2R9OA

Cathepsin s complexed with compound 8
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9oA00
3DF0A 1BQIA 3F5VA 3P5UA 4WA6A 1QOLA 2AIMA 3IHPA 1AECA 3KWBX 3OVZA 4N4ZA 1AU3A 3LXSA 4N8WA 5J94A 4PADA 2DC6A 2AU1A 1GCBA 1VJVA 2FUDA 2R9FA 2JQGR 1KFXL 1CSBB 2G7YA 1KXRA 7PCKA 9PAPA 1F2AA 1GMYA 4CDDB 3IMAA 1ZIVA 5PADA 3KKUA 3V6CA 1ME3A 1NQCA 3ZUAA 1EWOA 3U8EA 1U9WA 4X6HA 1SNKA 4YYUA 3IUTA 1TL9A 3RVVA 1YK7A 4YYSA 1MDWA 3KWZA 2PREA 1NB5A 2BDZA 3H8BA 3RVXA 2O6XA 1O0EA 2G6DA 4KLBA 2HXZA 4FIPA 1CVZA 4Q8GA 3MHHA 2DC8A 3K24A 2H7JA 1BGOA 2FRQA 1PXVA 3QJ3A 3NHEA 3F75A 4X6IA 2XU5A 4XUIA 2YJCA 2FRAA 1POPA 3RVWA 1TU6A 3GCBA 2R9MA 1EWMA 5JA7A 1JQPA 4CDCB 4RY2A 3OISA 3WXFA 4I05A 2YJBA 3IEJA 4MZSA 2DCDA 2AUZA 3P5WA 2YJ2A 2HHNA 4HWYA 2BDLA 2DZZA 1PPNA 3LFYA 4X6JA 2OZ2A 2WBFX 1U9XA 1AU4A 1AYWA 3MORA 2AYOA 4QBBA 3K9MA 5CVOB 3H6SA 1QMYA 2PNSA 2PBHA 1Y4HA 2YJ9A 4CDFB 1K3BB 1F2CA 4YV8A 3S3RA 5A24A 1FH0A 1ATKA 3V6EA 3AI8A 1U5IA 3WXGA 4PI3A 2NQDB 3S3QA 1KHQA 3H89A 1CV8A 1QXPA 1BY8A 5EGWA 3TNXA 1QDQA 3USVA 2NQIA 3BWKA 2HH5A 2DC9A 2AS8A 5CVMA 4CZWA 3H7DA 2R9NA 4BS6A 5F02A 2FT2A 1MEGA 3IOQA 4BS5A 1F2BA 4I04A 3HD3A 1PPDA 1AU0A 3B79A 2DC7A 2P0RA 2DCCA 2DCBA 3BPMA 3O0UA 3HHAA 2F7DA 3M99A 3P5VA 5JH3A 4MSXA 2GFOA 2XU4A 1YVBA 3KFQA 1SP4B 2ARYA 1PIPA 3OF8A 1IWDA 1AYVA 1S4VA 2VHSA 4Q8HA 3CBKA 1TLOA 2P7UA 2DCAA 3CH2X 1ZCMA 5K16A 2Y6EA 4MZOA 2E00A 4BPVA 4QRGA 3H8CA 4XR7A 1Q6KA 3PBHA 2R6NA 1AYUA 2G8EA 4DMXA 2ACTA 1Y08A 3QSDA 2ATOA 1DF0A 2DZYA 1F29A 2FQ9A 3N3GA 2YJ8A 1MS6A 5EF4A 2R9CA 4PP2E 5CHVA 3O1GA 3K8UA 2NQAA 1U9QX 2IPPB 4W4UA 1NB3A 4FJCA 2AUXA 2XU3A 8PCHA 4CDEB 3E1ZB 1NL6A 3C9EA 2E03A 2F1GA 1PADA 1MEMA 2JQFR 2VHFA 1CB5A 2OP3A 2G8JA 3OVXA 2AYNA 1EWLA 3BOWA 1M6DA 4P6EA 1EWPA 4YYWA 1U9VA 1PPPA 1KFUL 4YYQA 2FYEA 4BQVA 3HHIA 1XKGA 3N3KA 1KHPA 1ICFA 4YVAA 3MTNA 3PDFA 3BPFA 1STFE 4YYRA 1GLOA 2PADA 4G54A 5CVNB 1CQDA 3MHSA 4QH6A 2DJGB 5FPWA 2HD5A 2CIOA 1BP4A 3PNRA 2OULA 2CB5A 3P5XA 3KX1A 1YT7A 3BC3A 1AU2A 1THEA 1ITOA 6PADA 1PCIA 1ME4A 1HUCB 1MIRA 2GHUA 3HWNA 3KSEA 4W5CA 4BSQA 3I3TA 3D6SA 1EF7A 1YK8A 3I06A 3QT4A 4QRVA 2FTDA 5CHTA 2FO5A 3KW9A 4PP1A 3WXEA 4ZUXU 4I07A 2B1NA 4YYVA 2Y5BA 2IBIA 3IV2A 3N4CA 1A6RA 4W5BA 1YALA 3CH3X 1CJLA 2E01A 4QRXA 2B1MA 1NLJA 1NPZA 2AVWA 4DMYA 1GECE 3CBJA 4AXLA 1DEUA 1X9YA 4N79A 2P86A 1PPOA 4AXMA 1CPJA 1PE6A 4FK5A 1AIMA 2XU1A 4OEMA 4OELA 1CS8A 4P6GA 3PW3A 3OF9A 2E02A 3ERVA 1VSNA 1PBHA 1CTEA 3BCNA 2C0YA 2NQGA 2R9OA 4K7CA 2DJFB 1MHWA
chains in the Genus database with same CATH superfamily
3DF0A 1BQIA 3F5VA 3P5UA 4WA6A 1QOLA 2AIMA 3IHPA 1AECA 3KWBX 3OVZA 4N4ZA 1AU3A 3LXSA 4N8WA 5J94A 4PADA 2DC6A 2AU1A 1GCBA 1VJVA 2FUDA 2R9FA 4D8IA 2JQGR 1KFXL 1CSBB 2G7YA 1KXRA 7PCKA 9PAPA 1F2AA 1GMYA 5JZEA 4ZTBA 4CDDB 3IMAA 1ZIVA 5PADA 3KKUA 3V6CA 1ME3A 1NQCA 3ZUAA 1EWOA 3U8EA 1U9WA 4X6HA 1SNKA 4YYUA 4MM3B 5KO3A 3IUTA 1TL9A 3RVVA 1YK7A 4YYSA 1MDWA 3KWZA 2PREA 1NB5A 2BDZA 3H8BA 3RVXA 2O6XA 3W30A 1O0EA 2G6DA 4KLBA 2HXZA 4FIPA 1CVZA 4D8EA 4Q8GA 3MHHA 2DC8A 3K24A 2H7JA 1BGOA 2FRQA 1PXVA 3QJ3A 3NHEA 3F75A 4X6IA 2XU5A 4XUIA 2YJCA 2FRAA 1POPA 3RVWA 1TU6A 3GCBA 2R9MA 1EWMA 2FE8A 5JA7A 1JQPA 4CDCB 4RY2A 3ZNHA 3OISA 3B21A 1UKFA 3WXFA 2AGAA 4I05A 2YJBA 3IEJA 4MZSA 4P16A 2DCDA 2AUZA 3P5WA 2YJ2A 2HHNA 4HWYA 2BDLA 2DZZA 1PPNA 3LFYA 4X6JA 3BY4A 4RNAA 2OZ2A 4OVZA 2WBFX 1U9XA 1AU4A 1AYWA 3MORA 2AYOA 4QBBA 3K9MA 4OW0A 5CVOB 3H6SA 1QMYA 2BTWA 2PNSA 2PBHA 2HWKA 3O65A 1Y4HA 2YJ9A 3PHWA 4CDFB 1K3BB 1F2CA 4YV8A 3S3RA 5A24A 1FH0A 3PSEA 4BOUA 1ATKA 3V6EA 3AI8A 1U5IA 3WXGA 4PI3A 2NQDB 4A5UA 3S3QA 1KHQA 3H89A 1CV8A 1QXPA 1BY8A 5EGWA 3TNXA 1QDQA 3USVA 4OVZB 2NQIA 3BWKA 2HH5A 2DC9A 2AS8A 5CVMA 4CZWA 3H7DA 2R9NA 4GUAA 4BS6A 5F02A 2BTWB 2FT2A 1MEGA 3IOQA 3MTVA 4BOZA 4BS5A 1F2BA 4I04A 3HD3A 1PPDA 3OQCA 4WURA 1AU0A 3B79A 2DC7A 4D8BA 2P0RA 2DCCA 2DCBA 3C0RA 3BPMA 3O0UA 3HHAA 2F7DA 3M99A 3P5VA 5JH3A 4MSXA 2GFOA 2XU4A 1YVBA 3KFQA 1SP4B 4XZXA 5E6JA 2ARYA 3PHXA 1PIPA 3OF8A 4MI7A 1IWDA 1AYVA 1S4VA 2VHSA 4Q8HA 3CBKA 1TLOA 2P7UA 2DCAA 3CH2X 1ZCMA 5K16A 2Y6EA 4MZOA 4BOQA 4RF1A 2E00A 3E9SA 4BPVA 4QRGA 3H8CA 4XR7A 1Q6KA 3PBHA 2R6NA 1AYUA 2G8EA 4DMXA 2ACTA 1Y08A 3QSDA 2ATOA 2DOSA 1DF0A 2DZYA 1F29A 2FQ9A 3N3GA 2YJ8A 1MS6A 5EF4A 2J7QC 2R9CA 4PP2E 5CHVA 3O1GA 3K8UA 3TMPA 2NQAA 1U9QX 2IPPB 4W4UA 1NB3A 2J7QA 4FJCA 2AUXA 2XU3A 8PCHA 4CDEB 3E1ZB 3C9EA 1NL6A 2E03A 2F1GA 1PADA 1MEMA 2UZJA 2JQFR 2VHFA 1CB5A 4BOSA 1PVJA 4RF0A 2OP3A 2G8JA 3OVXA 2AYNA 4IP3A 1EWLA 3BOWA 1M6DA 3BBAA 4P6EA 1EWPA 4YYWA 1U9VA 1PPPA 1KFUL 3PT2A 4YYQA 2FYEA 4BQVA 3HHIA 1XKGA 3N3KA 1KHPA 4BOPA 1ICFA 4YVAA 3MTNA 3PDFA 3BPFA 1STFE 4HXDB 2JTCA 3BB7A 3RNVA 2JRIA 3PHUA 4YYRA 3PRPA 1GLOA 2PADA 4G54A 5CVNB 1DKIA 1CQDA 3MHSA 4R3DA 4QH6A 2DJGB 5FPWA 2HD5A 2CIOA 1BP4A 3W31A 3PNRA 2OULA 2CB5A 3P5XA 3KX1A 4M0WA 1YT7A 3BC3A 1AU2A 1THEA 1ITOA 6PADA 1PCIA 1ME4A 5EZSA 1HUCB 1MIRA 2GHUA 3HWNA 3KSEA 4W5CA 4BSQA 1YZBA 3I3TA 3D6SA 3TRKA 1EF7A 1YK8A 3I06A 3QT4A 4QRVA 2FTDA 5CHTA 2FO5A 3KW9A 4PP1A 3WXEA 4ZUXU 4I07A 2B1NA 4YYVA 2Y5BA 4REZA 2IBIA 5EZQA 3IV2A 3N4CA 1A6RA 4W5BA 3MJ5A 3PRMA 1YALA 3CH3X 1CJLA 2E01A 4QRXA 2Z84A 2B1MA 1NLJA 1NPZA 2AVWA 4DMYA 1GECE 3CBJA 4AXLA 1DEUA 1X9YA 4N79A 2BU3A 3MP2A 2P86A 1PPOA 4AXMA 1CPJA 1PE6A 4FK5A 1AIMA 2XU1A 4OEMA 4OELA 1CS8A 4P6GA 3PW3A 3OF9A 2E02A 3ERVA 1VSNA 1PBHA 1CTEA 4IUMA 4RKXA 4PT5A 3BCNA 2C0YA 2NQGA 2R9OA 4K7CA 3IFUA 2DJFB 1MHWA
chains in the Genus database with same CATH topology
3DF0A 1BQIA 3F5VA 1W4TA 3P5UA 4WA6A 1QOLA 2AIMA 3IHPA 1AECA 3KWBX 3OVZA 4N4ZA 1AU3A 3LXSA 4N8WA 5J94A 4PADA 2DC6A 2AU1A 1GCBA 1VJVA 2FUDA 2R9FA 2JQGR 1KFXL 1CSBB 2G7YA 1W5RA 1KXRA 7PCKA 9PAPA 1F2AA 1GMYA 4NV7A 4CDDB 3IMAA 1ZIVA 5PADA 3KKUA 3V6CA 4C5PA 1ME3A 1NQCA 3ZUAA 1EWOA 3U8EA 1U9WA 4X6HA 1SNKA 4YYUA 3IUTA 1TL9A 3RVVA 1YK7A 4YYSA 1MDWA 3KWZA 2PREA 1NB5A 2BDZA 3H8BA 4NV8A 3RVXA 2O6XA 1O0EA 2G6DA 4KLBA 2HXZA 4FIPA 1CVZA 4Q8GA 3MHHA 2DC8A 3K24A 2VFBA 2H7JA 1BGOA 2FRQA 1PXVA 3QJ3A 3NHEA 3F75A 4X6IA 2XU5A 4XUIA 2YJCA 2FRAA 1POPA 3RVWA 1TU6A 3GCBA 2R9MA 1EWMA 5JA7A 1JQPA 4CDCB 4RY2A 1E2TA 3OISA 3WXFA 4I05A 2YJBA 3IEJA 4MZSA 1W6FA 2DCDA 2AUZA 3P5WA 2YJ2A 2HHNA 4HWYA 2BDLA 2DZZA 1PPNA 3LFYA 4X6JA 3LTWA 2OZ2A 2WBFX 1U9XA 1AU4A 1AYWA 3MORA 2AYOA 4QBBA 3K9MA 5CVOB 3H6SA 1QMYA 2PNSA 2PBHA 1Y4HA 2YJ9A 4CDFB 1K3BB 1F2CA 4YV8A 3S3RA 5A24A 1FH0A 1ATKA 3V6EA 2VFCA 3AI8A 1U5IA 3WXGA 4PI3A 2NQDB 3S3QA 1KHQA 3H89A 1CV8A 1QXPA 1BY8A 5EGWA 3TNXA 1QDQA 3USVA 2NQIA 3BWKA 2HH5A 2DC9A 2AS8A 5CVMA 4CZWA 3H7DA 2R9NA 4BS6A 5F02A 2FT2A 1MEGA 3IOQA 4BS5A 1F2BA 4I04A 3HD3A 1PPDA 1AU0A 3B79A 2DC7A 2BSZA 2P0RA 2DCCA 2DCBA 3BPMA 3O0UA 3HHAA 2F7DA 3M99A 3P5VA 5JH3A 4MSXA 2GFOA 2XU4A 1YVBA 3KFQA 1SP4B 2ARYA 1PIPA 3OF8A 1IWDA 1AYVA 1S4VA 2VHSA 4Q8HA 3CBKA 4BGFA 1TLOA 2P7UA 2DCAA 3CH2X 1ZCMA 5K16A 2Y6EA 4MZOA 4GUZA 2E00A 3D9WA 4BPVA 4QRGA 3H8CA 4XR7A 1Q6KA 3PBHA 2R6NA 1AYUA 2G8EA 4DMXA 2ACTA 1Y08A 3QSDA 2ATOA 1DF0A 2DZYA 1F29A 2FQ9A 3N3GA 2YJ8A 1MS6A 5EF4A 2R9CA 4PP2E 5CHVA 3O1GA 3K8UA 2NQAA 1U9QX 2IPPB 4W4UA 1NB3A 4FJCA 2AUXA 2XU3A 8PCHA 4CDEB 3E1ZB 1NL6A 3C9EA 2E03A 2F1GA 1PADA 1MEMA 2JQFR 2VHFA 1CB5A 2OP3A 2G8JA 3OVXA 2AYNA 1EWLA 3BOWA 1M6DA 4P6EA 1EWPA 4YYWA 1U9VA 1PPPA 1KFUL 4YYQA 2FYEA 4BQVA 3HHIA 1XKGA 3N3KA 1KHPA 1ICFA 4YVAA 3MTNA 3PDFA 3BPFA 1STFE 4YYRA 1GLOA 2PADA 4G54A 5CVNB 1CQDA 3MHSA 4QH6A 2DJGB 5FPWA 2HD5A 2CIOA 1BP4A 3PNRA 2OULA 2CB5A 3P5XA 3KX1A 1YT7A 3BC3A 1AU2A 1THEA 1ITOA 6PADA 1PCIA 1ME4A 1HUCB 1MIRA 2GHUA 3HWNA 3KSEA 4W5CA 4BSQA 3I3TA 3D6SA 1EF7A 1YK8A 3I06A 3QT4A 4QRVA 2FTDA 5CHTA 1GX3A 2FO5A 3KW9A 4PP1A 3WXEA 4ZUXU 4I07A 2B1NA 4YYVA 2Y5BA 2IBIA 3IV2A 3N4CA 1A6RA 4W5BA 1YALA 3CH3X 1CJLA 2E01A 4QRXA 2B1MA 1NLJA 1NPZA 2AVWA 4DMYA 1GECE 3CBJA 4AXLA 1DEUA 1X9YA 4N79A 2P86A 1PPOA 4AXMA 1CPJA 1PE6A 4FK5A 1AIMA 2XU1A 4OEMA 4OELA 1CS8A 4P6GA 3PW3A 3OF9A 2E02A 3ERVA 1VSNA 1PBHA 1CTEA 3BCNA 2C0YA 2NQGA 2R9OA 4K7CA 4B55A 2DJFB 1MHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DF0 A;  1BQI A;  3F5V A;  3P5U A;  4WA6 A;  1QOL A;  2AIM A;  3IHP A;  1AEC A;  3KWB X;  3OVZ A;  4N4Z A;  1AU3 A;  3LXS A;  4N8W A;  5J94 A;  4PAD A;  2DC6 A;  2AU1 A;  1GCB A;  1VJV A;  2FUD A;  2R9F A;  2JQG R;  1KFX L;  1CSB B;  2G7Y A;  1KXR A;  7PCK A;  9PAP A;  1F2A A;  1GMY A;  4CDD B;  3IMA A;  1ZIV A;  5PAD A;  3KKU A;  3V6C A;  1ME3 A;  1NQC A;  3ZUA A;  1EWO A;  3U8E A;  1U9W A;  4X6H A;  1SNK A;  4YYU A;  3IUT A;  1TL9 A;  3RVV A;  1YK7 A;  4YYS A;  1MDW A;  3KWZ A;  2PRE A;  1NB5 A;  2BDZ A;  3H8B A;  3RVX A;  2O6X A;  1O0E A;  2G6D A;  4KLB A;  2HXZ A;  4FIP A;  1CVZ A;  4Q8G A;  3MHH A;  2DC8 A;  3K24 A;  2H7J A;  1BGO A;  2FRQ A;  1PXV A;  3QJ3 A;  3NHE A;  3F75 A;  4X6I A;  2XU5 A;  4XUI A;  2YJC A;  2FRA A;  1POP A;  3RVW A;  1TU6 A;  3GCB A;  2R9M A;  1EWM A;  5JA7 A;  1JQP A;  4CDC B;  4RY2 A;  3OIS A;  3WXF A;  4I05 A;  2YJB A;  3IEJ A;  4MZS A;  2DCD A;  2AUZ A;  3P5W A;  2YJ2 A;  2HHN A;  4HWY A;  2BDL A;  2DZZ A;  1PPN A;  3LFY A;  4X6J A;  2OZ2 A;  2WBF X;  1U9X A;  1AU4 A;  1AYW A;  3MOR A;  2AYO A;  4QBB A;  3K9M A;  5CVO B;  3H6S A;  1QMY A;  2PNS A;  2PBH A;  1Y4H A;  2YJ9 A;  4CDF B;  1K3B B;  1F2C A;  4YV8 A;  3S3R A;  5A24 A;  1FH0 A;  1ATK A;  3V6E A;  3AI8 A;  1U5I A;  3WXG A;  4PI3 A;  2NQD B;  3S3Q A;  1KHQ A;  3H89 A;  1CV8 A;  1QXP A;  1BY8 A;  5EGW A;  3TNX A;  1QDQ A;  3USV A;  2NQI A;  3BWK A;  2HH5 A;  2DC9 A;  2AS8 A;  5CVM A;  4CZW A;  3H7D A;  2R9N A;  4BS6 A;  5F02 A;  2FT2 A;  1MEG A;  3IOQ A;  4BS5 A;  1F2B A;  4I04 A;  3HD3 A;  1PPD A;  1AU0 A;  3B79 A;  2DC7 A;  2P0R A;  2DCC A;  2DCB A;  3BPM A;  3O0U A;  3HHA A;  2F7D A;  3M99 A;  3P5V A;  5JH3 A;  4MSX A;  2GFO A;  2XU4 A;  1YVB A;  3KFQ A;  1SP4 B;  2ARY A;  1PIP A;  3OF8 A;  1IWD A;  1AYV A;  1S4V A;  2VHS A;  4Q8H A;  3CBK A;  1TLO A;  2P7U A;  2DCA A;  3CH2 X;  1ZCM A;  5K16 A;  2Y6E A;  4MZO A;  2E00 A;  4BPV A;  4QRG A;  3H8C A;  4XR7 A;  1Q6K A;  3PBH A;  2R6N A;  1AYU A;  2G8E A;  4DMX A;  2ACT A;  1Y08 A;  3QSD A;  2ATO A;  1DF0 A;  2DZY A;  1F29 A;  2FQ9 A;  3N3G A;  2YJ8 A;  1MS6 A;  5EF4 A;  2R9C A;  4PP2 E;  5CHV A;  3O1G A;  3K8U A;  2NQA A;  1U9Q X;  2IPP B;  4W4U A;  1NB3 A;  4FJC A;  2AUX A;  2XU3 A;  8PCH A;  4CDE B;  3E1Z B;  1NL6 A;  3C9E A;  2E03 A;  2F1G A;  1PAD A;  1MEM A;  2JQF R;  2VHF A;  1CB5 A;  2OP3 A;  2G8J A;  3OVX A;  2AYN A;  1EWL A;  3BOW A;  1M6D A;  4P6E A;  1EWP A;  4YYW A;  1U9V A;  1PPP A;  1KFU L;  4YYQ A;  2FYE A;  4BQV A;  3HHI A;  1XKG A;  3N3K A;  1KHP A;  1ICF A;  4YVA A;  3MTN A;  3PDF A;  3BPF A;  1STF E;  4YYR A;  1GLO A;  2PAD A;  4G54 A;  5CVN B;  1CQD A;  3MHS A;  4QH6 A;  2DJG B;  5FPW A;  2HD5 A;  2CIO A;  1BP4 A;  3PNR A;  2OUL A;  2CB5 A;  3P5X A;  3KX1 A;  1YT7 A;  3BC3 A;  1AU2 A;  1THE A;  1ITO A;  6PAD A;  1PCI A;  1ME4 A;  1HUC B;  1MIR A;  2GHU A;  3HWN A;  3KSE A;  4W5C A;  4BSQ A;  3I3T A;  3D6S A;  1EF7 A;  1YK8 A;  3I06 A;  3QT4 A;  4QRV A;  2FTD A;  5CHT A;  2FO5 A;  3KW9 A;  4PP1 A;  3WXE A;  4ZUX U;  4I07 A;  2B1N A;  4YYV A;  2Y5B A;  2IBI A;  3IV2 A;  3N4C A;  1A6R A;  4W5B A;  1YAL A;  3CH3 X;  1CJL A;  2E01 A;  4QRX A;  2B1M A;  1NLJ A;  1NPZ A;  2AVW A;  4DMY A;  1GEC E;  3CBJ A;  4AXL A;  1DEU A;  1X9Y A;  4N79 A;  2P86 A;  1PPO A;  4AXM A;  1CPJ A;  1PE6 A;  4FK5 A;  1AIM A;  2XU1 A;  4OEM A;  4OEL A;  1CS8 A;  4P6G A;  3PW3 A;  3OF9 A;  2E02 A;  3ERV A;  1VSN A;  1PBH A;  1CTE A;  3BCN A;  2C0Y A;  2NQG A;  2R9O A;  4K7C A;  2DJF B;  1MHW A; 
#chains in the Genus database with same CATH topology
 3DF0 A;  1BQI A;  3F5V A;  3P5U A;  4WA6 A;  1QOL A;  2AIM A;  3IHP A;  1AEC A;  3KWB X;  3OVZ A;  4N4Z A;  1AU3 A;  3LXS A;  4N8W A;  5J94 A;  4PAD A;  2DC6 A;  2AU1 A;  1GCB A;  1VJV A;  2FUD A;  2R9F A;  4D8I A;  2JQG R;  1KFX L;  1CSB B;  2G7Y A;  1KXR A;  7PCK A;  9PAP A;  1F2A A;  1GMY A;  5JZE A;  4ZTB A;  4CDD B;  3IMA A;  1ZIV A;  5PAD A;  3KKU A;  3V6C A;  1ME3 A;  1NQC A;  3ZUA A;  1EWO A;  3U8E A;  1U9W A;  4X6H A;  1SNK A;  4YYU A;  4MM3 B;  5KO3 A;  3IUT A;  1TL9 A;  3RVV A;  1YK7 A;  4YYS A;  1MDW A;  3KWZ A;  2PRE A;  1NB5 A;  2BDZ A;  3H8B A;  3RVX A;  2O6X A;  3W30 A;  1O0E A;  2G6D A;  4KLB A;  2HXZ A;  4FIP A;  1CVZ A;  4D8E A;  4Q8G A;  3MHH A;  2DC8 A;  3K24 A;  2H7J A;  1BGO A;  2FRQ A;  1PXV A;  3QJ3 A;  3NHE A;  3F75 A;  4X6I A;  2XU5 A;  4XUI A;  2YJC A;  2FRA A;  1POP A;  3RVW A;  1TU6 A;  3GCB A;  2R9M A;  1EWM A;  2FE8 A;  5JA7 A;  1JQP A;  4CDC B;  4RY2 A;  3ZNH A;  3OIS A;  3B21 A;  1UKF A;  3WXF A;  2AGA A;  4I05 A;  2YJB A;  3IEJ A;  4MZS A;  4P16 A;  2DCD A;  2AUZ A;  3P5W A;  2YJ2 A;  2HHN A;  4HWY A;  2BDL A;  2DZZ A;  1PPN A;  3LFY A;  4X6J A;  3BY4 A;  4RNA A;  2OZ2 A;  4OVZ A;  2WBF X;  1U9X A;  1AU4 A;  1AYW A;  3MOR A;  2AYO A;  4QBB A;  3K9M A;  4OW0 A;  5CVO B;  3H6S A;  1QMY A;  2BTW A;  2PNS A;  2PBH A;  2HWK A;  3O65 A;  1Y4H A;  2YJ9 A;  3PHW A;  4CDF B;  1K3B B;  1F2C A;  4YV8 A;  3S3R A;  5A24 A;  1FH0 A;  3PSE A;  4BOU A;  1ATK A;  3V6E A;  3AI8 A;  1U5I A;  3WXG A;  4PI3 A;  2NQD B;  4A5U A;  3S3Q A;  1KHQ A;  3H89 A;  1CV8 A;  1QXP A;  1BY8 A;  5EGW A;  3TNX A;  1QDQ A;  3USV A;  4OVZ B;  2NQI A;  3BWK A;  2HH5 A;  2DC9 A;  2AS8 A;  5CVM A;  4CZW A;  3H7D A;  2R9N A;  4GUA A;  4BS6 A;  5F02 A;  2BTW B;  2FT2 A;  1MEG A;  3IOQ A;  3MTV A;  4BOZ A;  4BS5 A;  1F2B A;  4I04 A;  3HD3 A;  1PPD A;  3OQC A;  4WUR A;  1AU0 A;  3B79 A;  2DC7 A;  4D8B A;  2P0R A;  2DCC A;  2DCB A;  3C0R A;  3BPM A;  3O0U A;  3HHA A;  2F7D A;  3M99 A;  3P5V A;  5JH3 A;  4MSX A;  2GFO A;  2XU4 A;  1YVB A;  3KFQ A;  1SP4 B;  4XZX A;  5E6J A;  2ARY A;  3PHX A;  1PIP A;  3OF8 A;  4MI7 A;  1IWD A;  1AYV A;  1S4V A;  2VHS A;  4Q8H A;  3CBK A;  1TLO A;  2P7U A;  2DCA A;  3CH2 X;  1ZCM A;  5K16 A;  2Y6E A;  4MZO A;  4BOQ A;  4RF1 A;  2E00 A;  3E9S A;  4BPV A;  4QRG A;  3H8C A;  4XR7 A;  1Q6K A;  3PBH A;  2R6N A;  1AYU A;  2G8E A;  4DMX A;  2ACT A;  1Y08 A;  3QSD A;  2ATO A;  2DOS A;  1DF0 A;  2DZY A;  1F29 A;  2FQ9 A;  3N3G A;  2YJ8 A;  1MS6 A;  5EF4 A;  2J7Q C;  2R9C A;  4PP2 E;  5CHV A;  3O1G A;  3K8U A;  3TMP A;  2NQA A;  1U9Q X;  2IPP B;  4W4U A;  1NB3 A;  2J7Q A;  4FJC A;  2AUX A;  2XU3 A;  8PCH A;  4CDE B;  3E1Z B;  3C9E A;  1NL6 A;  2E03 A;  2F1G A;  1PAD A;  1MEM A;  2UZJ A;  2JQF R;  2VHF A;  1CB5 A;  4BOS A;  1PVJ A;  4RF0 A;  2OP3 A;  2G8J A;  3OVX A;  2AYN A;  4IP3 A;  1EWL A;  3BOW A;  1M6D A;  3BBA A;  4P6E A;  1EWP A;  4YYW A;  1U9V A;  1PPP A;  1KFU L;  3PT2 A;  4YYQ A;  2FYE A;  4BQV A;  3HHI A;  1XKG A;  3N3K A;  1KHP A;  4BOP A;  1ICF A;  4YVA A;  3MTN A;  3PDF A;  3BPF A;  1STF E;  4HXD B;  2JTC A;  3BB7 A;  3RNV A;  2JRI A;  3PHU A;  4YYR A;  3PRP A;  1GLO A;  2PAD A;  4G54 A;  5CVN B;  1DKI A;  1CQD A;  3MHS A;  4R3D A;  4QH6 A;  2DJG B;  5FPW A;  2HD5 A;  2CIO A;  1BP4 A;  3W31 A;  3PNR A;  2OUL A;  2CB5 A;  3P5X A;  3KX1 A;  4M0W A;  1YT7 A;  3BC3 A;  1AU2 A;  1THE A;  1ITO A;  6PAD A;  1PCI A;  1ME4 A;  5EZS A;  1HUC B;  1MIR A;  2GHU A;  3HWN A;  3KSE A;  4W5C A;  4BSQ A;  1YZB A;  3I3T A;  3D6S A;  3TRK A;  1EF7 A;  1YK8 A;  3I06 A;  3QT4 A;  4QRV A;  2FTD A;  5CHT A;  2FO5 A;  3KW9 A;  4PP1 A;  3WXE A;  4ZUX U;  4I07 A;  2B1N A;  4YYV A;  2Y5B A;  4REZ A;  2IBI A;  5EZQ A;  3IV2 A;  3N4C A;  1A6R A;  4W5B A;  3MJ5 A;  3PRM A;  1YAL A;  3CH3 X;  1CJL A;  2E01 A;  4QRX A;  2Z84 A;  2B1M A;  1NLJ A;  1NPZ A;  2AVW A;  4DMY A;  1GEC E;  3CBJ A;  4AXL A;  1DEU A;  1X9Y A;  4N79 A;  2BU3 A;  3MP2 A;  2P86 A;  1PPO A;  4AXM A;  1CPJ A;  1PE6 A;  4FK5 A;  1AIM A;  2XU1 A;  4OEM A;  4OEL A;  1CS8 A;  4P6G A;  3PW3 A;  3OF9 A;  2E02 A;  3ERV A;  1VSN A;  1PBH A;  1CTE A;  4IUM A;  4RKX A;  4PT5 A;  3BCN A;  2C0Y A;  2NQG A;  2R9O A;  4K7C A;  3IFU A;  2DJF B;  1MHW A; 
#chains in the Genus database with same CATH homology
 3DF0 A;  1BQI A;  3F5V A;  1W4T A;  3P5U A;  4WA6 A;  1QOL A;  2AIM A;  3IHP A;  1AEC A;  3KWB X;  3OVZ A;  4N4Z A;  1AU3 A;  3LXS A;  4N8W A;  5J94 A;  4PAD A;  2DC6 A;  2AU1 A;  1GCB A;  1VJV A;  2FUD A;  2R9F A;  2JQG R;  1KFX L;  1CSB B;  2G7Y A;  1W5R A;  1KXR A;  7PCK A;  9PAP A;  1F2A A;  1GMY A;  4NV7 A;  4CDD B;  3IMA A;  1ZIV A;  5PAD A;  3KKU A;  3V6C A;  4C5P A;  1ME3 A;  1NQC A;  3ZUA A;  1EWO A;  3U8E A;  1U9W A;  4X6H A;  1SNK A;  4YYU A;  3IUT A;  1TL9 A;  3RVV A;  1YK7 A;  4YYS A;  1MDW A;  3KWZ A;  2PRE A;  1NB5 A;  2BDZ A;  3H8B A;  4NV8 A;  3RVX A;  2O6X A;  1O0E A;  2G6D A;  4KLB A;  2HXZ A;  4FIP A;  1CVZ A;  4Q8G A;  3MHH A;  2DC8 A;  3K24 A;  2VFB A;  2H7J A;  1BGO A;  2FRQ A;  1PXV A;  3QJ3 A;  3NHE A;  3F75 A;  4X6I A;  2XU5 A;  4XUI A;  2YJC A;  2FRA A;  1POP A;  3RVW A;  1TU6 A;  3GCB A;  2R9M A;  1EWM A;  5JA7 A;  1JQP A;  4CDC B;  4RY2 A;  1E2T A;  3OIS A;  3WXF A;  4I05 A;  2YJB A;  3IEJ A;  4MZS A;  1W6F A;  2DCD A;  2AUZ A;  3P5W A;  2YJ2 A;  2HHN A;  4HWY A;  2BDL A;  2DZZ A;  1PPN A;  3LFY A;  4X6J A;  3LTW A;  2OZ2 A;  2WBF X;  1U9X A;  1AU4 A;  1AYW A;  3MOR A;  2AYO A;  4QBB A;  3K9M A;  5CVO B;  3H6S A;  1QMY A;  2PNS A;  2PBH A;  1Y4H A;  2YJ9 A;  4CDF B;  1K3B B;  1F2C A;  4YV8 A;  3S3R A;  5A24 A;  1FH0 A;  1ATK A;  3V6E A;  2VFC A;  3AI8 A;  1U5I A;  3WXG A;  4PI3 A;  2NQD B;  3S3Q A;  1KHQ A;  3H89 A;  1CV8 A;  1QXP A;  1BY8 A;  5EGW A;  3TNX A;  1QDQ A;  3USV A;  2NQI A;  3BWK A;  2HH5 A;  2DC9 A;  2AS8 A;  5CVM A;  4CZW A;  3H7D A;  2R9N A;  4BS6 A;  5F02 A;  2FT2 A;  1MEG A;  3IOQ A;  4BS5 A;  1F2B A;  4I04 A;  3HD3 A;  1PPD A;  1AU0 A;  3B79 A;  2DC7 A;  2BSZ A;  2P0R A;  2DCC A;  2DCB A;  3BPM A;  3O0U A;  3HHA A;  2F7D A;  3M99 A;  3P5V A;  5JH3 A;  4MSX A;  2GFO A;  2XU4 A;  1YVB A;  3KFQ A;  1SP4 B;  2ARY A;  1PIP A;  3OF8 A;  1IWD A;  1AYV A;  1S4V A;  2VHS A;  4Q8H A;  3CBK A;  4BGF A;  1TLO A;  2P7U A;  2DCA A;  3CH2 X;  1ZCM A;  5K16 A;  2Y6E A;  4MZO A;  4GUZ A;  2E00 A;  3D9W A;  4BPV A;  4QRG A;  3H8C A;  4XR7 A;  1Q6K A;  3PBH A;  2R6N A;  1AYU A;  2G8E A;  4DMX A;  2ACT A;  1Y08 A;  3QSD A;  2ATO A;  1DF0 A;  2DZY A;  1F29 A;  2FQ9 A;  3N3G A;  2YJ8 A;  1MS6 A;  5EF4 A;  2R9C A;  4PP2 E;  5CHV A;  3O1G A;  3K8U A;  2NQA A;  1U9Q X;  2IPP B;  4W4U A;  1NB3 A;  4FJC A;  2AUX A;  2XU3 A;  8PCH A;  4CDE B;  3E1Z B;  1NL6 A;  3C9E A;  2E03 A;  2F1G A;  1PAD A;  1MEM A;  2JQF R;  2VHF A;  1CB5 A;  2OP3 A;  2G8J A;  3OVX A;  2AYN A;  1EWL A;  3BOW A;  1M6D A;  4P6E A;  1EWP A;  4YYW A;  1U9V A;  1PPP A;  1KFU L;  4YYQ A;  2FYE A;  4BQV A;  3HHI A;  1XKG A;  3N3K A;  1KHP A;  1ICF A;  4YVA A;  3MTN A;  3PDF A;  3BPF A;  1STF E;  4YYR A;  1GLO A;  2PAD A;  4G54 A;  5CVN B;  1CQD A;  3MHS A;  4QH6 A;  2DJG B;  5FPW A;  2HD5 A;  2CIO A;  1BP4 A;  3PNR A;  2OUL A;  2CB5 A;  3P5X A;  3KX1 A;  1YT7 A;  3BC3 A;  1AU2 A;  1THE A;  1ITO A;  6PAD A;  1PCI A;  1ME4 A;  1HUC B;  1MIR A;  2GHU A;  3HWN A;  3KSE A;  4W5C A;  4BSQ A;  3I3T A;  3D6S A;  1EF7 A;  1YK8 A;  3I06 A;  3QT4 A;  4QRV A;  2FTD A;  5CHT A;  1GX3 A;  2FO5 A;  3KW9 A;  4PP1 A;  3WXE A;  4ZUX U;  4I07 A;  2B1N A;  4YYV A;  2Y5B A;  2IBI A;  3IV2 A;  3N4C A;  1A6R A;  4W5B A;  1YAL A;  3CH3 X;  1CJL A;  2E01 A;  4QRX A;  2B1M A;  1NLJ A;  1NPZ A;  2AVW A;  4DMY A;  1GEC E;  3CBJ A;  4AXL A;  1DEU A;  1X9Y A;  4N79 A;  2P86 A;  1PPO A;  4AXM A;  1CPJ A;  1PE6 A;  4FK5 A;  1AIM A;  2XU1 A;  4OEM A;  4OEL A;  1CS8 A;  4P6G A;  3PW3 A;  3OF9 A;  2E02 A;  3ERV A;  1VSN A;  1PBH A;  1CTE A;  3BCN A;  2C0Y A;  2NQG A;  2R9O A;  4K7C A;  4B55 A;  2DJF B;  1MHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...