4A5UA

Turnip yellow mosaic virus proteinase and escherichia coli 30s ribosomal s15
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
148
Chain Sequence
LPAPLTNDPTAIGPVLPFEELHPRRYPENTATFLTRLRSLPSNHLPQPTLNCLLSAVSDQTKVSEEHLWESLQTILPDSQLSNEETNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPPSHFSPGKRLLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Compact Viral Processing Proteinase/Ubiquitin Hydrolase from the Otu Family.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Transferase/rna binding protein
molecule keywords RNA REPLICASE POLYPROTEIN
total genus 49
structure length 148
sequence length 148
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.100 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4a5uA00
4A5UA
chains in the Genus database with same CATH superfamily
1EWMA 1TU6A 2JQGR 3WXEA 1X9YA 4HXDB 4HWYA 4ZTBA 5FPWA 5EZSA 5JH3A 2F1GA 1HUCB 3K24A 3N4CA 2WBFX 1MEMA 1NB3A 3IUTA 2CIOA 2OZ2A 3HD3A 3OQCA 3B79A 3K8UA 3ZUAA 1TL9A 3PHUA 3HHIA 3OVZA 4CDEB 2DOSA 4YYQA 2IBIA 2ARYA 3BBAA 3BCNA 5CHVA 3TRKA 4YYVA 3H8CA 1QDQA 4YYRA 1YK8A 4CDFB 1GCBA 1MEGA 3KWBX 4OVZA 4WURA 1Y4HA 4P16A 5CVMA 4N4ZA 3LFYA 1NL6A 4D8EA 4OW0A 2Y6EA 3H8BA 4PP1A 4IP3A 2C0YA 3I3TA 4BPVA 1U9WA 4OEMA 1ITOA 2OULA 4QRVA 1CVZA 2HHNA 5EZQA 1CV8A 2R9NA 4MZOA 1YK7A 2Y5BA 2R6NA 1O0EA 4MM3B 4BOSA 2OP3A 4IUMA 2XU3A 1DKIA 1AU3A 3CBJA 1PADA 1U5IA 3N3GA 2HWKA 3KX1A 2R9FA 4X6HA 2PBHA 3V6CA 2YJ9A 4BSQA 2FO5A 3PSEA 4MZSA 2YJ2A 2DCCA 3IHPA 1CTEA 3KKUA 4BQVA 1SP4B 3HWNA 1PPNA 2AIMA 3QJ3A 3IFUA 3WXGA 3H7DA 4QRXA 2AUXA 2BDLA 1YZBA 4I05A 3AI8A 4BOUA 5CHTA 4MSXA 1CPJA 1KFXL 1ZCMA 4I04A 1UKFA 2HXZA 2YJBA 1U9XA 2DCBA 4Q8HA 1VSNA 2DC7A 4CDDB 1AU2A 2CB5A 2DC9A 1AYWA 3ERVA 2AS8A 1CB5A 4RNAA 2ACTA 3O65A 3U8EA 2GHUA 1PPPA 3OVXA 4D8BA 3KFQA 2AGAA 2FRAA 4BOPA 1AYVA 2DJFB 3MHHA 1BQIA 3W30A 1PPDA 3C9EA 3F5VA 1QXPA 4M0WA 3MHSA 2YJCA 1PXVA 4X6JA 1MHWA 3RVXA 1Y08A 4AXLA 2VHFA 1MIRA 3KW9A 3MP2A 1POPA 3QT4A 4RKXA 2H7JA 3CH2X 2NQAA 1CS8A 4D8IA 3IEJA 3QSDA 1THEA 4W4UA 2F7DA 1DEUA 2HH5A 3P5VA 9PAPA 1PCIA 3IMAA 2AVWA 2G7YA 2ATOA 1IWDA 2E00A 2J7QA 4XZXA 2FT2A 2G6DA 1S4VA 2AYOA 3BWKA 2FTDA 3CH3X 5CVOB 2PADA 3PDFA 5JA7A 4W5CA 4AXMA 2P7UA 3IOQA 2R9OA 5J94A 2AUZA 3PRPA 1PPOA 2JQFR 3W31A 1CSBB 4PP2E 5F02A 5CVNB 1YT7A 3GCBA 2FYEA 2J7QC 4PT5A 1AU4A 1VJVA 1PE6A 4ZUXU 2DZYA 1BGOA 1ATKA 3P5XA 2P0RA 4DMXA 3MJ5A 2R9CA 3USVA 3KWZA 2BU3A 1F29A 1SNKA 3F75A 4N8WA 2DCDA 3D6SA 3PBHA 1CJLA 2DCAA 6PADA 2NQGA 2FQ9A 3BPMA 1JQPA 3H89A 8PCHA 2UZJA 3BOWA 4BOZA 1BP4A 4RF1A 1AECA 3TNXA 3O1GA 4OVZB 2GFOA 2XU1A 4BS6A 1EWLA 4Q8GA 1NPZA 1M6DA 1K3BB 2DC6A 4YVAA 1A6RA 4YYSA 4N79A 3H6SA 4QRGA 4FIPA 4G54A 4W5BA 1EF7A 3PHWA 2NQIA 2P86A 3E9SA 2BTWB 1ME4A 2R9MA 4WA6A 3P5UA 3PHXA 4K7CA 3S3RA 4RY2A 1YVBA 3LXSA 5K16A 3TMPA 1PBHA 3DF0A 2FUDA 4GUAA 1MS6A 2G8JA 4XR7A 3RVWA 5E6JA 1ME3A 2Z84A 1QOLA 3BB7A 3OF9A 1GLOA 4OELA 5EGWA 1F2AA 3O0UA 4KLBA 1Q6KA 1EWPA 3K9MA 1F2BA 3BY4A 4CDCB 4CZWA 2B1NA 1U9QX 3MORA 4RF0A 2JRIA 4MI7A 1FH0A 2FRQA 2JTCA 2E01A 3WXFA 3I06A 1PVJA 5A24A 1QMYA 1KXRA 4DMYA 4PADA 4X6IA 3PT2A 5KO3A 3HHAA 2G8EA 3P5WA 3OF8A 3MTNA 1KFUL 3N3KA 2DZZA 1GMYA 3CBKA 3RVVA 3OISA 1AIMA 4YYWA 4P6EA 1NQCA 1ICFA 1CQDA 2DJGB 1AYUA 4R3DA 2NQDB 4REZA 1EWOA 4P6GA 1TLOA 3PRMA 4YYUA 3NHEA 3E1ZB 4FJCA 2DC8A 1U9VA 1KHPA 2E02A 1AU0A 2PNSA 3V6EA 2YJ8A 4BS5A 2HD5A 3B21A 2FE8A 2XU5A 1DF0A 2PREA 4YV8A 7PCKA 1F2CA 3PNRA 3C0RA 4PI3A 1PIPA 1MDWA 4QBBA 4XUIA 1GECE 5PADA 3PW3A 1NLJA 1YALA 2B1MA 2AYNA 3M99A 5JZEA 3BPFA 2BDZA 3IV2A 4FK5A 4A5UA 5EF4A 1ZIVA 1NB5A 2AU1A 2XU4A 2BTWA 1STFE 1BY8A 1XKGA 2VHSA 4QH6A 4I07A 2O6XA 3BC3A 2E03A 2IPPB 3RNVA 3KSEA 1KHQA 3S3QA 4BOQA 3MTVA 3ZNHA
chains in the Genus database with same CATH topology
2DOSA 3IFUA 3TMPA 3MJ5A 4RNAA 3BBAA 3BY4A 3O65A 2HWKA 3PRPA 1YZBA 4GUAA 3TRKA 4D8BA 5JZEA 4HXDB 2AGAA 4ZTBA 4BOUA 2BU3A 3MP2A 5EZSA 4A5UA 3W31A 4BOPA 4RKXA 5EZQA 5KO3A 4RF0A 2J7QA 4XZXA 2JRIA 3B21A 2FE8A 4MI7A 4OVZA 3W30A 4D8IA 2JTCA 4WURA 1UKFA 2BTWA 3PHWA 4P16A 3PSEA 5E6JA 1PVJA 2Z84A 3BB7A 2J7QC 4R3DA 4D8EA 4PT5A 3E9SA 2BTWB 3C0RA 3OQCA 4M0WA 4MM3B 4OW0A 4REZA 4BOSA 2UZJA 4BOZA 3PRMA 4IP3A 4IUMA 4RF1A 3RNVA 1DKIA 3PHXA 4BOQA 4OVZB 3PHUA 3MTVA 3PT2A 3ZNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5U A; 
#chains in the Genus database with same CATH topology
 1EWM A;  1TU6 A;  2JQG R;  3WXE A;  1X9Y A;  4HXD B;  4HWY A;  4ZTB A;  5FPW A;  5EZS A;  5JH3 A;  2F1G A;  1HUC B;  3K24 A;  3N4C A;  2WBF X;  1MEM A;  1NB3 A;  3IUT A;  2CIO A;  2OZ2 A;  3HD3 A;  3OQC A;  3B79 A;  3K8U A;  3ZUA A;  1TL9 A;  3PHU A;  3HHI A;  3OVZ A;  4CDE B;  2DOS A;  4YYQ A;  2IBI A;  2ARY A;  3BBA A;  3BCN A;  5CHV A;  3TRK A;  4YYV A;  3H8C A;  1QDQ A;  4YYR A;  1YK8 A;  4CDF B;  1GCB A;  1MEG A;  3KWB X;  4OVZ A;  4WUR A;  1Y4H A;  4P16 A;  5CVM A;  4N4Z A;  3LFY A;  1NL6 A;  4D8E A;  4OW0 A;  2Y6E A;  3H8B A;  4PP1 A;  4IP3 A;  2C0Y A;  3I3T A;  4BPV A;  1U9W A;  4OEM A;  1ITO A;  2OUL A;  4QRV A;  1CVZ A;  2HHN A;  5EZQ A;  1CV8 A;  2R9N A;  4MZO A;  1YK7 A;  2Y5B A;  2R6N A;  1O0E A;  4MM3 B;  4BOS A;  2OP3 A;  4IUM A;  2XU3 A;  1DKI A;  1AU3 A;  3CBJ A;  1PAD A;  1U5I A;  3N3G A;  2HWK A;  3KX1 A;  2R9F A;  4X6H A;  2PBH A;  3V6C A;  2YJ9 A;  4BSQ A;  2FO5 A;  3PSE A;  4MZS A;  2YJ2 A;  2DCC A;  3IHP A;  1CTE A;  3KKU A;  4BQV A;  1SP4 B;  3HWN A;  1PPN A;  2AIM A;  3QJ3 A;  3IFU A;  3WXG A;  3H7D A;  4QRX A;  2AUX A;  2BDL A;  1YZB A;  4I05 A;  3AI8 A;  4BOU A;  5CHT A;  4MSX A;  1CPJ A;  1KFX L;  1ZCM A;  4I04 A;  1UKF A;  2HXZ A;  2YJB A;  1U9X A;  2DCB A;  4Q8H A;  1VSN A;  2DC7 A;  4CDD B;  1AU2 A;  2CB5 A;  2DC9 A;  1AYW A;  3ERV A;  2AS8 A;  1CB5 A;  4RNA A;  2ACT A;  3O65 A;  3U8E A;  2GHU A;  1PPP A;  3OVX A;  4D8B A;  3KFQ A;  2AGA A;  2FRA A;  4BOP A;  1AYV A;  2DJF B;  3MHH A;  1BQI A;  3W30 A;  1PPD A;  3C9E A;  3F5V A;  1QXP A;  4M0W A;  3MHS A;  2YJC A;  1PXV A;  4X6J A;  1MHW A;  3RVX A;  1Y08 A;  4AXL A;  2VHF A;  1MIR A;  3KW9 A;  3MP2 A;  1POP A;  3QT4 A;  4RKX A;  2H7J A;  3CH2 X;  2NQA A;  1CS8 A;  4D8I A;  3IEJ A;  3QSD A;  1THE A;  4W4U A;  2F7D A;  1DEU A;  2HH5 A;  3P5V A;  9PAP A;  1PCI A;  3IMA A;  2AVW A;  2G7Y A;  2ATO A;  1IWD A;  2E00 A;  2J7Q A;  4XZX A;  2FT2 A;  2G6D A;  1S4V A;  2AYO A;  3BWK A;  2FTD A;  3CH3 X;  5CVO B;  2PAD A;  3PDF A;  5JA7 A;  4W5C A;  4AXM A;  2P7U A;  3IOQ A;  2R9O A;  5J94 A;  2AUZ A;  3PRP A;  1PPO A;  2JQF R;  3W31 A;  1CSB B;  4PP2 E;  5F02 A;  5CVN B;  1YT7 A;  3GCB A;  2FYE A;  2J7Q C;  4PT5 A;  1AU4 A;  1VJV A;  1PE6 A;  4ZUX U;  2DZY A;  1BGO A;  1ATK A;  3P5X A;  2P0R A;  4DMX A;  3MJ5 A;  2R9C A;  3USV A;  3KWZ A;  2BU3 A;  1F29 A;  1SNK A;  3F75 A;  4N8W A;  2DCD A;  3D6S A;  3PBH A;  1CJL A;  2DCA A;  6PAD A;  2NQG A;  2FQ9 A;  3BPM A;  1JQP A;  3H89 A;  8PCH A;  2UZJ A;  3BOW A;  4BOZ A;  1BP4 A;  4RF1 A;  1AEC A;  3TNX A;  3O1G A;  4OVZ B;  2GFO A;  2XU1 A;  4BS6 A;  1EWL A;  4Q8G A;  1NPZ A;  1M6D A;  1K3B B;  2DC6 A;  4YVA A;  1A6R A;  4YYS A;  4N79 A;  3H6S A;  4QRG A;  4FIP A;  4G54 A;  4W5B A;  1EF7 A;  3PHW A;  2NQI A;  2P86 A;  3E9S A;  2BTW B;  1ME4 A;  2R9M A;  4WA6 A;  3P5U A;  3PHX A;  4K7C A;  3S3R A;  4RY2 A;  1YVB A;  3LXS A;  5K16 A;  3TMP A;  1PBH A;  3DF0 A;  2FUD A;  4GUA A;  1MS6 A;  2G8J A;  4XR7 A;  3RVW A;  5E6J A;  1ME3 A;  2Z84 A;  1QOL A;  3BB7 A;  3OF9 A;  1GLO A;  4OEL A;  5EGW A;  1F2A A;  3O0U A;  4KLB A;  1Q6K A;  1EWP A;  3K9M A;  1F2B A;  3BY4 A;  4CDC B;  4CZW A;  2B1N A;  1U9Q X;  3MOR A;  4RF0 A;  2JRI A;  4MI7 A;  1FH0 A;  2FRQ A;  2JTC A;  2E01 A;  3WXF A;  3I06 A;  1PVJ A;  5A24 A;  1QMY A;  1KXR A;  4DMY A;  4PAD A;  4X6I A;  3PT2 A;  5KO3 A;  3HHA A;  2G8E A;  3P5W A;  3OF8 A;  3MTN A;  1KFU L;  3N3K A;  2DZZ A;  1GMY A;  3CBK A;  3RVV A;  3OIS A;  1AIM A;  4YYW A;  4P6E A;  1NQC A;  1ICF A;  1CQD A;  2DJG B;  1AYU A;  4R3D A;  2NQD B;  4REZ A;  1EWO A;  4P6G A;  1TLO A;  3PRM A;  4YYU A;  3NHE A;  3E1Z B;  4FJC A;  2DC8 A;  1U9V A;  1KHP A;  2E02 A;  1AU0 A;  2PNS A;  3V6E A;  2YJ8 A;  4BS5 A;  2HD5 A;  3B21 A;  2FE8 A;  2XU5 A;  1DF0 A;  2PRE A;  4YV8 A;  7PCK A;  1F2C A;  3PNR A;  3C0R A;  4PI3 A;  1PIP A;  1MDW A;  4QBB A;  4XUI A;  1GEC E;  5PAD A;  3PW3 A;  1NLJ A;  1YAL A;  2B1M A;  2AYN A;  3M99 A;  5JZE A;  3BPF A;  2BDZ A;  3IV2 A;  4FK5 A;  4A5U A;  5EF4 A;  1ZIV A;  1NB5 A;  2AU1 A;  2XU4 A;  2BTW A;  1STF E;  1BY8 A;  1XKG A;  2VHS A;  4QH6 A;  4I07 A;  2O6X A;  3BC3 A;  2E03 A;  2IPP B;  3RNV A;  3KSE A;  1KHQ A;  3S3Q A;  4BOQ A;  3MTV A;  3ZNH A; 
#chains in the Genus database with same CATH homology
 2DOS A;  3IFU A;  3TMP A;  3MJ5 A;  4RNA A;  3BBA A;  3BY4 A;  3O65 A;  2HWK A;  3PRP A;  1YZB A;  4GUA A;  3TRK A;  4D8B A;  5JZE A;  4HXD B;  2AGA A;  4ZTB A;  4BOU A;  2BU3 A;  3MP2 A;  5EZS A;  4A5U A;  3W31 A;  4BOP A;  4RKX A;  5EZQ A;  5KO3 A;  4RF0 A;  2J7Q A;  4XZX A;  2JRI A;  3B21 A;  2FE8 A;  4MI7 A;  4OVZ A;  3W30 A;  4D8I A;  2JTC A;  4WUR A;  1UKF A;  2BTW A;  3PHW A;  4P16 A;  3PSE A;  5E6J A;  1PVJ A;  2Z84 A;  3BB7 A;  2J7Q C;  4R3D A;  4D8E A;  4PT5 A;  3E9S A;  2BTW B;  3C0R A;  3OQC A;  4M0W A;  4MM3 B;  4OW0 A;  4REZ A;  4BOS A;  2UZJ A;  4BOZ A;  3PRM A;  4IP3 A;  4IUM A;  4RF1 A;  3RNV A;  1DKI A;  3PHX A;  4BOQ A;  4OVZ B;  3PHU A;  3MTV A;  3PT2 A;  3ZNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...