4A5UA

Turnip yellow mosaic virus proteinase and escherichia coli 30s ribosomal s15
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
148
Chain Sequence
b'LPAPLTNDPTAIGPVLPFEELHPRRYPENTATFLTRLRSLPSNHLPQPTLNCLLSAVSDQTKVSEEHLWESLQTILPDSQLSNEETNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPPSHFSPGKRLLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA REPLICASE POLYPROTEIN
publication title A Compact Viral Processing Proteinase/Ubiquitin Hydrolase from the Otu Family.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Transferase/rna binding protein
total genus 49
structure length 148
sequence length 148
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.100 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4a5uA00
4A5UA
chains in the Genus database with same CATH superfamily
3K9MA 1CS8A 4Q8HA 4IUMA 4CDCB 2NQGA 4XUIA 1O0EA 1PIPA 2GHUA 2PREA 3IMAA 2JQGR 5JZEA 1ME3A 1CJLA 2ATOA 3F75A 1KHQA 4HWYA 1GCBA 1U9XA 4GUAA 1F2CA 3NHEA 1AU3A 3BWKA 1S4VA 4A5UA 1NLJA 3S3RA 1IWDA 2AUXA 5EGWA 2DC6A 2E01A 3WXGA 4N4ZA 1QOLA 1TLOA 3W30A 3BPFA 3N4CA 2B1NA 4MI7A 3E9SA 3WXEA 1PPNA 2HH5A 2FTDA 3KWBX 4BSQA 1DF0A 4ZTBA 1YK8A 4OW0A 2C0YA 1U9QX 1NQCA 1AYWA 2R9CA 3U8EA 2PNSA 2WBFX 5K16A 3PHWA 1STFE 2O6XA 3QSDA 1GMYA 3PHUA 1AU4A 4I07A 4QBBA 2YJ8A 1AU0A 1EWMA 2UZJA 1F2AA 3RVWA 3IFUA 3K24A 4BOUA 2NQDB 3BC3A 1NPZA 2AGAA 1PBHA 3OF9A 3N3GA 2B1MA 1FH0A 4PT5A 4OELA 2FT2A 3C0RA 4W4UA 2XU1A 1TU6A 3KKUA 3D6SA 4YV8A 4MZOA 3H6SA 5EF4A 3WXFA 2FRAA 4YYVA 1NL6A 5J94A 3PDFA 1PPPA 2DJGB 2HHNA 2XU5A 1MIRA 2DC8A 1M6DA 1YZBA 2AVWA 2P0RA 1QMYA 1KXRA 1CTEA 3H89A 1PPDA 4D8IA 2IPPB 4CZWA 3MJ5A 3MHSA 4MM3B 3ZNHA 4PADA 3RVXA 2E03A 2BDLA 1QDQA 4IP3A 1BQIA 4BS5A 5CHTA 4QRXA 5EZQA 4D8EA 2XU3A 4WA6A 1UKFA 3PT2A 4P6GA 1VSNA 7PCKA 3QJ3A 2R9FA 3PNRA 1ME4A 2IBIA 3S3QA 2YJ2A 1QXPA 2FRQA 4BOZA 4D8BA 3HHAA 5JA7A 2AU1A 4P6EA 3PRPA 4N8WA 4XZXA 2JQFR 4BS6A 5EZSA 3H8CA 3E1ZB 4CDFB 1NB5A 1ZCMA 1CPJA 4PP2E 2G7YA 3MP2A 3BY4A 3BOWA 2F1GA 3HHIA 4AXLA 1PCIA 2FO5A 2R9NA 4CDEB 2J7QC 3HWNA 3V6EA 3AI8A 2NQAA 1EWOA 3O1GA 2JTCA 2BDZA 2ACTA 3LXSA 2OULA 4RF0A 1Y4HA 2HXZA 1KFXL 2R9OA 2FYEA 1U9WA 4YYSA 1K3BB 2AS8A 3CH3X 2DCAA 3KX1A 1A6RA 1ATKA 4R3DA 2E02A 5E6JA 3N3KA 4I05A 3PHXA 5A24A 3OVZA 2GFOA 4XR7A 2FE8A 1BY8A 3IUTA 5PADA 6PADA 2OZ2A 3QT4A 3BBAA 3KFQA 1CSBB 4K7CA 4OEMA 3I06A 2YJCA 3C9EA 1AYVA 2VHFA 3M99A 2G6DA 3H7DA 1PVJA 3IEJA 2BTWA 2G8JA 3MORA 3KSEA 3B79A 3ERVA 1YVBA 1ICFA 1AU2A 4PI3A 4OVZB 1BGOA 3P5UA 1PE6A 8PCHA 4RF1A 2DJFB 4OVZA 4G54A 3H8BA 2HD5A 2YJBA 2PBHA 3I3TA 1DEUA 4YYQA 5F02A 1GLOA 2NQIA 3OISA 1MHWA 4FK5A 3O65A 3GCBA 1U9VA 1EWPA 2DC9A 1PADA 1GECE 1MDWA 4YYRA 1Q6KA 3CH2X 1ITOA 1XKGA 2YJ9A 1X9YA 4BOQA 1PPOA 3F5VA 4X6JA 1AIMA 3B21A 2AUZA 1MEGA 4YVAA 1Y08A 4N79A 4KLBA 3IV2A 2PADA 4RY2A 3KW9A 3CBJA 2JRIA 1YT7A 4BOSA 1TL9A 4REZA 1SNKA 1SP4B 2Y6EA 3OQCA 3OVXA 2DCCA 9PAPA 3ZUAA 2P86A 4W5BA 5CVMA 1YK7A 1DKIA 3PRMA 2FQ9A 1THEA 3IOQA 2AYOA 4MZSA 3P5XA 3PW3A 2J7QA 4CDDB 3DF0A 3O0UA 5CHVA 5CVNB 1F29A 1VJVA 4BOPA 4BQVA 3BCNA 4P16A 3W31A 4QRGA 3TNXA 3P5VA 1KFUL 2G8EA 3TMPA 4X6IA 3P5WA 1CVZA 4MSXA 4YYWA 2AYNA 1BP4A 2BU3A 3K8UA 2R9MA 4QH6A 1CQDA 2DOSA 1CV8A 2HWKA 4Q8GA 1F2BA 3PSEA 1YALA 5JH3A 3LFYA 2ARYA 4QRVA 2CB5A 2P7UA 3IHPA 5KO3A 2DCBA 1U5IA 1CB5A 2BTWB 3TRKA 3BPMA 3RNVA 3PBHA 4PP1A 2E00A 1HUCB 3BB7A 4YYUA 4BPVA 4DMYA 2FUDA 3MHHA 4FJCA 4M0WA 1AECA 4W5CA 3KWZA 4AXMA 2OP3A 4X6HA 5CVOB 2DCDA 1NB3A 4HXDB 2CIOA 3V6CA 1AYUA 4ZUXU 1MEMA 1EF7A 2DC7A 3HD3A 5FPWA 2DZYA 3CBKA 1PXVA 4RNAA 2XU4A 1KHPA 2VHSA 1JQPA 2AIMA 1POPA 1ZIVA 4DMXA 2DZZA 3MTNA 2Y5BA 1MS6A 2H7JA 4RKXA 3USVA 3OF8A 4FIPA 4I04A 4WURA 3MTVA 2Z84A 3RVVA 2R6NA 1EWLA 2F7DA
chains in the Genus database with same CATH topology
1YZBA 4IUMA 3TMPA 5JZEA 1PVJA 4D8IA 2BTWA 2BU3A 4GUAA 3MJ5A 4MM3B 3ZNHA 2DOSA 4OVZB 4A5UA 2HWKA 4RF1A 3PSEA 4IP3A 4OVZA 5EZQA 4D8EA 5KO3A 3W30A 1UKFA 2BTWB 3PT2A 3TRKA 4MI7A 3E9SA 3RNVA 4ZTBA 3BB7A 3O65A 4OW0A 3PHWA 4BOZA 4D8BA 3PHUA 4M0WA 3PRPA 4BOQA 4XZXA 5EZSA 3B21A 2UZJA 3IFUA 4HXDB 3MP2A 4BOUA 3BY4A 2AGAA 2JRIA 4BOSA 2J7QC 4REZA 2JTCA 3OQCA 4PT5A 3C0RA 4RNAA 4RF0A 1DKIA 3PRMA 2J7QA 4R3DA 4RKXA 5E6JA 3PHXA 4WURA 4BOPA 2FE8A 3MTVA 2Z84A 4P16A 3W31A 3BBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5U A; 
#chains in the Genus database with same CATH topology
 3K9M A;  1CS8 A;  4Q8H A;  4IUM A;  4CDC B;  2NQG A;  4XUI A;  1O0E A;  1PIP A;  2GHU A;  2PRE A;  3IMA A;  2JQG R;  5JZE A;  1ME3 A;  1CJL A;  2ATO A;  3F75 A;  1KHQ A;  4HWY A;  1GCB A;  1U9X A;  4GUA A;  1F2C A;  3NHE A;  1AU3 A;  3BWK A;  1S4V A;  4A5U A;  1NLJ A;  3S3R A;  1IWD A;  2AUX A;  5EGW A;  2DC6 A;  2E01 A;  3WXG A;  4N4Z A;  1QOL A;  1TLO A;  3W30 A;  3BPF A;  3N4C A;  2B1N A;  4MI7 A;  3E9S A;  3WXE A;  1PPN A;  2HH5 A;  2FTD A;  3KWB X;  4BSQ A;  1DF0 A;  4ZTB A;  1YK8 A;  4OW0 A;  2C0Y A;  1U9Q X;  1NQC A;  1AYW A;  2R9C A;  3U8E A;  2PNS A;  2WBF X;  5K16 A;  3PHW A;  1STF E;  2O6X A;  3QSD A;  1GMY A;  3PHU A;  1AU4 A;  4I07 A;  4QBB A;  2YJ8 A;  1AU0 A;  1EWM A;  2UZJ A;  1F2A A;  3RVW A;  3IFU A;  3K24 A;  4BOU A;  2NQD B;  3BC3 A;  1NPZ A;  2AGA A;  1PBH A;  3OF9 A;  3N3G A;  2B1M A;  1FH0 A;  4PT5 A;  4OEL A;  2FT2 A;  3C0R A;  4W4U A;  2XU1 A;  1TU6 A;  3KKU A;  3D6S A;  4YV8 A;  4MZO A;  3H6S A;  5EF4 A;  3WXF A;  2FRA A;  4YYV A;  1NL6 A;  5J94 A;  3PDF A;  1PPP A;  2DJG B;  2HHN A;  2XU5 A;  1MIR A;  2DC8 A;  1M6D A;  1YZB A;  2AVW A;  2P0R A;  1QMY A;  1KXR A;  1CTE A;  3H89 A;  1PPD A;  4D8I A;  2IPP B;  4CZW A;  3MJ5 A;  3MHS A;  4MM3 B;  3ZNH A;  4PAD A;  3RVX A;  2E03 A;  2BDL A;  1QDQ A;  4IP3 A;  1BQI A;  4BS5 A;  5CHT A;  4QRX A;  5EZQ A;  4D8E A;  2XU3 A;  4WA6 A;  1UKF A;  3PT2 A;  4P6G A;  1VSN A;  7PCK A;  3QJ3 A;  2R9F A;  3PNR A;  1ME4 A;  2IBI A;  3S3Q A;  2YJ2 A;  1QXP A;  2FRQ A;  4BOZ A;  4D8B A;  3HHA A;  5JA7 A;  2AU1 A;  4P6E A;  3PRP A;  4N8W A;  4XZX A;  2JQF R;  4BS6 A;  5EZS A;  3H8C A;  3E1Z B;  4CDF B;  1NB5 A;  1ZCM A;  1CPJ A;  4PP2 E;  2G7Y A;  3MP2 A;  3BY4 A;  3BOW A;  2F1G A;  3HHI A;  4AXL A;  1PCI A;  2FO5 A;  2R9N A;  4CDE B;  2J7Q C;  3HWN A;  3V6E A;  3AI8 A;  2NQA A;  1EWO A;  3O1G A;  2JTC A;  2BDZ A;  2ACT A;  3LXS A;  2OUL A;  4RF0 A;  1Y4H A;  2HXZ A;  1KFX L;  2R9O A;  2FYE A;  1U9W A;  4YYS A;  1K3B B;  2AS8 A;  3CH3 X;  2DCA A;  3KX1 A;  1A6R A;  1ATK A;  4R3D A;  2E02 A;  5E6J A;  3N3K A;  4I05 A;  3PHX A;  5A24 A;  3OVZ A;  2GFO A;  4XR7 A;  2FE8 A;  1BY8 A;  3IUT A;  5PAD A;  6PAD A;  2OZ2 A;  3QT4 A;  3BBA A;  3KFQ A;  1CSB B;  4K7C A;  4OEM A;  3I06 A;  2YJC A;  3C9E A;  1AYV A;  2VHF A;  3M99 A;  2G6D A;  3H7D A;  1PVJ A;  3IEJ A;  2BTW A;  2G8J A;  3MOR A;  3KSE A;  3B79 A;  3ERV A;  1YVB A;  1ICF A;  1AU2 A;  4PI3 A;  4OVZ B;  1BGO A;  3P5U A;  1PE6 A;  8PCH A;  4RF1 A;  2DJF B;  4OVZ A;  4G54 A;  3H8B A;  2HD5 A;  2YJB A;  2PBH A;  3I3T A;  1DEU A;  4YYQ A;  5F02 A;  1GLO A;  2NQI A;  3OIS A;  1MHW A;  4FK5 A;  3O65 A;  3GCB A;  1U9V A;  1EWP A;  2DC9 A;  1PAD A;  1GEC E;  1MDW A;  4YYR A;  1Q6K A;  3CH2 X;  1ITO A;  1XKG A;  2YJ9 A;  1X9Y A;  4BOQ A;  1PPO A;  3F5V A;  4X6J A;  1AIM A;  3B21 A;  2AUZ A;  1MEG A;  4YVA A;  1Y08 A;  4N79 A;  4KLB A;  3IV2 A;  2PAD A;  4RY2 A;  3KW9 A;  3CBJ A;  2JRI A;  1YT7 A;  4BOS A;  1TL9 A;  4REZ A;  1SNK A;  1SP4 B;  2Y6E A;  3OQC A;  3OVX A;  2DCC A;  9PAP A;  3ZUA A;  2P86 A;  4W5B A;  5CVM A;  1YK7 A;  1DKI A;  3PRM A;  2FQ9 A;  1THE A;  3IOQ A;  2AYO A;  4MZS A;  3P5X A;  3PW3 A;  2J7Q A;  4CDD B;  3DF0 A;  3O0U A;  5CHV A;  5CVN B;  1F29 A;  1VJV A;  4BOP A;  4BQV A;  3BCN A;  4P16 A;  3W31 A;  4QRG A;  3TNX A;  3P5V A;  1KFU L;  2G8E A;  3TMP A;  4X6I A;  3P5W A;  1CVZ A;  4MSX A;  4YYW A;  2AYN A;  1BP4 A;  2BU3 A;  3K8U A;  2R9M A;  4QH6 A;  1CQD A;  2DOS A;  1CV8 A;  2HWK A;  4Q8G A;  1F2B A;  3PSE A;  1YAL A;  5JH3 A;  3LFY A;  2ARY A;  4QRV A;  2CB5 A;  2P7U A;  3IHP A;  5KO3 A;  2DCB A;  1U5I A;  1CB5 A;  2BTW B;  3TRK A;  3BPM A;  3RNV A;  3PBH A;  4PP1 A;  2E00 A;  1HUC B;  3BB7 A;  4YYU A;  4BPV A;  4DMY A;  2FUD A;  3MHH A;  4FJC A;  4M0W A;  1AEC A;  4W5C A;  3KWZ A;  4AXM A;  2OP3 A;  4X6H A;  5CVO B;  2DCD A;  1NB3 A;  4HXD B;  2CIO A;  3V6C A;  1AYU A;  4ZUX U;  1MEM A;  1EF7 A;  2DC7 A;  3HD3 A;  5FPW A;  2DZY A;  3CBK A;  1PXV A;  4RNA A;  2XU4 A;  1KHP A;  2VHS A;  1JQP A;  2AIM A;  1POP A;  1ZIV A;  4DMX A;  2DZZ A;  3MTN A;  2Y5B A;  1MS6 A;  2H7J A;  4RKX A;  3USV A;  3OF8 A;  4FIP A;  4I04 A;  4WUR A;  3MTV A;  2Z84 A;  3RVV A;  2R6N A;  1EWL A;  2F7D A; 
#chains in the Genus database with same CATH homology
 1YZB A;  4IUM A;  3TMP A;  5JZE A;  1PVJ A;  4D8I A;  2BTW A;  2BU3 A;  4GUA A;  3MJ5 A;  4MM3 B;  3ZNH A;  2DOS A;  4OVZ B;  4A5U A;  2HWK A;  4RF1 A;  3PSE A;  4IP3 A;  4OVZ A;  5EZQ A;  4D8E A;  5KO3 A;  3W30 A;  1UKF A;  2BTW B;  3PT2 A;  3TRK A;  4MI7 A;  3E9S A;  3RNV A;  4ZTB A;  3BB7 A;  3O65 A;  4OW0 A;  3PHW A;  4BOZ A;  4D8B A;  3PHU A;  4M0W A;  3PRP A;  4BOQ A;  4XZX A;  5EZS A;  3B21 A;  2UZJ A;  3IFU A;  4HXD B;  3MP2 A;  4BOU A;  3BY4 A;  2AGA A;  2JRI A;  4BOS A;  2J7Q C;  4REZ A;  2JTC A;  3OQC A;  4PT5 A;  3C0R A;  4RNA A;  4RF0 A;  1DKI A;  3PRM A;  2J7Q A;  4R3D A;  4RKX A;  5E6J A;  3PHX A;  4WUR A;  4BOP A;  2FE8 A;  3MTV A;  2Z84 A;  4P16 A;  3W31 A;  3BBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...