME3 A;  4FK5 A;  1ZIV A;  1CQD A;  1BQI A;  2BDL A;  3O1G A;  2AS8 A;  3OVZ A;  3M99 A;  3I06 A;  1SNK A;  3KW9 A;  2OP3 A;  3N3K A;  2BSZ A;  1ZCM A;  7PCK A;  1YK7 A;  3HWN A;  4X6I A;  2PAD A;  2XU3 A;  1PPO A;  4W5B A;  1QXP A;  2AYN A;  1YK8 A;  4KLB A;  3DF0 A;  1DEU A;  4YYW A;  2XU1 A;  1AU2 A;  2DZZ A;  1E2T A;  4ZUX U;  3QSD A;  2FYE A;  3IUT A;  3P5W A;  1M6D A;  1KFX L;  2FRQ A;  3LTW A;  4I07 A;  4P6G A;  2G7Y A;  1CV8 A;  1THE A;  2R9F A;  1HUC B;  3TNX A;  3PNR A;  1YT7 A;  4DMY A;  1X9Y A;  1PE6 A;  3CH3 X;  4PI3 A;  2NQI A;  1AYU A;  1MEG A;  4Q8G A;  2DCC A;  4YVA A;  5F02 A;  2P86 A;  3KWB X;  3AI8 A;  3HHA A;  4YYS A;  1PPD A;  3H8B A;  4NV8 A;  2Y6E A;  8PCH A;  2F1G A;  1FH0 A;  2VHF A;  2DZY A;  3PBH A;  1SP4 B;  3BCN A;  1U9W A;  9PAP A;  2PRE A;  2YJC A;  2NQD B;  2C0Y A;  2G8E A;  1PIP A;  1Y08 A;  3BPM A;  4HWY A;  1PBH A;  2DC6 A;  3V6C A;  2HH5 A;  4FIP A;  3BOW A;  1NQC A;  4OEM A;  1O0E A;  3H6S A;  4W4U A;  3HD3 A;  4FJC A;  1NL6 A;  1S4V A;  1TL9 A;  1YVB A;  2JQF R;  1EF7 A;  1MS6 A;  3IV2 A;  5CHV A;  3RVV A;  3BC3 A;  3K24 A;  2GHU A;  4BGF A;  2OUL A;  1AYV A;  1GCB A;  4QRG A;  4X6J A;  4YYR A;  2BDZ A;  3WXE A;  2R9O A;  2ARY A;  1GEC E;  2B1M A;  2VFC A;  4YV8 A;  2FUD A;  3LXS A;  3RVW A;  5EF4 A;  5EGW A;  3MTN A;  1U5I A;  4CDF B;  1BY8 A;  3GCB A;  1POP A;  3S3R A;  1GLO A;  5J94 A;  3H89 A;  5A24 A;  1KHQ A;  2DCA A;  1W6F A;  2VFB A;  4PP2 E;  4RY2 A;  2F7D A;  3P5V A;  2OZ2 A;  1MEM A;  4XUI A;  1PPP A;  1EWM A;  4YYQ A;  2P0R A;  4I05 A;  2G6D A;  3CH2 X;  1F2A A;  4BSQ A;  1AU3 A;  4NV7 A;  4QH6 A;  1KHP A;  4N4Z A;  3H8C A;  2AU1 A;  3F75 A;  1MHW A;  2IPP B;  1QOL A;  3IOQ A;  1EWL A;  2PNS A;  1U9Q X;  1PXV A;  2HHN A;  2B1N A;  3CBK A;  2G8J A;  1CVZ A;  5K16 A;  3U8E A;  3KFQ A;  4MZS A;  4N79 A;  2R9M A;  3H7D A;  2FT2 A;  3I3T A;  1KXR A;  3USV A;  4CDC B;  2HD5 A;  2P7U A;  2ACT A;  3D6S A;  2FQ9 A;  2AIM A;  3NHE A;  2IBI A;  1EWO A;  1NPZ A;  4N8W A;  4CZW A;  2E03 A;  3IHP A;  2HXZ A;  5CVM A;  2AVW A;  1CB5 A;  3IMA A;  2AUZ A;  3KX1 A;  2NQG A;  2WBF X;  3P5U A;  1BGO A;  2XU4 A;  3B79 A;  1A6R A;  5CVO B;  1CSB B;  1CPJ A;  2CIO A;  4DMX A;  3D9W A;  5JH3 A;  2VHS A;  3K8U A;  2YJB A;  2XU5 A;  4Q8H A;  3WXF A;  1QMY A;  1GMY A;  2AUX A;  3RVX A;  1PCI A;  1QDQ A;  1K3B B;  1IWD A;  3K9M A;  4GUZ A;  2DC8 A;  4MZO A;  3BWK A;  3F5V A;  3P5X A;  4AXL A;  1Y4H A;  2AYO A;  1JQP A;  3N3G A;  4QBB A;  2YJ9 A;  2E01 A;  3E1Z B;  3BPF A;  2JQG R;  1AYW A;  4BQV A;  3MOR A;  4K7C A;  1F2B A;  3OIS A;  3IEJ A;  1DF0 A;  1AIM A;  3MHH A;  4PAD A;  3N4C A;  1F29 A;  4B55 A;  2Y5B A;  4MSX A;  1ICF A;  3KSE A;  1Q6K A;  4PP1 A;  1AEC A;  4XR7 A;  1U9X A;  2O6X A;  2H7J A;  2R9N A;  3KWZ A;  4P6E A;  4I04 A;  1PAD A;  2R6N A;  1ITO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...