1YT7A

Cathepsin k complexed with a constrained ketoamide inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
PDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title P(2)-P(3) conformationally constrained ketoamide-based inhibitors of cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yt7A00
2E02A 2C0YA 1PPOA 2FT2A 4N79A 2PNSA 2DJFB 2ARYA 1X9YA 3S3RA 2BDZA 3KW9A 3TNXA 1KHQA 3MTNA 1QXPA 2FTDA 3O0UA 3BCNA 3IMAA 1KXRA 1PCIA 4CDFB 2G6DA 3K24A 1U9XA 1CS8A 2R9OA 2R9FA 4P6EA 3BOWA 2XU5A 2OULA 1MHWA 3P5VA 1KHPA 1CV8A 4YVAA 3U8EA 4W5BA 3CBKA 3USVA 1M6DA 1ITOA 1TLOA 2AU1A 2OP3A 3OISA 1NQCA 2OZ2A 1DF0A 1ME4A 2NQGA 3QT4A 5FPWA 1MEMA 1NB5A 1KFUL 1ME3A 4BS6A 1YT7A 5A24A 3MORA 3IEJA 2WBFX 4I04A 3H8CA 3K9MA 1F29A 2DC8A 4YYSA 2P7UA 1K3BB 1GLOA 1IWDA 5EF4A 1MEGA 2R9NA 4N4ZA 4BS5A 5CVNB 4OEMA 4QH6A 4BSQA 1AYWA 3KX1A 3CH3X 4KLBA 1NB3A 1YK7A 2DCAA 4YYQA 1YVBA 2FQ9A 5CHVA 2FYEA 2P0RA 2FRAA 4RY2A 3IHPA 2YJ9A 2PREA 3E1ZB 1A6RA 4QRVA 2YJCA 3IUTA 1O0EA 2R9CA 1HUCB 1EWPA 2Y5BA 2FO5A 4YYWA 3O1GA 3PBHA 4YYRA 1Y08A 4QRXA 2XU4A 1AU0A 1S4VA 2JQFR 4W4UA 3H7DA 4X6IA 2NQIA 1PPDA 1CB5A 1FH0A 3BC3A 3I3TA 2AVWA 1U5IA 2GHUA 3LXSA 3KWZA 1PIPA 4QRGA 4MSXA 1KFXL 2NQDB 2O6XA 1F2AA 3IV2A 1YK8A 3K8UA 3LFYA 4PI3A 4PP2E 3N3GA 2DZYA 1BY8A 1Q6KA 1AYVA 3C9EA 3QJ3A 1TL9A 3HHAA 2HHNA 2Y6EA 5JA7A 3RVVA 1CVZA 2R9MA 2AUZA 3DF0A 5K16A 4Q8HA 1AU2A 1F2BA 2G7YA 1BP4A 3MHHA 4PP1A 1CPJA 5CVMA 2P86A 3CH2X 3BPMA 3PNRA 4I07A 2DC6A 2G8JA 4FJCA 5CHTA 3V6EA 1SP4B 2E00A 1NPZA 3N3KA 3M99A 2DC9A 2AS8A 1U9QX 3D6SA 2BDLA 1EWLA 3H89A 5JH3A 1NLJA 1U9WA 2DC7A 3ZUAA 9PAPA 1ICFA 4AXMA 1NL6A 1CQDA 3IOQA 4K7CA 4W5CA 4XR7A 4OELA 3PW3A 3H8BA 1GECE 1MIRA 1PPPA 3QSDA 1XKGA 4CDDB 4X6HA 2CB5A 4PADA 1STFE 3OF8A 1MS6A 1F2CA 4I05A 3RVWA 1POPA 3KFQA 2JQGR 3KKUA 2PADA 6PADA 1VJVA 3KSEA 4X6JA 1PADA 1EWOA 2YJBA 4MZOA 3RVXA 1VSNA 4FK5A 5CVOB 3WXFA 3OVXA 5EGWA 1PPNA 3F75A 3F5VA 1GCBA 1PE6A 4BPVA 1MDWA 1BGOA 2XU1A 2E01A 3P5UA 1AYUA 1ZCMA 1QDQA 3MHSA 2HH5A 5F02A 3P5XA 2AUXA 1QOLA 4P6GA 2ATOA 4Q8GA 4YV8A 4FIPA 1SNKA 3KWBX 3OVZA 1CTEA 2DCDA 1AU3A 2B1NA 2IBIA 3H6SA 4G54A 3BWKA 3WXEA 1CJLA 1JQPA 3B79A 3NHEA 3P5WA 3V6CA 1AIMA 3OF9A 2VHFA 4MZSA 4CZWA 2AIMA 3HHIA 2H7JA 4WA6A 3HWNA 2R6NA 4YYVA 3PDFA 2ACTA 2G8EA 2GFOA 1ZIVA 3AI8A 1AU4A 2AYNA 3WXGA 4CDCB 4DMXA 4YYUA 1ATKA 3CBJA 2VHSA 7PCKA 4QBBA 4DMYA 4N8WA 2B1MA 4BQVA 2DCBA 2AYOA 2PBHA 2FUDA 2DJGB 4AXLA 1AECA 1PBHA 1GMYA 2F1GA 1EF7A 2HD5A 4ZUXU 1CSBB 5J94A 1BQIA 3I06A 1THEA 3S3QA 4XUIA 1QMYA 1PXVA 2CIOA 2DZZA 1TU6A 2NQAA 3ERVA 1U9VA 2FRQA 1EWMA 2DCCA 2HXZA 3GCBA 2YJ8A 4HWYA 4CDEB 1YALA 1DEUA 2IPPB 5PADA 2XU3A 3N4CA 3HD3A 2E03A 2YJ2A 3BPFA 8PCHA 1Y4HA 2F7DA
chains in the Genus database with same CATH superfamily
2E02A 2C0YA 1PPOA 2FT2A 3PRMA 4N79A 2PNSA 2DJFB 3PT2A 2ARYA 1X9YA 3S3RA 2BDZA 3KW9A 3TNXA 1KHQA 3MTNA 1QXPA 3BY4A 4BOUA 2FTDA 3O0UA 3BCNA 3IMAA 1KXRA 1PCIA 4CDFB 2G6DA 3K24A 1U9XA 1CS8A 2R9OA 4RKXA 2R9FA 4P6EA 3BOWA 2XU5A 2OULA 1MHWA 3P5VA 1DKIA 1KHPA 1CV8A 2FE8A 4YVAA 3U8EA 4W5BA 2Z84A 3CBKA 3USVA 1M6DA 1ITOA 1TLOA 2AU1A 2OP3A 3OISA 1NQCA 2OZ2A 4P16A 1DF0A 1ME4A 2NQGA 3PHUA 3QT4A 3IFUA 5FPWA 1MEMA 1NB5A 1KFUL 1ME3A 4BS6A 1YT7A 5A24A 3MORA 3IEJA 2WBFX 4I04A 3H8CA 2BTWA 3K9MA 1F29A 2DC8A 4YYSA 4IP3A 2P7UA 1K3BB 1GLOA 1IWDA 5EF4A 1MEGA 2R9NA 5E6JA 4N4ZA 4BS5A 5CVNB 4OEMA 4QH6A 4BSQA 1AYWA 3KX1A 3CH3X 4KLBA 1YZBA 1NB3A 2J7QC 1YK7A 4R3DA 2DCAA 4YYQA 1YVBA 2FQ9A 4PT5A 5CHVA 2FYEA 2P0RA 2FRAA 4RY2A 3IHPA 3OQCA 2YJ9A 2PREA 3E1ZB 1A6RA 4QRVA 2YJCA 3IUTA 1O0EA 2R9CA 1HUCB 1EWPA 2Y5BA 5JZEA 2FO5A 4YYWA 3O1GA 3PBHA 4YYRA 1Y08A 4QRXA 4RF0A 2XU4A 1AU0A 1S4VA 2JQFR 4W4UA 3H7DA 3C0RA 4X6IA 2NQIA 1PPDA 1CB5A 1FH0A 3BC3A 3I3TA 2AVWA 1U5IA 2GHUA 3LXSA 1UKFA 2UZJA 3KWZA 1PIPA 4QRGA 4MSXA 1KFXL 2NQDB 3PHWA 4HXDB 2O6XA 3BBAA 1F2AA 4BOZA 3IV2A 1YK8A 3K8UA 3LFYA 4PI3A 4PP2E 3N3GA 2DZYA 1BY8A 1Q6KA 1AYVA 3C9EA 3QJ3A 1TL9A 3HHAA 2HHNA 2Y6EA 5JA7A 3RVVA 1CVZA 2R9MA 2AUZA 3DF0A 5K16A 3PHXA 4Q8HA 1AU2A 1F2BA 2G7YA 1BP4A 2BTWB 3MHHA 4PP1A 1CPJA 4RF1A 5CVMA 2P86A 3CH2X 3BPMA 3PNRA 4I07A 4BOSA 2DC6A 2G8JA 4FJCA 5CHTA 3V6EA 1SP4B 2E00A 3PRPA 4ZTBA 1NPZA 3N3KA 3M99A 4MI7A 2DC9A 2AS8A 1U9QX 3D6SA 2BDLA 1EWLA 3H89A 5KO3A 2AGAA 5EZQA 5JH3A 1NLJA 1U9WA 2DC7A 3ZUAA 9PAPA 3PSEA 1ICFA 4AXMA 4OW0A 1NL6A 3O65A 1CQDA 3IOQA 4K7CA 2J7QA 4W5CA 4XR7A 4OELA 3PW3A 3H8BA 1GECE 4D8EA 1MIRA 1PPPA 3E9SA 3QSDA 1XKGA 4CDDB 4X6HA 2CB5A 4PADA 1STFE 3OF8A 1MS6A 1F2CA 2BU3A 4I05A 3RVWA 1POPA 3KFQA 2JQGR 3KKUA 2PADA 6PADA 2JTCA 4MM3B 1VJVA 3KSEA 4X6JA 1PADA 1EWOA 2YJBA 3MJ5A 4MZOA 3RVXA 1VSNA 4FK5A 4XZXA 5CVOB 3TMPA 3WXFA 3OVXA 5EGWA 3W30A 1PVJA 1PPNA 3F75A 3F5VA 1GCBA 1PE6A 4BPVA 1MDWA 1BGOA 2XU1A 2E01A 3P5UA 1AYUA 1ZCMA 1QDQA 3MP2A 3MHSA 2HH5A 5F02A 5EZSA 3P5XA 2AUXA 1QOLA 4GUAA 4P6GA 2ATOA 4OVZA 4Q8GA 3MTVA 4YV8A 4FIPA 3TRKA 1SNKA 3KWBX 4BOQA 4REZA 3OVZA 1CTEA 2DCDA 1AU3A 2B1NA 2IBIA 3H6SA 4G54A 3BWKA 3WXEA 1CJLA 1JQPA 3B79A 3NHEA 3P5WA 3V6CA 2DOSA 1AIMA 3OF9A 2VHFA 3BB7A 4MZSA 4CZWA 4IUMA 4A5UA 4BOPA 2AIMA 3HHIA 2H7JA 3W31A 4WA6A 3HWNA 2R6NA 4YYVA 3PDFA 2ACTA 2G8EA 2GFOA 4RNAA 1ZIVA 3AI8A 1AU4A 2AYNA 3WXGA 4CDCB 4DMXA 4YYUA 1ATKA 4M0WA 4WURA 3CBJA 2VHSA 7PCKA 4QBBA 4DMYA 2HWKA 4N8WA 2B1MA 4BQVA 2DCBA 2AYOA 2PBHA 2FUDA 2DJGB 4AXLA 1AECA 1PBHA 1GMYA 2F1GA 1EF7A 2HD5A 4ZUXU 1CSBB 5J94A 1BQIA 3I06A 1THEA 3S3QA 4XUIA 1QMYA 1PXVA 2CIOA 2JRIA 3ZNHA 2DZZA 1TU6A 2NQAA 4OVZB 3ERVA 1U9VA 2FRQA 1EWMA 3RNVA 2DCCA 4D8BA 2HXZA 3GCBA 2YJ8A 4HWYA 4CDEB 1YALA 1DEUA 2IPPB 5PADA 2XU3A 4D8IA 3N4CA 3HD3A 3B21A 2E03A 2YJ2A 3BPFA 8PCHA 1Y4HA 2F7DA
chains in the Genus database with same CATH topology
2E02A 2C0YA 1PPOA 2FT2A 4N79A 2PNSA 2DJFB 2ARYA 1X9YA 3S3RA 2BDZA 3KW9A 3TNXA 1KHQA 3MTNA 1QXPA 2FTDA 3O0UA 3BCNA 3IMAA 1KXRA 1PCIA 4CDFB 2G6DA 2VFCA 3K24A 1U9XA 1CS8A 2R9OA 3D9WA 2R9FA 4P6EA 3BOWA 2XU5A 2OULA 1MHWA 3P5VA 1KHPA 1CV8A 4YVAA 3U8EA 4W5BA 3CBKA 3USVA 1M6DA 1ITOA 1TLOA 2AU1A 2OP3A 3OISA 1NQCA 2OZ2A 1DF0A 1ME4A 2NQGA 3QT4A 5FPWA 1MEMA 1NB5A 1KFUL 1ME3A 4BS6A 1YT7A 5A24A 3MORA 3IEJA 2WBFX 4I04A 3H8CA 3K9MA 1F29A 2DC8A 4YYSA 2P7UA 1K3BB 1GLOA 1IWDA 5EF4A 1MEGA 2R9NA 4N4ZA 4BS5A 5CVNB 4OEMA 4QH6A 4BSQA 1AYWA 3KX1A 3CH3X 4KLBA 1NB3A 1YK7A 2DCAA 4YYQA 1YVBA 2FQ9A 5CHVA 2FYEA 2P0RA 2FRAA 4RY2A 3IHPA 2YJ9A 2PREA 3E1ZB 1A6RA 4QRVA 2YJCA 3IUTA 1O0EA 2R9CA 1HUCB 1EWPA 2Y5BA 2FO5A 4YYWA 3O1GA 3PBHA 4YYRA 1Y08A 4QRXA 2XU4A 1AU0A 1S4VA 2JQFR 4W4UA 3H7DA 4X6IA 2NQIA 1PPDA 1CB5A 1FH0A 3BC3A 3I3TA 2AVWA 1U5IA 2GHUA 3LXSA 3KWZA 1PIPA 4QRGA 4MSXA 1KFXL 2NQDB 2O6XA 1F2AA 3IV2A 1YK8A 3K8UA 3LFYA 4PI3A 4PP2E 3N3GA 2DZYA 1BY8A 1Q6KA 1AYVA 3C9EA 3QJ3A 1TL9A 3HHAA 2HHNA 2Y6EA 5JA7A 3RVVA 1CVZA 2R9MA 2AUZA 3DF0A 5K16A 4Q8HA 1AU2A 1F2BA 2G7YA 1BP4A 2BSZA 3MHHA 4PP1A 1CPJA 5CVMA 2P86A 3CH2X 3BPMA 3PNRA 4I07A 2DC6A 2G8JA 4FJCA 4C5PA 5CHTA 3V6EA 1SP4B 2E00A 1GX3A 1NPZA 3N3KA 3M99A 2DC9A 2AS8A 1U9QX 3D6SA 2BDLA 1EWLA 3H89A 5JH3A 2VFBA 1NLJA 1U9WA 2DC7A 3ZUAA 9PAPA 1ICFA 4AXMA 1NL6A 1CQDA 3IOQA 4K7CA 4W5CA 4XR7A 4OELA 3PW3A 3H8BA 1GECE 1E2TA 1MIRA 1PPPA 3QSDA 1XKGA 4GUZA 4CDDB 4X6HA 2CB5A 4PADA 1STFE 3OF8A 1MS6A 1F2CA 4I05A 3RVWA 1POPA 3KFQA 2JQGR 3KKUA 2PADA 6PADA 1VJVA 3KSEA 4X6JA 1PADA 1EWOA 2YJBA 4MZOA 3RVXA 1VSNA 1W6FA 4FK5A 5CVOB 3WXFA 3OVXA 5EGWA 1PPNA 3F75A 3F5VA 1GCBA 1PE6A 4BPVA 1MDWA 1BGOA 2XU1A 2E01A 3P5UA 1AYUA 1ZCMA 1QDQA 1W5RA 1W4TA 3MHSA 2HH5A 4B55A 5F02A 3P5XA 2AUXA 1QOLA 4P6GA 2ATOA 4Q8GA 4YV8A 4FIPA 1SNKA 3KWBX 3OVZA 1CTEA 2DCDA 1AU3A 2B1NA 2IBIA 3H6SA 4G54A 3BWKA 3WXEA 1CJLA 1JQPA 3B79A 3LTWA 3NHEA 3P5WA 3V6CA 1AIMA 3OF9A 2VHFA 4MZSA 4CZWA 4BGFA 2AIMA 3HHIA 2H7JA 4WA6A 3HWNA 2R6NA 4YYVA 3PDFA 2ACTA 2G8EA 2GFOA 1ZIVA 3AI8A 1AU4A 2AYNA 3WXGA 4CDCB 4DMXA 4YYUA 1ATKA 4NV7A 3CBJA 4NV8A 2VHSA 7PCKA 4QBBA 4DMYA 4N8WA 2B1MA 4BQVA 2DCBA 2AYOA 2PBHA 2FUDA 2DJGB 4AXLA 1AECA 1PBHA 1GMYA 2F1GA 1EF7A 2HD5A 4ZUXU 1CSBB 5J94A 1BQIA 3I06A 1THEA 3S3QA 4XUIA 1QMYA 1PXVA 2CIOA 2DZZA 1TU6A 2NQAA 3ERVA 1U9VA 2FRQA 1EWMA 2DCCA 2HXZA 3GCBA 2YJ8A 4HWYA 4CDEB 1YALA 1DEUA 2IPPB 5PADA 2XU3A 3N4CA 3HD3A 2E03A 2YJ2A 3BPFA 8PCHA 1Y4HA 2F7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E02 A;  2C0Y A;  1PPO A;  2FT2 A;  4N79 A;  2PNS A;  2DJF B;  2ARY A;  1X9Y A;  3S3R A;  2BDZ A;  3KW9 A;  3TNX A;  1KHQ A;  3MTN A;  1QXP A;  2FTD A;  3O0U A;  3BCN A;  3IMA A;  1KXR A;  1PCI A;  4CDF B;  2G6D A;  3K24 A;  1U9X A;  1CS8 A;  2R9O A;  2R9F A;  4P6E A;  3BOW A;  2XU5 A;  2OUL A;  1MHW A;  3P5V A;  1KHP A;  1CV8 A;  4YVA A;  3U8E A;  4W5B A;  3CBK A;  3USV A;  1M6D A;  1ITO A;  1TLO A;  2AU1 A;  2OP3 A;  3OIS A;  1NQC A;  2OZ2 A;  1DF0 A;  1ME4 A;  2NQG A;  3QT4 A;  5FPW A;  1MEM A;  1NB5 A;  1KFU L;  1ME3 A;  4BS6 A;  1YT7 A;  5A24 A;  3MOR A;  3IEJ A;  2WBF X;  4I04 A;  3H8C A;  3K9M A;  1F29 A;  2DC8 A;  4YYS A;  2P7U A;  1K3B B;  1GLO A;  1IWD A;  5EF4 A;  1MEG A;  2R9N A;  4N4Z A;  4BS5 A;  5CVN B;  4OEM A;  4QH6 A;  4BSQ A;  1AYW A;  3KX1 A;  3CH3 X;  4KLB A;  1NB3 A;  1YK7 A;  2DCA A;  4YYQ A;  1YVB A;  2FQ9 A;  5CHV A;  2FYE A;  2P0R A;  2FRA A;  4RY2 A;  3IHP A;  2YJ9 A;  2PRE A;  3E1Z B;  1A6R A;  4QRV A;  2YJC A;  3IUT A;  1O0E A;  2R9C A;  1HUC B;  1EWP A;  2Y5B A;  2FO5 A;  4YYW A;  3O1G A;  3PBH A;  4YYR A;  1Y08 A;  4QRX A;  2XU4 A;  1AU0 A;  1S4V A;  2JQF R;  4W4U A;  3H7D A;  4X6I A;  2NQI A;  1PPD A;  1CB5 A;  1FH0 A;  3BC3 A;  3I3T A;  2AVW A;  1U5I A;  2GHU A;  3LXS A;  3KWZ A;  1PIP A;  4QRG A;  4MSX A;  1KFX L;  2NQD B;  2O6X A;  1F2A A;  3IV2 A;  1YK8 A;  3K8U A;  3LFY A;  4PI3 A;  4PP2 E;  3N3G A;  2DZY A;  1BY8 A;  1Q6K A;  1AYV A;  3C9E A;  3QJ3 A;  1TL9 A;  3HHA A;  2HHN A;  2Y6E A;  5JA7 A;  3RVV A;  1CVZ A;  2R9M A;  2AUZ A;  3DF0 A;  5K16 A;  4Q8H A;  1AU2 A;  1F2B A;  2G7Y A;  1BP4 A;  3MHH A;  4PP1 A;  1CPJ A;  5CVM A;  2P86 A;  3CH2 X;  3BPM A;  3PNR A;  4I07 A;  2DC6 A;  2G8J A;  4FJC A;  5CHT A;  3V6E A;  1SP4 B;  2E00 A;  1NPZ A;  3N3K A;  3M99 A;  2DC9 A;  2AS8 A;  1U9Q X;  3D6S A;  2BDL A;  1EWL A;  3H89 A;  5JH3 A;  1NLJ A;  1U9W A;  2DC7 A;  3ZUA A;  9PAP A;  1ICF A;  4AXM A;  1NL6 A;  1CQD A;  3IOQ A;  4K7C A;  4W5C A;  4XR7 A;  4OEL A;  3PW3 A;  3H8B A;  1GEC E;  1MIR A;  1PPP A;  3QSD A;  1XKG A;  4CDD B;  4X6H A;  2CB5 A;  4PAD A;  1STF E;  3OF8 A;  1MS6 A;  1F2C A;  4I05 A;  3RVW A;  1POP A;  3KFQ A;  2JQG R;  3KKU A;  2PAD A;  6PAD A;  1VJV A;  3KSE A;  4X6J A;  1PAD A;  1EWO A;  2YJB A;  4MZO A;  3RVX A;  1VSN A;  4FK5 A;  5CVO B;  3WXF A;  3OVX A;  5EGW A;  1PPN A;  3F75 A;  3F5V A;  1GCB A;  1PE6 A;  4BPV A;  1MDW A;  1BGO A;  2XU1 A;  2E01 A;  3P5U A;  1AYU A;  1ZCM A;  1QDQ A;  3MHS A;  2HH5 A;  5F02 A;  3P5X A;  2AUX A;  1QOL A;  4P6G A;  2ATO A;  4Q8G A;  4YV8 A;  4FIP A;  1SNK A;  3KWB X;  3OVZ A;  1CTE A;  2DCD A;  1AU3 A;  2B1N A;  2IBI A;  3H6S A;  4G54 A;  3BWK A;  3WXE A;  1CJL A;  1JQP A;  3B79 A;  3NHE A;  3P5W A;  3V6C A;  1AIM A;  3OF9 A;  2VHF A;  4MZS A;  4CZW A;  2AIM A;  3HHI A;  2H7J A;  4WA6 A;  3HWN A;  2R6N A;  4YYV A;  3PDF A;  2ACT A;  2G8E A;  2GFO A;  1ZIV A;  3AI8 A;  1AU4 A;  2AYN A;  3WXG A;  4CDC B;  4DMX A;  4YYU A;  1ATK A;  3CBJ A;  2VHS A;  7PCK A;  4QBB A;  4DMY A;  4N8W A;  2B1M A;  4BQV A;  2DCB A;  2AYO A;  2PBH A;  2FUD A;  2DJG B;  4AXL A;  1AEC A;  1PBH A;  1GMY A;  2F1G A;  1EF7 A;  2HD5 A;  4ZUX U;  1CSB B;  5J94 A;  1BQI A;  3I06 A;  1THE A;  3S3Q A;  4XUI A;  1QMY A;  1PXV A;  2CIO A;  2DZZ A;  1TU6 A;  2NQA A;  3ERV A;  1U9V A;  2FRQ A;  1EWM A;  2DCC A;  2HXZ A;  3GCB A;  2YJ8 A;  4HWY A;  4CDE B;  1YAL A;  1DEU A;  2IPP B;  5PAD A;  2XU3 A;  3N4C A;  3HD3 A;  2E03 A;  2YJ2 A;  3BPF A;  8PCH A;  1Y4H A;  2F7D A; 
#chains in the Genus database with same CATH topology
 2E02 A;  2C0Y A;  1PPO A;  2FT2 A;  3PRM A;  4N79 A;  2PNS A;  2DJF B;  3PT2 A;  2ARY A;  1X9Y A;  3S3R A;  2BDZ A;  3KW9 A;  3TNX A;  1KHQ A;  3MTN A;  1QXP A;  3BY4 A;  4BOU A;  2FTD A;  3O0U A;  3BCN A;  3IMA A;  1KXR A;  1PCI A;  4CDF B;  2G6D A;  3K24 A;  1U9X A;  1CS8 A;  2R9O A;  4RKX A;  2R9F A;  4P6E A;  3BOW A;  2XU5 A;  2OUL A;  1MHW A;  3P5V A;  1DKI A;  1KHP A;  1CV8 A;  2FE8 A;  4YVA A;  3U8E A;  4W5B A;  2Z84 A;  3CBK A;  3USV A;  1M6D A;  1ITO A;  1TLO A;  2AU1 A;  2OP3 A;  3OIS A;  1NQC A;  2OZ2 A;  4P16 A;  1DF0 A;  1ME4 A;  2NQG A;  3PHU A;  3QT4 A;  3IFU A;  5FPW A;  1MEM A;  1NB5 A;  1KFU L;  1ME3 A;  4BS6 A;  1YT7 A;  5A24 A;  3MOR A;  3IEJ A;  2WBF X;  4I04 A;  3H8C A;  2BTW A;  3K9M A;  1F29 A;  2DC8 A;  4YYS A;  4IP3 A;  2P7U A;  1K3B B;  1GLO A;  1IWD A;  5EF4 A;  1MEG A;  2R9N A;  5E6J A;  4N4Z A;  4BS5 A;  5CVN B;  4OEM A;  4QH6 A;  4BSQ A;  1AYW A;  3KX1 A;  3CH3 X;  4KLB A;  1YZB A;  1NB3 A;  2J7Q C;  1YK7 A;  4R3D A;  2DCA A;  4YYQ A;  1YVB A;  2FQ9 A;  4PT5 A;  5CHV A;  2FYE A;  2P0R A;  2FRA A;  4RY2 A;  3IHP A;  3OQC A;  2YJ9 A;  2PRE A;  3E1Z B;  1A6R A;  4QRV A;  2YJC A;  3IUT A;  1O0E A;  2R9C A;  1HUC B;  1EWP A;  2Y5B A;  5JZE A;  2FO5 A;  4YYW A;  3O1G A;  3PBH A;  4YYR A;  1Y08 A;  4QRX A;  4RF0 A;  2XU4 A;  1AU0 A;  1S4V A;  2JQF R;  4W4U A;  3H7D A;  3C0R A;  4X6I A;  2NQI A;  1PPD A;  1CB5 A;  1FH0 A;  3BC3 A;  3I3T A;  2AVW A;  1U5I A;  2GHU A;  3LXS A;  1UKF A;  2UZJ A;  3KWZ A;  1PIP A;  4QRG A;  4MSX A;  1KFX L;  2NQD B;  3PHW A;  4HXD B;  2O6X A;  3BBA A;  1F2A A;  4BOZ A;  3IV2 A;  1YK8 A;  3K8U A;  3LFY A;  4PI3 A;  4PP2 E;  3N3G A;  2DZY A;  1BY8 A;  1Q6K A;  1AYV A;  3C9E A;  3QJ3 A;  1TL9 A;  3HHA A;  2HHN A;  2Y6E A;  5JA7 A;  3RVV A;  1CVZ A;  2R9M A;  2AUZ A;  3DF0 A;  5K16 A;  3PHX A;  4Q8H A;  1AU2 A;  1F2B A;  2G7Y A;  1BP4 A;  2BTW B;  3MHH A;  4PP1 A;  1CPJ A;  4RF1 A;  5CVM A;  2P86 A;  3CH2 X;  3BPM A;  3PNR A;  4I07 A;  4BOS A;  2DC6 A;  2G8J A;  4FJC A;  5CHT A;  3V6E A;  1SP4 B;  2E00 A;  3PRP A;  4ZTB A;  1NPZ A;  3N3K A;  3M99 A;  4MI7 A;  2DC9 A;  2AS8 A;  1U9Q X;  3D6S A;  2BDL A;  1EWL A;  3H89 A;  5KO3 A;  2AGA A;  5EZQ A;  5JH3 A;  1NLJ A;  1U9W A;  2DC7 A;  3ZUA A;  9PAP A;  3PSE A;  1ICF A;  4AXM A;  4OW0 A;  1NL6 A;  3O65 A;  1CQD A;  3IOQ A;  4K7C A;  2J7Q A;  4W5C A;  4XR7 A;  4OEL A;  3PW3 A;  3H8B A;  1GEC E;  4D8E A;  1MIR A;  1PPP A;  3E9S A;  3QSD A;  1XKG A;  4CDD B;  4X6H A;  2CB5 A;  4PAD A;  1STF E;  3OF8 A;  1MS6 A;  1F2C A;  2BU3 A;  4I05 A;  3RVW A;  1POP A;  3KFQ A;  2JQG R;  3KKU A;  2PAD A;  6PAD A;  2JTC A;  4MM3 B;  1VJV A;  3KSE A;  4X6J A;  1PAD A;  1EWO A;  2YJB A;  3MJ5 A;  4MZO A;  3RVX A;  1VSN A;  4FK5 A;  4XZX A;  5CVO B;  3TMP A;  3WXF A;  3OVX A;  5EGW A;  3W30 A;  1PVJ A;  1PPN A;  3F75 A;  3F5V A;  1GCB A;  1PE6 A;  4BPV A;  1MDW A;  1BGO A;  2XU1 A;  2E01 A;  3P5U A;  1AYU A;  1ZCM A;  1QDQ A;  3MP2 A;  3MHS A;  2HH5 A;  5F02 A;  5EZS A;  3P5X A;  2AUX A;  1QOL A;  4GUA A;  4P6G A;  2ATO A;  4OVZ A;  4Q8G A;  3MTV A;  4YV8 A;  4FIP A;  3TRK A;  1SNK A;  3KWB X;  4BOQ A;  4REZ A;  3OVZ A;  1CTE A;  2DCD A;  1AU3 A;  2B1N A;  2IBI A;  3H6S A;  4G54 A;  3BWK A;  3WXE A;  1CJL A;  1JQP A;  3B79 A;  3NHE A;  3P5W A;  3V6C A;  2DOS A;  1AIM A;  3OF9 A;  2VHF A;  3BB7 A;  4MZS A;  4CZW A;  4IUM A;  4A5U A;  4BOP A;  2AIM A;  3HHI A;  2H7J A;  3W31 A;  4WA6 A;  3HWN A;  2R6N A;  4YYV A;  3PDF A;  2ACT A;  2G8E A;  2GFO A;  4RNA A;  1ZIV A;  3AI8 A;  1AU4 A;  2AYN A;  3WXG A;  4CDC B;  4DMX A;  4YYU A;  1ATK A;  4M0W A;  4WUR A;  3CBJ A;  2VHS A;  7PCK A;  4QBB A;  4DMY A;  2HWK A;  4N8W A;  2B1M A;  4BQV A;  2DCB A;  2AYO A;  2PBH A;  2FUD A;  2DJG B;  4AXL A;  1AEC A;  1PBH A;  1GMY A;  2F1G A;  1EF7 A;  2HD5 A;  4ZUX U;  1CSB B;  5J94 A;  1BQI A;  3I06 A;  1THE A;  3S3Q A;  4XUI A;  1QMY A;  1PXV A;  2CIO A;  2JRI A;  3ZNH A;  2DZZ A;  1TU6 A;  2NQA A;  4OVZ B;  3ERV A;  1U9V A;  2FRQ A;  1EWM A;  3RNV A;  2DCC A;  4D8B A;  2HXZ A;  3GCB A;  2YJ8 A;  4HWY A;  4CDE B;  1YAL A;  1DEU A;  2IPP B;  5PAD A;  2XU3 A;  4D8I A;  3N4C A;  3HD3 A;  3B21 A;  2E03 A;  2YJ2 A;  3BPF A;  8PCH A;  1Y4H A;  2F7D A; 
#chains in the Genus database with same CATH homology
 2E02 A;  2C0Y A;  1PPO A;  2FT2 A;  4N79 A;  2PNS A;  2DJF B;  2ARY A;  1X9Y A;  3S3R A;  2BDZ A;  3KW9 A;  3TNX A;  1KHQ A;  3MTN A;  1QXP A;  2FTD A;  3O0U A;  3BCN A;  3IMA A;  1KXR A;  1PCI A;  4CDF B;  2G6D A;  2VFC A;  3K24 A;  1U9X A;  1CS8 A;  2R9O A;  3D9W A;  2R9F A;  4P6E A;  3BOW A;  2XU5 A;  2OUL A;  1MHW A;  3P5V A;  1KHP A;  1CV8 A;  4YVA A;  3U8E A;  4W5B A;  3CBK A;  3USV A;  1M6D A;  1ITO A;  1TLO A;  2AU1 A;  2OP3 A;  3OIS A;  1NQC A;  2OZ2 A;  1DF0 A;  1ME4 A;  2NQG A;  3QT4 A;  5FPW A;  1MEM A;  1NB5 A;  1KFU L;  1ME3 A;  4BS6 A;  1YT7 A;  5A24 A;  3MOR A;  3IEJ A;  2WBF X;  4I04 A;  3H8C A;  3K9M A;  1F29 A;  2DC8 A;  4YYS A;  2P7U A;  1K3B B;  1GLO A;  1IWD A;  5EF4 A;  1MEG A;  2R9N A;  4N4Z A;  4BS5 A;  5CVN B;  4OEM A;  4QH6 A;  4BSQ A;  1AYW A;  3KX1 A;  3CH3 X;  4KLB A;  1NB3 A;  1YK7 A;  2DCA A;  4YYQ A;  1YVB A;  2FQ9 A;  5CHV A;  2FYE A;  2P0R A;  2FRA A;  4RY2 A;  3IHP A;  2YJ9 A;  2PRE A;  3E1Z B;  1A6R A;  4QRV A;  2YJC A;  3IUT A;  1O0E A;  2R9C A;  1HUC B;  1EWP A;  2Y5B A;  2FO5 A;  4YYW A;  3O1G A;  3PBH A;  4YYR A;  1Y08 A;  4QRX A;  2XU4 A;  1AU0 A;  1S4V A;  2JQF R;  4W4U A;  3H7D A;  4X6I A;  2NQI A;  1PPD A;  1CB5 A;  1FH0 A;  3BC3 A;  3I3T A;  2AVW A;  1U5I A;  2GHU A;  3LXS A;  3KWZ A;  1PIP A;  4QRG A;  4MSX A;  1KFX L;  2NQD B;  2O6X A;  1F2A A;  3IV2 A;  1YK8 A;  3K8U A;  3LFY A;  4PI3 A;  4PP2 E;  3N3G A;  2DZY A;  1BY8 A;  1Q6K A;  1AYV A;  3C9E A;  3QJ3 A;  1TL9 A;  3HHA A;  2HHN A;  2Y6E A;  5JA7 A;  3RVV A;  1CVZ A;  2R9M A;  2AUZ A;  3DF0 A;  5K16 A;  4Q8H A;  1AU2 A;  1F2B A;  2G7Y A;  1BP4 A;  2BSZ A;  3MHH A;  4PP1 A;  1CPJ A;  5CVM A;  2P86 A;  3CH2 X;  3BPM A;  3PNR A;  4I07 A;  2DC6 A;  2G8J A;  4FJC A;  4C5P A;  5CHT A;  3V6E A;  1SP4 B;  2E00 A;  1GX3 A;  1NPZ A;  3N3K A;  3M99 A;  2DC9 A;  2AS8 A;  1U9Q X;  3D6S A;  2BDL A;  1EWL A;  3H89 A;  5JH3 A;  2VFB A;  1NLJ A;  1U9W A;  2DC7 A;  3ZUA A;  9PAP A;  1ICF A;  4AXM A;  1NL6 A;  1CQD A;  3IOQ A;  4K7C A;  4W5C A;  4XR7 A;  4OEL A;  3PW3 A;  3H8B A;  1GEC E;  1E2T A;  1MIR A;  1PPP A;  3QSD A;  1XKG A;  4GUZ A;  4CDD B;  4X6H A;  2CB5 A;  4PAD A;  1STF E;  3OF8 A;  1MS6 A;  1F2C A;  4I05 A;  3RVW A;  1POP A;  3KFQ A;  2JQG R;  3KKU A;  2PAD A;  6PAD A;  1VJV A;  3KSE A;  4X6J A;  1PAD A;  1EWO A;  2YJB A;  4MZO A;  3RVX A;  1VSN A;  1W6F A;  4FK5 A;  5CVO B;  3WXF A;  3OVX A;  5EGW A;  1PPN A;  3F75 A;  3F5V A;  1GCB A;  1PE6 A;  4BPV A;  1MDW A;  1BGO A;  2XU1 A;  2E01 A;  3P5U A;  1AYU A;  1ZCM A;  1QDQ A;  1W5R A;  1W4T A;  3MHS A;  2HH5 A;  4B55 A;  5F02 A;  3P5X A;  2AUX A;  1QOL A;  4P6G A;  2ATO A;  4Q8G A;  4YV8 A;  4FIP A;  1SNK A;  3KWB X;  3OVZ A;  1CTE A;  2DCD A;  1AU3 A;  2B1N A;  2IBI A;  3H6S A;  4G54 A;  3BWK A;  3WXE A;  1CJL A;  1JQP A;  3B79 A;  3LTW A;  3NHE A;  3P5W A;  3V6C A;  1AIM A;  3OF9 A;  2VHF A;  4MZS A;  4CZW A;  4BGF A;  2AIM A;  3HHI A;  2H7J A;  4WA6 A;  3HWN A;  2R6N A;  4YYV A;  3PDF A;  2ACT A;  2G8E A;  2GFO A;  1ZIV A;  3AI8 A;  1AU4 A;  2AYN A;  3WXG A;  4CDC B;  4DMX A;  4YYU A;  1ATK A;  4NV7 A;  3CBJ A;  4NV8 A;  2VHS A;  7PCK A;  4QBB A;  4DMY A;  4N8W A;  2B1M A;  4BQV A;  2DCB A;  2AYO A;  2PBH A;  2FUD A;  2DJG B;  4AXL A;  1AEC A;  1PBH A;  1GMY A;  2F1G A;  1EF7 A;  2HD5 A;  4ZUX U;  1CSB B;  5J94 A;  1BQI A;  3I06 A;  1THE A;  3S3Q A;  4XUI A;  1QMY A;  1PXV A;  2CIO A;  2DZZ A;  1TU6 A;  2NQA A;  3ERV A;  1U9V A;  2FRQ A;  1EWM A;  2DCC A;  2HXZ A;  3GCB A;  2YJ8 A;  4HWY A;  4CDE B;  1YAL A;  1DEU A;  2IPP B;  5PAD A;  2XU3 A;  3N4C A;  3HD3 A;  2E03 A;  2YJ2 A;  3BPF A;  8PCH A;  1Y4H A;  2F7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...