1YT7A

Cathepsin k complexed with a constrained ketoamide inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
PDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title P(2)-P(3) conformationally constrained ketoamide-based inhibitors of cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yt7A00
3KKUA 1CJLA 2C0YA 1CS8A 3P5UA 3PNRA 3PBHA 1PCIA 1KXRA 3MHSA 1QOLA 2PBHA 4G54A 4OELA 3H6SA 3OVXA 4QRVA 3IEJA 3V6EA 1NLJA 1U9QX 3S3RA 5CHVA 3BPFA 3CBJA 1Y08A 5CHTA 1BP4A 2DC7A 1CQDA 3H89A 3I3TA 1GMYA 2AYOA 3IUTA 1THEA 2E02A 1QDQA 1ZIVA 2Y6EA 2AIMA 4YVAA 3I06A 4BPVA 2IPPB 4YV8A 3DF0A 1POPA 1AIMA 2CB5A 2VHSA 2NQDB 2P7UA 3WXGA 1F2BA 1YVBA 4ZUXU 2OZ2A 2ARYA 4P6EA 2PNSA 3MORA 3KX1A 4Q8HA 1MHWA 2FO5A 2AU1A 2PADA 5CVMA 4BS6A 1AYUA 1CPJA 3V6CA 5EGWA 1CVZA 3KWBX 4MZOA 4BSQA 4W4UA 5FPWA 1PPDA 1AU4A 3BPMA 1VJVA 2FUDA 3QSDA 1ITOA 2WBFX 3WXFA 1PPNA 4WA6A 2ACTA 5K16A 9PAPA 1CV8A 2BDZA 4QBBA 1AYWA 1YK7A 2B1NA 1K3BB 3TNXA 4I07A 3RVWA 2NQIA 2DC8A 4I05A 3H7DA 2JQFR 4PP2E 2R9FA 4AXMA 1KHPA 1TLOA 1MIRA 2YJCA 2P0RA 1IWDA 2R9CA 1AECA 2AVWA 2XU5A 3F75A 1U9XA 4MZSA 1CB5A 3KW9A 2Y5BA 3N3KA 1TL9A 3IMAA 3N3GA 3BWKA 1Y4HA 2HXZA 2PREA 3OF9A 2BDLA 2HD5A 3KFQA 3HHAA 1ATKA 3NHEA 4CDEB 1YALA 3ZUAA 4P6GA 3H8BA 4K7CA 2AUXA 2XU3A 4N4ZA 2NQGA 4CDFB 1PXVA 1S4VA 3K9MA 1BGOA 3PDFA 4YYSA 1O0EA 2FT2A 3OVZA 1ZCMA 4AXLA 3D6SA 4YYVA 5JA7A 4MSXA 1GECE 1PADA 2R9NA 2VHFA 3CH2X 2YJBA 4CZWA 3E1ZB 1ICFA 1PPOA 3KSEA 3GCBA 2XU1A 1PIPA 3B79A 1AU3A 3C9EA 3OISA 3IV2A 4CDCB 2G8EA 3H8CA 1ME3A 2DCAA 1GLOA 1QXPA 5CVNB 2DCDA 3S3QA 1PBHA 1DF0A 3O1GA 3ERVA 1STFE 1AU2A 4DMYA 2GHUA 2YJ9A 4QRXA 1MEGA 1NQCA 2ATOA 8PCHA 2FYEA 1F29A 5EF4A 4W5BA 5JH3A 2DC6A 2DCBA 1KFXL 3LXSA 2HHNA 4QH6A 1NPZA 1KFUL 2AYNA 1CTEA 1U9WA 3P5VA 1YK8A 3AI8A 2FRAA 3IOQA 4FIPA 2FTDA 1SNKA 4CDDB 2DZYA 4DMXA 1VSNA 3MTNA 4RY2A 3CH3X 2DCCA 1BQIA 2H7JA 1X9YA 2FRQA 3KWZA 5J94A 3CBKA 4W5CA 5PADA 7PCKA 3HHIA 4FK5A 3HD3A 4XUIA 4YYWA 1YT7A 2XU4A 1CSBB 2GFOA 2OP3A 1M6DA 4X6JA 1F2CA 4YYRA 1NL6A 3HWNA 2AUZA 1Q6KA 1GCBA 3OF8A 1A6RA 4YYUA 4HWYA 2IBIA 1MEMA 3P5WA 1U5IA 4XR7A 1TU6A 3F5VA 3QJ3A 2NQAA 2R9OA 2DJGB 4PI3A 2F1GA 2YJ2A 1F2AA 2P86A 4PADA 3USVA 3MHHA 4I04A 2G6DA 2OULA 5F02A 1EWPA 1MS6A 2DC9A 2G8JA 3LFYA 1SP4B 1NB3A 1NB5A 4OEMA 4X6IA 3N4CA 3QT4A 2HH5A 1FH0A 3U8EA 3P5XA 1AU0A 1QMYA 4BQVA 1EF7A 3RVVA 1JQPA 4BS5A 2E03A 2G7YA 4X6HA 3O0UA 6PADA 4PP1A 2DJFB 2AS8A 2FQ9A 1AYVA 5CVOB 2B1MA 2JQGR 2YJ8A 3PW3A 1PE6A 4YYQA 1MDWA 3BCNA 2O6XA 1EWLA 1U9VA 2E00A 3BOWA 1ME4A 1DEUA 2R9MA 4FJCA 4KLBA 1KHQA 3IHPA 1PPPA 2F7DA 4N8WA 3K24A 4Q8GA 1XKGA 3M99A 3WXEA 4QRGA 2CIOA 3K8UA 1BY8A 4N79A 2DZZA 1HUCB 3BC3A 3RVXA 1EWMA 2R6NA 1EWOA 2E01A 5A24A
chains in the Genus database with same CATH superfamily
3KKUA 1CJLA 2C0YA 1CS8A 3P5UA 3PNRA 3PBHA 1PCIA 1KXRA 3MHSA 1QOLA 2PBHA 4G54A 4OELA 3H6SA 3OVXA 4QRVA 3IEJA 3V6EA 1NLJA 1U9QX 3S3RA 5CHVA 3BPFA 3CBJA 1Y08A 3PRMA 5CHTA 1BP4A 2DC7A 1CQDA 4BOZA 3H89A 3I3TA 1GMYA 2AYOA 3IUTA 3ZNHA 1THEA 3PHXA 2E02A 5JZEA 3O65A 4ZTBA 1QDQA 1ZIVA 2Y6EA 2AIMA 4YVAA 3I06A 4BPVA 2IPPB 4YV8A 3DF0A 1POPA 1AIMA 2CB5A 4RKXA 2VHSA 2NQDB 2P7UA 3WXGA 1F2BA 1YVBA 4ZUXU 2OZ2A 2ARYA 4D8EA 4P6EA 1YZBA 2PNSA 3MORA 3PT2A 3KX1A 2Z84A 4Q8HA 1MHWA 2FO5A 2AU1A 2PADA 5CVMA 4BS6A 3PSEA 3BB7A 4MM3B 1AYUA 1CPJA 3V6CA 5EGWA 1CVZA 5EZSA 4MZOA 3KWBX 4RNAA 4BSQA 2JTCA 4W4UA 5FPWA 1PPDA 3BBAA 1AU4A 3BPMA 1VJVA 2FUDA 3QSDA 1ITOA 2WBFX 3WXFA 1PPNA 4WA6A 2ACTA 2AGAA 5K16A 3MP2A 9PAPA 1CV8A 2BDZA 4QBBA 1AYWA 1YK7A 2B1NA 4WURA 1K3BB 4D8BA 2DOSA 3TNXA 4I07A 3RVWA 2NQIA 2DC8A 4I05A 4RF0A 3C0RA 3H7DA 2JQFR 2BTWB 2R9FA 4PP2E 4AXMA 4BOQA 1KHPA 1TLOA 1MIRA 2YJCA 2P0RA 1IWDA 2R9CA 5KO3A 1AECA 2AVWA 2BTWA 2XU5A 3F75A 1U9XA 4MZSA 1CB5A 3KW9A 2Y5BA 3N3KA 1TL9A 3IMAA 3N3GA 3BWKA 1Y4HA 2HXZA 2PREA 3B21A 3OF9A 2BDLA 2HD5A 3KFQA 3HHAA 1ATKA 3NHEA 4CDEB 2J7QC 1YALA 3ZUAA 4P6GA 3H8BA 4K7CA 1PVJA 2AUXA 2XU3A 4N4ZA 2NQGA 4CDFB 1PXVA 1S4VA 3K9MA 1BGOA 3PDFA 4YYSA 1O0EA 2FT2A 4MI7A 3OVZA 1ZCMA 4AXLA 3D6SA 4YYVA 5JA7A 4MSXA 4GUAA 1GECE 1PADA 2R9NA 2VHFA 2BU3A 3CH2X 2YJBA 4CZWA 3E1ZB 1ICFA 1PPOA 4M0WA 3KSEA 3GCBA 2XU1A 4OVZB 1PIPA 3OQCA 3B79A 1AU3A 3C9EA 3W30A 3OISA 3IV2A 4CDCB 2G8EA 3H8CA 1ME3A 2DCAA 1GLOA 1QXPA 4HXDB 5CVNB 2DCDA 3S3QA 1PBHA 1DF0A 3O1GA 3ERVA 1STFE 1AU2A 4DMYA 2GHUA 2YJ9A 4QRXA 1MEGA 1NQCA 2ATOA 8PCHA 2FYEA 1F29A 5EF4A 4W5BA 5JH3A 2DC6A 2DCBA 1KFXL 3BY4A 3LXSA 2HHNA 4QH6A 1NPZA 1KFUL 2AYNA 1CTEA 1U9WA 4IUMA 3P5VA 3RNVA 1YK8A 3AI8A 2FRAA 3IOQA 4FIPA 2FTDA 1SNKA 4CDDB 2DZYA 4DMXA 1VSNA 3MTNA 4RY2A 3CH3X 5E6JA 2DCCA 3PHUA 1BQIA 2H7JA 1X9YA 2FRQA 3MJ5A 4OW0A 3KWZA 5J94A 3CBKA 4IP3A 2HWKA 4W5CA 5PADA 7PCKA 3HHIA 4FK5A 3HD3A 4REZA 4XUIA 4YYWA 2J7QA 4OVZA 1YT7A 2XU4A 1CSBB 3E9SA 2GFOA 2OP3A 1M6DA 4X6JA 3TRKA 3TMPA 1F2CA 3PRPA 4A5UA 4YYRA 1NL6A 3HWNA 2AUZA 1Q6KA 1GCBA 3OF8A 1A6RA 4PT5A 4YYUA 2FE8A 2IBIA 4HWYA 1MEMA 3P5WA 1DKIA 1U5IA 4XR7A 1TU6A 3F5VA 3QJ3A 2NQAA 2R9OA 2DJGB 4PI3A 2F1GA 2YJ2A 1F2AA 2P86A 3IFUA 4PADA 4BOUA 3USVA 3MHHA 4I04A 4BOSA 2G6DA 4XZXA 2OULA 5F02A 3W31A 4RF1A 1EWPA 1MS6A 2DC9A 2G8JA 3LFYA 1SP4B 1UKFA 1NB3A 1NB5A 4OEMA 4X6IA 3N4CA 3QT4A 2HH5A 2JRIA 1FH0A 4R3DA 3U8EA 3P5XA 1AU0A 1QMYA 4BQVA 1EF7A 3RVVA 1JQPA 4BS5A 2E03A 2G7YA 4X6HA 3O0UA 3MTVA 6PADA 4PP1A 2DJFB 4P16A 2AS8A 2FQ9A 1AYVA 5CVOB 2B1MA 2JQGR 2YJ8A 3PW3A 1PE6A 4YYQA 1MDWA 3BCNA 2O6XA 1EWLA 1U9VA 2E00A 3BOWA 1ME4A 1DEUA 2R9MA 4FJCA 4KLBA 1KHQA 3IHPA 4BOPA 1PPPA 2F7DA 4N8WA 3K24A 4Q8GA 1XKGA 3M99A 3WXEA 4QRGA 2CIOA 3K8UA 1BY8A 4N79A 2DZZA 1HUCB 3BC3A 5EZQA 3RVXA 1EWMA 2R6NA 1EWOA 4D8IA 2E01A 3PHWA 2UZJA 5A24A
chains in the Genus database with same CATH topology
3LTWA 3KKUA 1CJLA 2C0YA 1CS8A 3P5UA 3PNRA 3PBHA 1PCIA 1KXRA 3MHSA 1QOLA 2PBHA 4G54A 4OELA 3H6SA 3OVXA 4QRVA 3IEJA 3V6EA 1NLJA 1U9QX 3S3RA 5CHVA 3BPFA 3CBJA 1Y08A 5CHTA 1BP4A 2DC7A 1CQDA 3H89A 3I3TA 1GMYA 2AYOA 3IUTA 1THEA 2E02A 1QDQA 1ZIVA 2Y6EA 2AIMA 4YVAA 3I06A 4BPVA 2IPPB 4YV8A 3DF0A 1POPA 1AIMA 2CB5A 2VHSA 2NQDB 1W4TA 2P7UA 3WXGA 1F2BA 1YVBA 4ZUXU 2OZ2A 2ARYA 4P6EA 2PNSA 3MORA 3KX1A 4Q8HA 1MHWA 2FO5A 2AU1A 2PADA 5CVMA 4BS6A 1AYUA 1CPJA 3V6CA 5EGWA 1CVZA 3KWBX 4MZOA 4BSQA 4W4UA 5FPWA 1PPDA 1AU4A 3BPMA 1VJVA 2FUDA 3QSDA 1ITOA 2WBFX 3WXFA 1PPNA 4WA6A 2ACTA 5K16A 9PAPA 1CV8A 2BDZA 4QBBA 1AYWA 1YK7A 2B1NA 1K3BB 1GX3A 3TNXA 4I07A 3RVWA 2NQIA 2DC8A 4I05A 3H7DA 2JQFR 4PP2E 2R9FA 4AXMA 1KHPA 1TLOA 4GUZA 1MIRA 2YJCA 2P0RA 1IWDA 2R9CA 1AECA 2AVWA 2XU5A 3F75A 1U9XA 4MZSA 1CB5A 3KW9A 2Y5BA 3N3KA 1TL9A 3IMAA 3N3GA 3BWKA 1Y4HA 2HXZA 2PREA 2VFCA 3OF9A 4BGFA 1W5RA 2BDLA 2HD5A 3KFQA 3HHAA 1ATKA 3NHEA 4CDEB 1YALA 3ZUAA 4P6GA 3H8BA 4K7CA 2AUXA 2XU3A 4N4ZA 2NQGA 4CDFB 1PXVA 1S4VA 3K9MA 1BGOA 4NV8A 3PDFA 4YYSA 1O0EA 2FT2A 3OVZA 1ZCMA 4AXLA 3D6SA 4YYVA 5JA7A 4MSXA 1GECE 1PADA 2R9NA 2VHFA 3CH2X 2YJBA 4CZWA 3E1ZB 1ICFA 1PPOA 3KSEA 3GCBA 2XU1A 1PIPA 3B79A 1AU3A 3C9EA 3OISA 3IV2A 4CDCB 2G8EA 3H8CA 1ME3A 2DCAA 1GLOA 1QXPA 5CVNB 2DCDA 3S3QA 1PBHA 1DF0A 3O1GA 3ERVA 1STFE 2VFBA 1AU2A 4DMYA 2GHUA 2YJ9A 4QRXA 1MEGA 1NQCA 2ATOA 8PCHA 2FYEA 1F29A 5EF4A 4W5BA 5JH3A 2DC6A 2DCBA 1KFXL 3LXSA 2HHNA 2BSZA 4QH6A 1NPZA 4B55A 1KFUL 2AYNA 1CTEA 1U9WA 3P5VA 1YK8A 3AI8A 2FRAA 3IOQA 4FIPA 2FTDA 1SNKA 4CDDB 2DZYA 4DMXA 1VSNA 3MTNA 4RY2A 3CH3X 2DCCA 1BQIA 2H7JA 1X9YA 2FRQA 3KWZA 5J94A 3CBKA 4W5CA 5PADA 7PCKA 3HHIA 4FK5A 3HD3A 4XUIA 4YYWA 1YT7A 2XU4A 1CSBB 1W6FA 2GFOA 2OP3A 1M6DA 4X6JA 1F2CA 4YYRA 1NL6A 3HWNA 2AUZA 1Q6KA 4C5PA 1GCBA 3OF8A 1A6RA 4YYUA 4HWYA 2IBIA 1MEMA 3P5WA 1U5IA 3D9WA 1TU6A 4XR7A 3F5VA 3QJ3A 2NQAA 2R9OA 2DJGB 4NV7A 4PI3A 2F1GA 2YJ2A 1F2AA 2P86A 4PADA 3USVA 3MHHA 4I04A 2G6DA 2OULA 5F02A 1EWPA 1MS6A 2DC9A 2G8JA 3LFYA 1SP4B 1NB3A 1NB5A 4OEMA 4X6IA 3N4CA 3QT4A 2HH5A 1FH0A 3U8EA 3P5XA 1AU0A 1QMYA 4BQVA 1EF7A 3RVVA 1JQPA 4BS5A 2E03A 2G7YA 4X6HA 3O0UA 6PADA 4PP1A 2DJFB 2AS8A 2FQ9A 1AYVA 5CVOB 2B1MA 2JQGR 2YJ8A 3PW3A 1PE6A 4YYQA 1MDWA 3BCNA 2O6XA 1EWLA 1U9VA 2E00A 3BOWA 1ME4A 1E2TA 1DEUA 2R9MA 4FJCA 4KLBA 1KHQA 3IHPA 1PPPA 2F7DA 4N8WA 3K24A 4Q8GA 1XKGA 3M99A 3WXEA 4QRGA 2CIOA 3K8UA 1BY8A 4N79A 2DZZA 1HUCB 3BC3A 3RVXA 1EWMA 2R6NA 1EWOA 2E01A 5A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKU A;  1CJL A;  2C0Y A;  1CS8 A;  3P5U A;  3PNR A;  3PBH A;  1PCI A;  1KXR A;  3MHS A;  1QOL A;  2PBH A;  4G54 A;  4OEL A;  3H6S A;  3OVX A;  4QRV A;  3IEJ A;  3V6E A;  1NLJ A;  1U9Q X;  3S3R A;  5CHV A;  3BPF A;  3CBJ A;  1Y08 A;  5CHT A;  1BP4 A;  2DC7 A;  1CQD A;  3H89 A;  3I3T A;  1GMY A;  2AYO A;  3IUT A;  1THE A;  2E02 A;  1QDQ A;  1ZIV A;  2Y6E A;  2AIM A;  4YVA A;  3I06 A;  4BPV A;  2IPP B;  4YV8 A;  3DF0 A;  1POP A;  1AIM A;  2CB5 A;  2VHS A;  2NQD B;  2P7U A;  3WXG A;  1F2B A;  1YVB A;  4ZUX U;  2OZ2 A;  2ARY A;  4P6E A;  2PNS A;  3MOR A;  3KX1 A;  4Q8H A;  1MHW A;  2FO5 A;  2AU1 A;  2PAD A;  5CVM A;  4BS6 A;  1AYU A;  1CPJ A;  3V6C A;  5EGW A;  1CVZ A;  3KWB X;  4MZO A;  4BSQ A;  4W4U A;  5FPW A;  1PPD A;  1AU4 A;  3BPM A;  1VJV A;  2FUD A;  3QSD A;  1ITO A;  2WBF X;  3WXF A;  1PPN A;  4WA6 A;  2ACT A;  5K16 A;  9PAP A;  1CV8 A;  2BDZ A;  4QBB A;  1AYW A;  1YK7 A;  2B1N A;  1K3B B;  3TNX A;  4I07 A;  3RVW A;  2NQI A;  2DC8 A;  4I05 A;  3H7D A;  2JQF R;  4PP2 E;  2R9F A;  4AXM A;  1KHP A;  1TLO A;  1MIR A;  2YJC A;  2P0R A;  1IWD A;  2R9C A;  1AEC A;  2AVW A;  2XU5 A;  3F75 A;  1U9X A;  4MZS A;  1CB5 A;  3KW9 A;  2Y5B A;  3N3K A;  1TL9 A;  3IMA A;  3N3G A;  3BWK A;  1Y4H A;  2HXZ A;  2PRE A;  3OF9 A;  2BDL A;  2HD5 A;  3KFQ A;  3HHA A;  1ATK A;  3NHE A;  4CDE B;  1YAL A;  3ZUA A;  4P6G A;  3H8B A;  4K7C A;  2AUX A;  2XU3 A;  4N4Z A;  2NQG A;  4CDF B;  1PXV A;  1S4V A;  3K9M A;  1BGO A;  3PDF A;  4YYS A;  1O0E A;  2FT2 A;  3OVZ A;  1ZCM A;  4AXL A;  3D6S A;  4YYV A;  5JA7 A;  4MSX A;  1GEC E;  1PAD A;  2R9N A;  2VHF A;  3CH2 X;  2YJB A;  4CZW A;  3E1Z B;  1ICF A;  1PPO A;  3KSE A;  3GCB A;  2XU1 A;  1PIP A;  3B79 A;  1AU3 A;  3C9E A;  3OIS A;  3IV2 A;  4CDC B;  2G8E A;  3H8C A;  1ME3 A;  2DCA A;  1GLO A;  1QXP A;  5CVN B;  2DCD A;  3S3Q A;  1PBH A;  1DF0 A;  3O1G A;  3ERV A;  1STF E;  1AU2 A;  4DMY A;  2GHU A;  2YJ9 A;  4QRX A;  1MEG A;  1NQC A;  2ATO A;  8PCH A;  2FYE A;  1F29 A;  5EF4 A;  4W5B A;  5JH3 A;  2DC6 A;  2DCB A;  1KFX L;  3LXS A;  2HHN A;  4QH6 A;  1NPZ A;  1KFU L;  2AYN A;  1CTE A;  1U9W A;  3P5V A;  1YK8 A;  3AI8 A;  2FRA A;  3IOQ A;  4FIP A;  2FTD A;  1SNK A;  4CDD B;  2DZY A;  4DMX A;  1VSN A;  3MTN A;  4RY2 A;  3CH3 X;  2DCC A;  1BQI A;  2H7J A;  1X9Y A;  2FRQ A;  3KWZ A;  5J94 A;  3CBK A;  4W5C A;  5PAD A;  7PCK A;  3HHI A;  4FK5 A;  3HD3 A;  4XUI A;  4YYW A;  1YT7 A;  2XU4 A;  1CSB B;  2GFO A;  2OP3 A;  1M6D A;  4X6J A;  1F2C A;  4YYR A;  1NL6 A;  3HWN A;  2AUZ A;  1Q6K A;  1GCB A;  3OF8 A;  1A6R A;  4YYU A;  4HWY A;  2IBI A;  1MEM A;  3P5W A;  1U5I A;  4XR7 A;  1TU6 A;  3F5V A;  3QJ3 A;  2NQA A;  2R9O A;  2DJG B;  4PI3 A;  2F1G A;  2YJ2 A;  1F2A A;  2P86 A;  4PAD A;  3USV A;  3MHH A;  4I04 A;  2G6D A;  2OUL A;  5F02 A;  1EWP A;  1MS6 A;  2DC9 A;  2G8J A;  3LFY A;  1SP4 B;  1NB3 A;  1NB5 A;  4OEM A;  4X6I A;  3N4C A;  3QT4 A;  2HH5 A;  1FH0 A;  3U8E A;  3P5X A;  1AU0 A;  1QMY A;  4BQV A;  1EF7 A;  3RVV A;  1JQP A;  4BS5 A;  2E03 A;  2G7Y A;  4X6H A;  3O0U A;  6PAD A;  4PP1 A;  2DJF B;  2AS8 A;  2FQ9 A;  1AYV A;  5CVO B;  2B1M A;  2JQG R;  2YJ8 A;  3PW3 A;  1PE6 A;  4YYQ A;  1MDW A;  3BCN A;  2O6X A;  1EWL A;  1U9V A;  2E00 A;  3BOW A;  1ME4 A;  1DEU A;  2R9M A;  4FJC A;  4KLB A;  1KHQ A;  3IHP A;  1PPP A;  2F7D A;  4N8W A;  3K24 A;  4Q8G A;  1XKG A;  3M99 A;  3WXE A;  4QRG A;  2CIO A;  3K8U A;  1BY8 A;  4N79 A;  2DZZ A;  1HUC B;  3BC3 A;  3RVX A;  1EWM A;  2R6N A;  1EWO A;  2E01 A;  5A24 A; 
#chains in the Genus database with same CATH topology
 3KKU A;  1CJL A;  2C0Y A;  1CS8 A;  3P5U A;  3PNR A;  3PBH A;  1PCI A;  1KXR A;  3MHS A;  1QOL A;  2PBH A;  4G54 A;  4OEL A;  3H6S A;  3OVX A;  4QRV A;  3IEJ A;  3V6E A;  1NLJ A;  1U9Q X;  3S3R A;  5CHV A;  3BPF A;  3CBJ A;  1Y08 A;  3PRM A;  5CHT A;  1BP4 A;  2DC7 A;  1CQD A;  4BOZ A;  3H89 A;  3I3T A;  1GMY A;  2AYO A;  3IUT A;  3ZNH A;  1THE A;  3PHX A;  2E02 A;  5JZE A;  3O65 A;  4ZTB A;  1QDQ A;  1ZIV A;  2Y6E A;  2AIM A;  4YVA A;  3I06 A;  4BPV A;  2IPP B;  4YV8 A;  3DF0 A;  1POP A;  1AIM A;  2CB5 A;  4RKX A;  2VHS A;  2NQD B;  2P7U A;  3WXG A;  1F2B A;  1YVB A;  4ZUX U;  2OZ2 A;  2ARY A;  4D8E A;  4P6E A;  1YZB A;  2PNS A;  3MOR A;  3PT2 A;  3KX1 A;  2Z84 A;  4Q8H A;  1MHW A;  2FO5 A;  2AU1 A;  2PAD A;  5CVM A;  4BS6 A;  3PSE A;  3BB7 A;  4MM3 B;  1AYU A;  1CPJ A;  3V6C A;  5EGW A;  1CVZ A;  5EZS A;  4MZO A;  3KWB X;  4RNA A;  4BSQ A;  2JTC A;  4W4U A;  5FPW A;  1PPD A;  3BBA A;  1AU4 A;  3BPM A;  1VJV A;  2FUD A;  3QSD A;  1ITO A;  2WBF X;  3WXF A;  1PPN A;  4WA6 A;  2ACT A;  2AGA A;  5K16 A;  3MP2 A;  9PAP A;  1CV8 A;  2BDZ A;  4QBB A;  1AYW A;  1YK7 A;  2B1N A;  4WUR A;  1K3B B;  4D8B A;  2DOS A;  3TNX A;  4I07 A;  3RVW A;  2NQI A;  2DC8 A;  4I05 A;  4RF0 A;  3C0R A;  3H7D A;  2JQF R;  2BTW B;  2R9F A;  4PP2 E;  4AXM A;  4BOQ A;  1KHP A;  1TLO A;  1MIR A;  2YJC A;  2P0R A;  1IWD A;  2R9C A;  5KO3 A;  1AEC A;  2AVW A;  2BTW A;  2XU5 A;  3F75 A;  1U9X A;  4MZS A;  1CB5 A;  3KW9 A;  2Y5B A;  3N3K A;  1TL9 A;  3IMA A;  3N3G A;  3BWK A;  1Y4H A;  2HXZ A;  2PRE A;  3B21 A;  3OF9 A;  2BDL A;  2HD5 A;  3KFQ A;  3HHA A;  1ATK A;  3NHE A;  4CDE B;  2J7Q C;  1YAL A;  3ZUA A;  4P6G A;  3H8B A;  4K7C A;  1PVJ A;  2AUX A;  2XU3 A;  4N4Z A;  2NQG A;  4CDF B;  1PXV A;  1S4V A;  3K9M A;  1BGO A;  3PDF A;  4YYS A;  1O0E A;  2FT2 A;  4MI7 A;  3OVZ A;  1ZCM A;  4AXL A;  3D6S A;  4YYV A;  5JA7 A;  4MSX A;  4GUA A;  1GEC E;  1PAD A;  2R9N A;  2VHF A;  2BU3 A;  3CH2 X;  2YJB A;  4CZW A;  3E1Z B;  1ICF A;  1PPO A;  4M0W A;  3KSE A;  3GCB A;  2XU1 A;  4OVZ B;  1PIP A;  3OQC A;  3B79 A;  1AU3 A;  3C9E A;  3W30 A;  3OIS A;  3IV2 A;  4CDC B;  2G8E A;  3H8C A;  1ME3 A;  2DCA A;  1GLO A;  1QXP A;  4HXD B;  5CVN B;  2DCD A;  3S3Q A;  1PBH A;  1DF0 A;  3O1G A;  3ERV A;  1STF E;  1AU2 A;  4DMY A;  2GHU A;  2YJ9 A;  4QRX A;  1MEG A;  1NQC A;  2ATO A;  8PCH A;  2FYE A;  1F29 A;  5EF4 A;  4W5B A;  5JH3 A;  2DC6 A;  2DCB A;  1KFX L;  3BY4 A;  3LXS A;  2HHN A;  4QH6 A;  1NPZ A;  1KFU L;  2AYN A;  1CTE A;  1U9W A;  4IUM A;  3P5V A;  3RNV A;  1YK8 A;  3AI8 A;  2FRA A;  3IOQ A;  4FIP A;  2FTD A;  1SNK A;  4CDD B;  2DZY A;  4DMX A;  1VSN A;  3MTN A;  4RY2 A;  3CH3 X;  5E6J A;  2DCC A;  3PHU A;  1BQI A;  2H7J A;  1X9Y A;  2FRQ A;  3MJ5 A;  4OW0 A;  3KWZ A;  5J94 A;  3CBK A;  4IP3 A;  2HWK A;  4W5C A;  5PAD A;  7PCK A;  3HHI A;  4FK5 A;  3HD3 A;  4REZ A;  4XUI A;  4YYW A;  2J7Q A;  4OVZ A;  1YT7 A;  2XU4 A;  1CSB B;  3E9S A;  2GFO A;  2OP3 A;  1M6D A;  4X6J A;  3TRK A;  3TMP A;  1F2C A;  3PRP A;  4A5U A;  4YYR A;  1NL6 A;  3HWN A;  2AUZ A;  1Q6K A;  1GCB A;  3OF8 A;  1A6R A;  4PT5 A;  4YYU A;  2FE8 A;  2IBI A;  4HWY A;  1MEM A;  3P5W A;  1DKI A;  1U5I A;  4XR7 A;  1TU6 A;  3F5V A;  3QJ3 A;  2NQA A;  2R9O A;  2DJG B;  4PI3 A;  2F1G A;  2YJ2 A;  1F2A A;  2P86 A;  3IFU A;  4PAD A;  4BOU A;  3USV A;  3MHH A;  4I04 A;  4BOS A;  2G6D A;  4XZX A;  2OUL A;  5F02 A;  3W31 A;  4RF1 A;  1EWP A;  1MS6 A;  2DC9 A;  2G8J A;  3LFY A;  1SP4 B;  1UKF A;  1NB3 A;  1NB5 A;  4OEM A;  4X6I A;  3N4C A;  3QT4 A;  2HH5 A;  2JRI A;  1FH0 A;  4R3D A;  3U8E A;  3P5X A;  1AU0 A;  1QMY A;  4BQV A;  1EF7 A;  3RVV A;  1JQP A;  4BS5 A;  2E03 A;  2G7Y A;  4X6H A;  3O0U A;  3MTV A;  6PAD A;  4PP1 A;  2DJF B;  4P16 A;  2AS8 A;  2FQ9 A;  1AYV A;  5CVO B;  2B1M A;  2JQG R;  2YJ8 A;  3PW3 A;  1PE6 A;  4YYQ A;  1MDW A;  3BCN A;  2O6X A;  1EWL A;  1U9V A;  2E00 A;  3BOW A;  1ME4 A;  1DEU A;  2R9M A;  4FJC A;  4KLB A;  1KHQ A;  3IHP A;  4BOP A;  1PPP A;  2F7D A;  4N8W A;  3K24 A;  4Q8G A;  1XKG A;  3M99 A;  3WXE A;  4QRG A;  2CIO A;  3K8U A;  1BY8 A;  4N79 A;  2DZZ A;  1HUC B;  3BC3 A;  5EZQ A;  3RVX A;  1EWM A;  2R6N A;  1EWO A;  4D8I A;  2E01 A;  3PHW A;  2UZJ A;  5A24 A; 
#chains in the Genus database with same CATH homology
 3LTW A;  3KKU A;  1CJL A;  2C0Y A;  1CS8 A;  3P5U A;  3PNR A;  3PBH A;  1PCI A;  1KXR A;  3MHS A;  1QOL A;  2PBH A;  4G54 A;  4OEL A;  3H6S A;  3OVX A;  4QRV A;  3IEJ A;  3V6E A;  1NLJ A;  1U9Q X;  3S3R A;  5CHV A;  3BPF A;  3CBJ A;  1Y08 A;  5CHT A;  1BP4 A;  2DC7 A;  1CQD A;  3H89 A;  3I3T A;  1GMY A;  2AYO A;  3IUT A;  1THE A;  2E02 A;  1QDQ A;  1ZIV A;  2Y6E A;  2AIM A;  4YVA A;  3I06 A;  4BPV A;  2IPP B;  4YV8 A;  3DF0 A;  1POP A;  1AIM A;  2CB5 A;  2VHS A;  2NQD B;  1W4T A;  2P7U A;  3WXG A;  1F2B A;  1YVB A;  4ZUX U;  2OZ2 A;  2ARY A;  4P6E A;  2PNS A;  3MOR A;  3KX1 A;  4Q8H A;  1MHW A;  2FO5 A;  2AU1 A;  2PAD A;  5CVM A;  4BS6 A;  1AYU A;  1CPJ A;  3V6C A;  5EGW A;  1CVZ A;  3KWB X;  4MZO A;  4BSQ A;  4W4U A;  5FPW A;  1PPD A;  1AU4 A;  3BPM A;  1VJV A;  2FUD A;  3QSD A;  1ITO A;  2WBF X;  3WXF A;  1PPN A;  4WA6 A;  2ACT A;  5K16 A;  9PAP A;  1CV8 A;  2BDZ A;  4QBB A;  1AYW A;  1YK7 A;  2B1N A;  1K3B B;  1GX3 A;  3TNX A;  4I07 A;  3RVW A;  2NQI A;  2DC8 A;  4I05 A;  3H7D A;  2JQF R;  4PP2 E;  2R9F A;  4AXM A;  1KHP A;  1TLO A;  4GUZ A;  1MIR A;  2YJC A;  2P0R A;  1IWD A;  2R9C A;  1AEC A;  2AVW A;  2XU5 A;  3F75 A;  1U9X A;  4MZS A;  1CB5 A;  3KW9 A;  2Y5B A;  3N3K A;  1TL9 A;  3IMA A;  3N3G A;  3BWK A;  1Y4H A;  2HXZ A;  2PRE A;  2VFC A;  3OF9 A;  4BGF A;  1W5R A;  2BDL A;  2HD5 A;  3KFQ A;  3HHA A;  1ATK A;  3NHE A;  4CDE B;  1YAL A;  3ZUA A;  4P6G A;  3H8B A;  4K7C A;  2AUX A;  2XU3 A;  4N4Z A;  2NQG A;  4CDF B;  1PXV A;  1S4V A;  3K9M A;  1BGO A;  4NV8 A;  3PDF A;  4YYS A;  1O0E A;  2FT2 A;  3OVZ A;  1ZCM A;  4AXL A;  3D6S A;  4YYV A;  5JA7 A;  4MSX A;  1GEC E;  1PAD A;  2R9N A;  2VHF A;  3CH2 X;  2YJB A;  4CZW A;  3E1Z B;  1ICF A;  1PPO A;  3KSE A;  3GCB A;  2XU1 A;  1PIP A;  3B79 A;  1AU3 A;  3C9E A;  3OIS A;  3IV2 A;  4CDC B;  2G8E A;  3H8C A;  1ME3 A;  2DCA A;  1GLO A;  1QXP A;  5CVN B;  2DCD A;  3S3Q A;  1PBH A;  1DF0 A;  3O1G A;  3ERV A;  1STF E;  2VFB A;  1AU2 A;  4DMY A;  2GHU A;  2YJ9 A;  4QRX A;  1MEG A;  1NQC A;  2ATO A;  8PCH A;  2FYE A;  1F29 A;  5EF4 A;  4W5B A;  5JH3 A;  2DC6 A;  2DCB A;  1KFX L;  3LXS A;  2HHN A;  2BSZ A;  4QH6 A;  1NPZ A;  4B55 A;  1KFU L;  2AYN A;  1CTE A;  1U9W A;  3P5V A;  1YK8 A;  3AI8 A;  2FRA A;  3IOQ A;  4FIP A;  2FTD A;  1SNK A;  4CDD B;  2DZY A;  4DMX A;  1VSN A;  3MTN A;  4RY2 A;  3CH3 X;  2DCC A;  1BQI A;  2H7J A;  1X9Y A;  2FRQ A;  3KWZ A;  5J94 A;  3CBK A;  4W5C A;  5PAD A;  7PCK A;  3HHI A;  4FK5 A;  3HD3 A;  4XUI A;  4YYW A;  1YT7 A;  2XU4 A;  1CSB B;  1W6F A;  2GFO A;  2OP3 A;  1M6D A;  4X6J A;  1F2C A;  4YYR A;  1NL6 A;  3HWN A;  2AUZ A;  1Q6K A;  4C5P A;  1GCB A;  3OF8 A;  1A6R A;  4YYU A;  4HWY A;  2IBI A;  1MEM A;  3P5W A;  1U5I A;  3D9W A;  1TU6 A;  4XR7 A;  3F5V A;  3QJ3 A;  2NQA A;  2R9O A;  2DJG B;  4NV7 A;  4PI3 A;  2F1G A;  2YJ2 A;  1F2A A;  2P86 A;  4PAD A;  3USV A;  3MHH A;  4I04 A;  2G6D A;  2OUL A;  5F02 A;  1EWP A;  1MS6 A;  2DC9 A;  2G8J A;  3LFY A;  1SP4 B;  1NB3 A;  1NB5 A;  4OEM A;  4X6I A;  3N4C A;  3QT4 A;  2HH5 A;  1FH0 A;  3U8E A;  3P5X A;  1AU0 A;  1QMY A;  4BQV A;  1EF7 A;  3RVV A;  1JQP A;  4BS5 A;  2E03 A;  2G7Y A;  4X6H A;  3O0U A;  6PAD A;  4PP1 A;  2DJF B;  2AS8 A;  2FQ9 A;  1AYV A;  5CVO B;  2B1M A;  2JQG R;  2YJ8 A;  3PW3 A;  1PE6 A;  4YYQ A;  1MDW A;  3BCN A;  2O6X A;  1EWL A;  1U9V A;  2E00 A;  3BOW A;  1ME4 A;  1E2T A;  1DEU A;  2R9M A;  4FJC A;  4KLB A;  1KHQ A;  3IHP A;  1PPP A;  2F7D A;  4N8W A;  3K24 A;  4Q8G A;  1XKG A;  3M99 A;  3WXE A;  4QRG A;  2CIO A;  3K8U A;  1BY8 A;  4N79 A;  2DZZ A;  1HUC B;  3BC3 A;  3RVX A;  1EWM A;  2R6N A;  1EWO A;  2E01 A;  5A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...