2R9OA

Cathepsin s complexed with compound 8
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9oA00
4YV8A 3IUTA 2O6XA 4XR7A 2G8JA 4FJCA 3KKUA 4W4UA 3LXSA 2G7YA 1TLOA 1AYWA 4MZSA 5J94A 3WXFA 3BOWA 3O0UA 4X6HA 1ITOA 4CZWA 1CVZA 3KWBX 3V6EA 1HUCB 1O0EA 1THEA 1NLJA 5CVMA 1CV8A 1BQIA 4OEMA 5JH3A 1NB5A 3H8CA 4X6JA 1PPOA 3BPMA 4OELA 3WXGA 3CBKA 1BY8A 3DF0A 3S3QA 1S4VA 1MHWA 2G8EA 4YYVA 2DZZA 2AS8A 3I3TA 2YJ9A 1DF0A 1NB3A 4PP2E 4PP1A 2AIMA 4CDDB 1ME3A 3WXEA 2IBIA 1EWOA 1EWMA 1U5IA 4X6IA 2VHSA 3MHSA 1F29A 4P6GA 2ARYA 2YJ2A 2P0RA 4DMYA 2OZ2A 2F1GA 2DJFB 2JQGR 4I05A 3F75A 1F2BA 2XU3A 5CHTA 1NPZA 2CIOA 1MS6A 2HHNA 1MEGA 2E00A 3MHHA 3ZUAA 3E1ZB 2DC8A 4MSXA 3IMAA 3N3GA 4BPVA 2DC9A 3CBJA 2NQIA 3HD3A 1AECA 1MIRA 3QSDA 4I04A 2DC7A 1GECE 4FIPA 1GLOA 5CHVA 1FH0A 1STFE 4FK5A 1POPA 2YJCA 1U9QX 1A6RA 3PW3A 2R6NA 3H7DA 3RVWA 3H89A 4YYUA 2BDLA 4ZUXU 2B1NA 4N4ZA 4AXMA 3QJ3A 2DZYA 4QRVA 1U9WA 1CPJA 3MTNA 4QRXA 3H6SA 1AYUA 3ERVA 1EF7A 3O1GA 2NQDB 2R9FA 2YJBA 5CVNB 2Y6EA 2FRAA 4PI3A 3PBHA 3N4CA 2OULA 4YYWA 1CSBB 1CB5A 3KFQA 2AVWA 1BP4A 1SNKA 4BSQA 4YYQA 2ATOA 1TU6A 3QT4A 4RY2A 2AYNA 3K8UA 3IOQA 4HWYA 1ATKA 1PE6A 1IWDA 1DEUA 3OISA 1PBHA 3P5WA 3MORA 3KWZA 4WA6A 4AXLA 4BS6A 3C9EA 1ZCMA 3OF8A 3U8EA 2GHUA 4YVAA 5FPWA 3BPFA 1PPDA 3S3RA 2DCAA 2VHFA 3IV2A 2AUZA 3K24A 2XU4A 2WBFX 2DJGB 3M99A 3I06A 1AU4A 2FUDA 2FTDA 1VSNA 1Q6KA 2R9OA 1KFXL 1SP4B 1YK7A 2CB5A 1EWLA 2E01A 3D6SA 3V6CA 1KFUL 4Q8GA 3OVXA 3KW9A 1PIPA 2B1MA 1QXPA 3NHEA 2DCDA 1ME4A 5EF4A 1PADA 2R9NA 4G54A 1F2AA 1PPNA 1Y08A 1PCIA 4BQVA 3RVXA 2PREA 3PNRA 4Q8HA 2PBHA 1YK8A 4KLBA 2E02A 2C0YA 1AU2A 3HHIA 1QMYA 4CDCB 2G6DA 3PDFA 6PADA 7PCKA 4QRGA 1QDQA 1ICFA 3B79A 3KX1A 4YYSA 5A24A 1XKGA 2PNSA 1KHQA 1GCBA 1YALA 2HH5A 3P5XA 1ZIVA 4MZOA 2DC6A 1NL6A 2HD5A 1JQPA 2GFOA 3N3KA 4W5BA 4CDEB 2XU1A 2FT2A 2P7UA 4XUIA 3OF9A 2Y5BA 1PXVA 3P5UA 1NQCA 1AU0A 2AU1A 2NQAA 9PAPA 3HWNA 3F5VA 5PADA 3K9MA 3HHAA 1AIMA 1YVBA 3CH2X 2HXZA 3IHPA 3IEJA 4P6EA 1X9YA 2BDZA 4K7CA 3USVA 8PCHA 1CQDA 2AUXA 1AYVA 1M6DA 1BGOA 3H8BA 2F7DA 2XU5A 1TL9A 1YT7A 5F02A 4BS5A 2E03A 1Y4HA 4QBBA 1QOLA 2R9MA 3GCBA 3BWKA 2FO5A 3RVVA 2DCCA 3TNXA 1PPPA 3AI8A 4CDFB 2YJ8A 1U9XA 1CTEA 3LFYA 4PADA 2DCBA 1U9VA 3BCNA 1AU3A 2FYEA 2H7JA 1GMYA 1MEMA 2ACTA 2JQFR 1KXRA 1VJVA 2PADA 2R9CA 1EWPA 5EGWA 4QH6A 4I07A 1MDWA 3CH3X 4DMXA 3P5VA 2AYOA 2FQ9A 1KHPA 1CJLA 2IPPB 4YYRA 2NQGA 1F2CA 5CVOB 4N79A 4W5CA 1CS8A 5K16A 3OVZA 2FRQA 1K3BB 4N8WA 2P86A 2OP3A 3BC3A 5JA7A 3KSEA
chains in the Genus database with same CATH superfamily
3PHXA 4YV8A 3IUTA 2O6XA 4XR7A 2G8JA 4FJCA 2UZJA 3KKUA 4W4UA 3LXSA 2G7YA 1TLOA 1AYWA 4MZSA 5J94A 3WXFA 3BOWA 3O0UA 4X6HA 4ZTBA 1ITOA 4CZWA 1CVZA 5JZEA 3MJ5A 3KWBX 3V6EA 1HUCB 1O0EA 1THEA 1NLJA 5CVMA 1CV8A 5KO3A 1BQIA 4OEMA 4MI7A 5JH3A 1NB5A 3H8CA 3BY4A 4X6JA 1PPOA 3BPMA 4OELA 3WXGA 3CBKA 1BY8A 3DF0A 4XZXA 3S3QA 1S4VA 1MHWA 4MM3B 2G8EA 4YYVA 2DZZA 2AS8A 3I3TA 3MTVA 2YJ9A 4OVZB 1DF0A 2J7QA 1NB3A 4PP2E 4PP1A 2AIMA 4CDDB 1ME3A 3WXEA 2IBIA 1EWOA 1EWMA 1U5IA 4X6IA 2VHSA 2JTCA 3MHSA 1F29A 4P6GA 2ARYA 2YJ2A 2P0RA 4DMYA 2OZ2A 4M0WA 2F1GA 2DJFB 2JQGR 4I05A 3F75A 1F2BA 2XU3A 5CHTA 1NPZA 2CIOA 1MS6A 2HHNA 1MEGA 2E00A 3MHHA 3ZUAA 1UKFA 3PRPA 3E1ZB 2DC8A 3IFUA 4MSXA 3IMAA 3N3GA 4BPVA 2DC9A 3CBJA 2NQIA 3HD3A 1AECA 3TMPA 1MIRA 3QSDA 2J7QC 4I04A 2DC7A 1GECE 4FIPA 1GLOA 5CHVA 1FH0A 1STFE 3OQCA 4FK5A 1POPA 2YJCA 1U9QX 1A6RA 3W31A 3PW3A 2R6NA 3H7DA 3RVWA 3H89A 4YYUA 4BOUA 2BDLA 4ZUXU 2B1NA 4N4ZA 4AXMA 3QJ3A 2DZYA 4QRVA 4IUMA 3TRKA 1U9WA 1CPJA 3MTNA 4QRXA 3H6SA 1AYUA 3ERVA 1EF7A 3O1GA 2NQDB 2R9FA 2YJBA 5CVNB 1PVJA 2Y6EA 2BTWB 2FRAA 4PI3A 3PBHA 3N4CA 2OULA 4YYWA 3PT2A 1CSBB 4BOSA 1CB5A 2Z84A 3KFQA 2AVWA 1BP4A 4D8BA 1SNKA 3BB7A 4BSQA 4YYQA 2ATOA 4WURA 1TU6A 3QT4A 4RY2A 2AYNA 3K8UA 3IOQA 4HWYA 4BOPA 1ATKA 4P16A 1PE6A 1IWDA 1DEUA 3OISA 1PBHA 3P5WA 4RKXA 3MORA 3KWZA 4WA6A 4AXLA 4BS6A 3C9EA 1ZCMA 3OF8A 3U8EA 2GHUA 2HWKA 4YVAA 3PSEA 5FPWA 3BPFA 1PPDA 3S3RA 2DCAA 2VHFA 3IV2A 2AUZA 3O65A 3K24A 2XU4A 2WBFX 2DJGB 3M99A 3I06A 1AU4A 2FUDA 2FTDA 1VSNA 3E9SA 1Q6KA 5EZQA 2R9OA 1KFXL 1SP4B 1YK7A 2CB5A 1EWLA 2E01A 3D6SA 3V6CA 1KFUL 4Q8GA 3OVXA 3KW9A 1PIPA 5EZSA 2B1MA 1QXPA 3NHEA 1YZBA 2DCDA 1ME4A 5EF4A 1PADA 2R9NA 4G54A 1F2AA 1PPNA 1Y08A 1PCIA 4BQVA 4RF1A 3RVXA 2PREA 3PNRA 4Q8HA 2PBHA 4D8IA 1YK8A 4A5UA 4KLBA 2E02A 2C0YA 1AU2A 3HHIA 1QMYA 4CDCB 2G6DA 3PDFA 3W30A 6PADA 7PCKA 4D8EA 4QRGA 1QDQA 1ICFA 3B79A 3KX1A 3PRMA 4YYSA 5A24A 1XKGA 2PNSA 1KHQA 1GCBA 1YALA 2HH5A 3PHUA 3PHWA 4IP3A 3P5XA 1ZIVA 4MZOA 2DC6A 1NL6A 2HD5A 1JQPA 2GFOA 4BOQA 3N3KA 3MP2A 4W5BA 4CDEB 2XU1A 4RNAA 2FT2A 2P7UA 4XUIA 3OF9A 2Y5BA 1PXVA 3P5UA 1NQCA 1AU0A 2AU1A 2NQAA 9PAPA 3HWNA 3F5VA 2BU3A 5PADA 3K9MA 3HHAA 1AIMA 1YVBA 3B21A 2BTWA 3CH2X 2HXZA 3IHPA 3IEJA 4P6EA 1X9YA 2BDZA 4K7CA 3USVA 8PCHA 4PT5A 1CQDA 2AUXA 1AYVA 1M6DA 1BGOA 3H8BA 2F7DA 2FE8A 2XU5A 1TL9A 1YT7A 4HXDB 2DOSA 5F02A 2E03A 4BS5A 1Y4HA 4QBBA 1QOLA 2R9MA 3GCBA 3BWKA 2FO5A 3RVVA 2DCCA 3TNXA 1PPPA 3AI8A 4CDFB 4OVZA 2YJ8A 1U9XA 4OW0A 1CTEA 3LFYA 4PADA 2DCBA 2AGAA 1U9VA 3BCNA 1AU3A 2FYEA 2H7JA 1GMYA 1MEMA 3BBAA 2ACTA 2JQFR 1KXRA 1VJVA 2PADA 2R9CA 4GUAA 1EWPA 5EGWA 4QH6A 4I07A 1MDWA 3CH3X 3ZNHA 4DMXA 2JRIA 4R3DA 3P5VA 2AYOA 2FQ9A 3RNVA 1KHPA 5E6JA 1CJLA 2IPPB 4YYRA 2NQGA 4REZA 1DKIA 4BOZA 3C0RA 1F2CA 5CVOB 4RF0A 4N79A 4W5CA 1CS8A 5K16A 3OVZA 2FRQA 1K3BB 4N8WA 2P86A 2OP3A 3BC3A 5JA7A 3KSEA
chains in the Genus database with same CATH topology
4YV8A 3D9WA 1W4TA 3IUTA 2O6XA 4XR7A 2G8JA 4FJCA 3KKUA 4W4UA 3LXSA 2G7YA 1TLOA 1AYWA 4MZSA 5J94A 3WXFA 3BOWA 3O0UA 4X6HA 1W5RA 1ITOA 4CZWA 1CVZA 3KWBX 3V6EA 1HUCB 1O0EA 1THEA 1NLJA 5CVMA 1CV8A 1BQIA 4OEMA 5JH3A 1NB5A 3H8CA 4X6JA 1PPOA 3BPMA 4OELA 3WXGA 3CBKA 1BY8A 3DF0A 3S3QA 1S4VA 1MHWA 2G8EA 4YYVA 2DZZA 2AS8A 3I3TA 2YJ9A 1DF0A 1NB3A 4PP2E 4PP1A 2AIMA 4CDDB 1ME3A 3WXEA 2IBIA 1EWOA 1EWMA 1U5IA 4X6IA 1GX3A 2VHSA 3MHSA 1F29A 4P6GA 2ARYA 2YJ2A 2P0RA 4DMYA 2OZ2A 2F1GA 2DJFB 2JQGR 4I05A 3F75A 1F2BA 2XU3A 1W6FA 5CHTA 1NPZA 2CIOA 1MS6A 2HHNA 1MEGA 2E00A 3MHHA 3ZUAA 3E1ZB 2DC8A 3LTWA 4MSXA 3IMAA 3N3GA 4BPVA 2DC9A 3CBJA 2NQIA 3HD3A 1AECA 2BSZA 4B55A 1MIRA 3QSDA 4I04A 2DC7A 1GECE 4FIPA 1GLOA 5CHVA 1FH0A 1STFE 4FK5A 1POPA 2YJCA 1U9QX 1A6RA 1E2TA 3PW3A 2R6NA 3H7DA 3RVWA 3H89A 4YYUA 2BDLA 4ZUXU 2B1NA 4N4ZA 4AXMA 3QJ3A 2DZYA 4QRVA 1U9WA 1CPJA 3MTNA 4QRXA 3H6SA 1AYUA 3ERVA 1EF7A 3O1GA 2NQDB 2R9FA 2VFBA 2YJBA 5CVNB 2Y6EA 2FRAA 4PI3A 3PBHA 3N4CA 2OULA 4YYWA 1CSBB 1CB5A 3KFQA 2AVWA 1BP4A 1SNKA 4BSQA 4YYQA 2ATOA 1TU6A 3QT4A 4RY2A 2AYNA 3K8UA 3IOQA 4HWYA 1ATKA 1PE6A 1IWDA 1DEUA 3OISA 1PBHA 3P5WA 3MORA 3KWZA 4WA6A 4GUZA 4AXLA 4BS6A 3C9EA 1ZCMA 3OF8A 3U8EA 2GHUA 4YVAA 5FPWA 3BPFA 1PPDA 3S3RA 2DCAA 2VHFA 3IV2A 2AUZA 3K24A 2XU4A 2WBFX 2DJGB 3M99A 2VFCA 3I06A 1AU4A 2FUDA 2FTDA 1VSNA 1Q6KA 2R9OA 1KFXL 4NV7A 1SP4B 1YK7A 2CB5A 1EWLA 2E01A 3D6SA 3V6CA 1KFUL 4Q8GA 3OVXA 3KW9A 1PIPA 2B1MA 1QXPA 3NHEA 2DCDA 1ME4A 5EF4A 1PADA 2R9NA 4G54A 1F2AA 1PPNA 1Y08A 1PCIA 4BQVA 3RVXA 2PREA 3PNRA 4Q8HA 2PBHA 1YK8A 4KLBA 2E02A 2C0YA 1AU2A 3HHIA 1QMYA 4CDCB 2G6DA 3PDFA 6PADA 7PCKA 4QRGA 1QDQA 1ICFA 3B79A 3KX1A 4YYSA 5A24A 1XKGA 2PNSA 1KHQA 1GCBA 1YALA 2HH5A 3P5XA 1ZIVA 4MZOA 2DC6A 1NL6A 2HD5A 1JQPA 2GFOA 3N3KA 4W5BA 4CDEB 2XU1A 2FT2A 2P7UA 4XUIA 3OF9A 2Y5BA 4C5PA 1PXVA 3P5UA 1NQCA 1AU0A 2AU1A 2NQAA 9PAPA 3HWNA 3F5VA 5PADA 3K9MA 3HHAA 1AIMA 1YVBA 3CH2X 2HXZA 3IHPA 3IEJA 4P6EA 1X9YA 2BDZA 4K7CA 3USVA 4BGFA 8PCHA 1CQDA 2AUXA 1AYVA 1M6DA 1BGOA 3H8BA 2F7DA 2XU5A 1TL9A 1YT7A 5F02A 4BS5A 2E03A 1Y4HA 4QBBA 1QOLA 2R9MA 3GCBA 3BWKA 2FO5A 3RVVA 2DCCA 3TNXA 1PPPA 3AI8A 4CDFB 2YJ8A 1U9XA 1CTEA 3LFYA 4PADA 2DCBA 1U9VA 3BCNA 1AU3A 2FYEA 2H7JA 1GMYA 1MEMA 2ACTA 2JQFR 1KXRA 1VJVA 2PADA 2R9CA 1EWPA 5EGWA 4QH6A 4I07A 1MDWA 3CH3X 4DMXA 3P5VA 2AYOA 2FQ9A 1KHPA 1CJLA 2IPPB 4YYRA 2NQGA 1F2CA 5CVOB 4N79A 4W5CA 1CS8A 4NV8A 5K16A 3OVZA 2FRQA 1K3BB 4N8WA 2P86A 2OP3A 3BC3A 5JA7A 3KSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YV8 A;  3IUT A;  2O6X A;  4XR7 A;  2G8J A;  4FJC A;  3KKU A;  4W4U A;  3LXS A;  2G7Y A;  1TLO A;  1AYW A;  4MZS A;  5J94 A;  3WXF A;  3BOW A;  3O0U A;  4X6H A;  1ITO A;  4CZW A;  1CVZ A;  3KWB X;  3V6E A;  1HUC B;  1O0E A;  1THE A;  1NLJ A;  5CVM A;  1CV8 A;  1BQI A;  4OEM A;  5JH3 A;  1NB5 A;  3H8C A;  4X6J A;  1PPO A;  3BPM A;  4OEL A;  3WXG A;  3CBK A;  1BY8 A;  3DF0 A;  3S3Q A;  1S4V A;  1MHW A;  2G8E A;  4YYV A;  2DZZ A;  2AS8 A;  3I3T A;  2YJ9 A;  1DF0 A;  1NB3 A;  4PP2 E;  4PP1 A;  2AIM A;  4CDD B;  1ME3 A;  3WXE A;  2IBI A;  1EWO A;  1EWM A;  1U5I A;  4X6I A;  2VHS A;  3MHS A;  1F29 A;  4P6G A;  2ARY A;  2YJ2 A;  2P0R A;  4DMY A;  2OZ2 A;  2F1G A;  2DJF B;  2JQG R;  4I05 A;  3F75 A;  1F2B A;  2XU3 A;  5CHT A;  1NPZ A;  2CIO A;  1MS6 A;  2HHN A;  1MEG A;  2E00 A;  3MHH A;  3ZUA A;  3E1Z B;  2DC8 A;  4MSX A;  3IMA A;  3N3G A;  4BPV A;  2DC9 A;  3CBJ A;  2NQI A;  3HD3 A;  1AEC A;  1MIR A;  3QSD A;  4I04 A;  2DC7 A;  1GEC E;  4FIP A;  1GLO A;  5CHV A;  1FH0 A;  1STF E;  4FK5 A;  1POP A;  2YJC A;  1U9Q X;  1A6R A;  3PW3 A;  2R6N A;  3H7D A;  3RVW A;  3H89 A;  4YYU A;  2BDL A;  4ZUX U;  2B1N A;  4N4Z A;  4AXM A;  3QJ3 A;  2DZY A;  4QRV A;  1U9W A;  1CPJ A;  3MTN A;  4QRX A;  3H6S A;  1AYU A;  3ERV A;  1EF7 A;  3O1G A;  2NQD B;  2R9F A;  2YJB A;  5CVN B;  2Y6E A;  2FRA A;  4PI3 A;  3PBH A;  3N4C A;  2OUL A;  4YYW A;  1CSB B;  1CB5 A;  3KFQ A;  2AVW A;  1BP4 A;  1SNK A;  4BSQ A;  4YYQ A;  2ATO A;  1TU6 A;  3QT4 A;  4RY2 A;  2AYN A;  3K8U A;  3IOQ A;  4HWY A;  1ATK A;  1PE6 A;  1IWD A;  1DEU A;  3OIS A;  1PBH A;  3P5W A;  3MOR A;  3KWZ A;  4WA6 A;  4AXL A;  4BS6 A;  3C9E A;  1ZCM A;  3OF8 A;  3U8E A;  2GHU A;  4YVA A;  5FPW A;  3BPF A;  1PPD A;  3S3R A;  2DCA A;  2VHF A;  3IV2 A;  2AUZ A;  3K24 A;  2XU4 A;  2WBF X;  2DJG B;  3M99 A;  3I06 A;  1AU4 A;  2FUD A;  2FTD A;  1VSN A;  1Q6K A;  2R9O A;  1KFX L;  1SP4 B;  1YK7 A;  2CB5 A;  1EWL A;  2E01 A;  3D6S A;  3V6C A;  1KFU L;  4Q8G A;  3OVX A;  3KW9 A;  1PIP A;  2B1M A;  1QXP A;  3NHE A;  2DCD A;  1ME4 A;  5EF4 A;  1PAD A;  2R9N A;  4G54 A;  1F2A A;  1PPN A;  1Y08 A;  1PCI A;  4BQV A;  3RVX A;  2PRE A;  3PNR A;  4Q8H A;  2PBH A;  1YK8 A;  4KLB A;  2E02 A;  2C0Y A;  1AU2 A;  3HHI A;  1QMY A;  4CDC B;  2G6D A;  3PDF A;  6PAD A;  7PCK A;  4QRG A;  1QDQ A;  1ICF A;  3B79 A;  3KX1 A;  4YYS A;  5A24 A;  1XKG A;  2PNS A;  1KHQ A;  1GCB A;  1YAL A;  2HH5 A;  3P5X A;  1ZIV A;  4MZO A;  2DC6 A;  1NL6 A;  2HD5 A;  1JQP A;  2GFO A;  3N3K A;  4W5B A;  4CDE B;  2XU1 A;  2FT2 A;  2P7U A;  4XUI A;  3OF9 A;  2Y5B A;  1PXV A;  3P5U A;  1NQC A;  1AU0 A;  2AU1 A;  2NQA A;  9PAP A;  3HWN A;  3F5V A;  5PAD A;  3K9M A;  3HHA A;  1AIM A;  1YVB A;  3CH2 X;  2HXZ A;  3IHP A;  3IEJ A;  4P6E A;  1X9Y A;  2BDZ A;  4K7C A;  3USV A;  8PCH A;  1CQD A;  2AUX A;  1AYV A;  1M6D A;  1BGO A;  3H8B A;  2F7D A;  2XU5 A;  1TL9 A;  1YT7 A;  5F02 A;  4BS5 A;  2E03 A;  1Y4H A;  4QBB A;  1QOL A;  2R9M A;  3GCB A;  3BWK A;  2FO5 A;  3RVV A;  2DCC A;  3TNX A;  1PPP A;  3AI8 A;  4CDF B;  2YJ8 A;  1U9X A;  1CTE A;  3LFY A;  4PAD A;  2DCB A;  1U9V A;  3BCN A;  1AU3 A;  2FYE A;  2H7J A;  1GMY A;  1MEM A;  2ACT A;  2JQF R;  1KXR A;  1VJV A;  2PAD A;  2R9C A;  1EWP A;  5EGW A;  4QH6 A;  4I07 A;  1MDW A;  3CH3 X;  4DMX A;  3P5V A;  2AYO A;  2FQ9 A;  1KHP A;  1CJL A;  2IPP B;  4YYR A;  2NQG A;  1F2C A;  5CVO B;  4N79 A;  4W5C A;  1CS8 A;  5K16 A;  3OVZ A;  2FRQ A;  1K3B B;  4N8W A;  2P86 A;  2OP3 A;  3BC3 A;  5JA7 A;  3KSE A; 
#chains in the Genus database with same CATH topology
 3PHX A;  4YV8 A;  3IUT A;  2O6X A;  4XR7 A;  2G8J A;  4FJC A;  2UZJ A;  3KKU A;  4W4U A;  3LXS A;  2G7Y A;  1TLO A;  1AYW A;  4MZS A;  5J94 A;  3WXF A;  3BOW A;  3O0U A;  4X6H A;  4ZTB A;  1ITO A;  4CZW A;  1CVZ A;  5JZE A;  3MJ5 A;  3KWB X;  3V6E A;  1HUC B;  1O0E A;  1THE A;  1NLJ A;  5CVM A;  1CV8 A;  5KO3 A;  1BQI A;  4OEM A;  4MI7 A;  5JH3 A;  1NB5 A;  3H8C A;  3BY4 A;  4X6J A;  1PPO A;  3BPM A;  4OEL A;  3WXG A;  3CBK A;  1BY8 A;  3DF0 A;  4XZX A;  3S3Q A;  1S4V A;  1MHW A;  4MM3 B;  2G8E A;  4YYV A;  2DZZ A;  2AS8 A;  3I3T A;  3MTV A;  2YJ9 A;  4OVZ B;  1DF0 A;  2J7Q A;  1NB3 A;  4PP2 E;  4PP1 A;  2AIM A;  4CDD B;  1ME3 A;  3WXE A;  2IBI A;  1EWO A;  1EWM A;  1U5I A;  4X6I A;  2VHS A;  2JTC A;  3MHS A;  1F29 A;  4P6G A;  2ARY A;  2YJ2 A;  2P0R A;  4DMY A;  2OZ2 A;  4M0W A;  2F1G A;  2DJF B;  2JQG R;  4I05 A;  3F75 A;  1F2B A;  2XU3 A;  5CHT A;  1NPZ A;  2CIO A;  1MS6 A;  2HHN A;  1MEG A;  2E00 A;  3MHH A;  3ZUA A;  1UKF A;  3PRP A;  3E1Z B;  2DC8 A;  3IFU A;  4MSX A;  3IMA A;  3N3G A;  4BPV A;  2DC9 A;  3CBJ A;  2NQI A;  3HD3 A;  1AEC A;  3TMP A;  1MIR A;  3QSD A;  2J7Q C;  4I04 A;  2DC7 A;  1GEC E;  4FIP A;  1GLO A;  5CHV A;  1FH0 A;  1STF E;  3OQC A;  4FK5 A;  1POP A;  2YJC A;  1U9Q X;  1A6R A;  3W31 A;  3PW3 A;  2R6N A;  3H7D A;  3RVW A;  3H89 A;  4YYU A;  4BOU A;  2BDL A;  4ZUX U;  2B1N A;  4N4Z A;  4AXM A;  3QJ3 A;  2DZY A;  4QRV A;  4IUM A;  3TRK A;  1U9W A;  1CPJ A;  3MTN A;  4QRX A;  3H6S A;  1AYU A;  3ERV A;  1EF7 A;  3O1G A;  2NQD B;  2R9F A;  2YJB A;  5CVN B;  1PVJ A;  2Y6E A;  2BTW B;  2FRA A;  4PI3 A;  3PBH A;  3N4C A;  2OUL A;  4YYW A;  3PT2 A;  1CSB B;  4BOS A;  1CB5 A;  2Z84 A;  3KFQ A;  2AVW A;  1BP4 A;  4D8B A;  1SNK A;  3BB7 A;  4BSQ A;  4YYQ A;  2ATO A;  4WUR A;  1TU6 A;  3QT4 A;  4RY2 A;  2AYN A;  3K8U A;  3IOQ A;  4HWY A;  4BOP A;  1ATK A;  4P16 A;  1PE6 A;  1IWD A;  1DEU A;  3OIS A;  1PBH A;  3P5W A;  4RKX A;  3MOR A;  3KWZ A;  4WA6 A;  4AXL A;  4BS6 A;  3C9E A;  1ZCM A;  3OF8 A;  3U8E A;  2GHU A;  2HWK A;  4YVA A;  3PSE A;  5FPW A;  3BPF A;  1PPD A;  3S3R A;  2DCA A;  2VHF A;  3IV2 A;  2AUZ A;  3O65 A;  3K24 A;  2XU4 A;  2WBF X;  2DJG B;  3M99 A;  3I06 A;  1AU4 A;  2FUD A;  2FTD A;  1VSN A;  3E9S A;  1Q6K A;  5EZQ A;  2R9O A;  1KFX L;  1SP4 B;  1YK7 A;  2CB5 A;  1EWL A;  2E01 A;  3D6S A;  3V6C A;  1KFU L;  4Q8G A;  3OVX A;  3KW9 A;  1PIP A;  5EZS A;  2B1M A;  1QXP A;  3NHE A;  1YZB A;  2DCD A;  1ME4 A;  5EF4 A;  1PAD A;  2R9N A;  4G54 A;  1F2A A;  1PPN A;  1Y08 A;  1PCI A;  4BQV A;  4RF1 A;  3RVX A;  2PRE A;  3PNR A;  4Q8H A;  2PBH A;  4D8I A;  1YK8 A;  4A5U A;  4KLB A;  2E02 A;  2C0Y A;  1AU2 A;  3HHI A;  1QMY A;  4CDC B;  2G6D A;  3PDF A;  3W30 A;  6PAD A;  7PCK A;  4D8E A;  4QRG A;  1QDQ A;  1ICF A;  3B79 A;  3KX1 A;  3PRM A;  4YYS A;  5A24 A;  1XKG A;  2PNS A;  1KHQ A;  1GCB A;  1YAL A;  2HH5 A;  3PHU A;  3PHW A;  4IP3 A;  3P5X A;  1ZIV A;  4MZO A;  2DC6 A;  1NL6 A;  2HD5 A;  1JQP A;  2GFO A;  4BOQ A;  3N3K A;  3MP2 A;  4W5B A;  4CDE B;  2XU1 A;  4RNA A;  2FT2 A;  2P7U A;  4XUI A;  3OF9 A;  2Y5B A;  1PXV A;  3P5U A;  1NQC A;  1AU0 A;  2AU1 A;  2NQA A;  9PAP A;  3HWN A;  3F5V A;  2BU3 A;  5PAD A;  3K9M A;  3HHA A;  1AIM A;  1YVB A;  3B21 A;  2BTW A;  3CH2 X;  2HXZ A;  3IHP A;  3IEJ A;  4P6E A;  1X9Y A;  2BDZ A;  4K7C A;  3USV A;  8PCH A;  4PT5 A;  1CQD A;  2AUX A;  1AYV A;  1M6D A;  1BGO A;  3H8B A;  2F7D A;  2FE8 A;  2XU5 A;  1TL9 A;  1YT7 A;  4HXD B;  2DOS A;  5F02 A;  2E03 A;  4BS5 A;  1Y4H A;  4QBB A;  1QOL A;  2R9M A;  3GCB A;  3BWK A;  2FO5 A;  3RVV A;  2DCC A;  3TNX A;  1PPP A;  3AI8 A;  4CDF B;  4OVZ A;  2YJ8 A;  1U9X A;  4OW0 A;  1CTE A;  3LFY A;  4PAD A;  2DCB A;  2AGA A;  1U9V A;  3BCN A;  1AU3 A;  2FYE A;  2H7J A;  1GMY A;  1MEM A;  3BBA A;  2ACT A;  2JQF R;  1KXR A;  1VJV A;  2PAD A;  2R9C A;  4GUA A;  1EWP A;  5EGW A;  4QH6 A;  4I07 A;  1MDW A;  3CH3 X;  3ZNH A;  4DMX A;  2JRI A;  4R3D A;  3P5V A;  2AYO A;  2FQ9 A;  3RNV A;  1KHP A;  5E6J A;  1CJL A;  2IPP B;  4YYR A;  2NQG A;  4REZ A;  1DKI A;  4BOZ A;  3C0R A;  1F2C A;  5CVO B;  4RF0 A;  4N79 A;  4W5C A;  1CS8 A;  5K16 A;  3OVZ A;  2FRQ A;  1K3B B;  4N8W A;  2P86 A;  2OP3 A;  3BC3 A;  5JA7 A;  3KSE A; 
#chains in the Genus database with same CATH homology
 4YV8 A;  3D9W A;  1W4T A;  3IUT A;  2O6X A;  4XR7 A;  2G8J A;  4FJC A;  3KKU A;  4W4U A;  3LXS A;  2G7Y A;  1TLO A;  1AYW A;  4MZS A;  5J94 A;  3WXF A;  3BOW A;  3O0U A;  4X6H A;  1W5R A;  1ITO A;  4CZW A;  1CVZ A;  3KWB X;  3V6E A;  1HUC B;  1O0E A;  1THE A;  1NLJ A;  5CVM A;  1CV8 A;  1BQI A;  4OEM A;  5JH3 A;  1NB5 A;  3H8C A;  4X6J A;  1PPO A;  3BPM A;  4OEL A;  3WXG A;  3CBK A;  1BY8 A;  3DF0 A;  3S3Q A;  1S4V A;  1MHW A;  2G8E A;  4YYV A;  2DZZ A;  2AS8 A;  3I3T A;  2YJ9 A;  1DF0 A;  1NB3 A;  4PP2 E;  4PP1 A;  2AIM A;  4CDD B;  1ME3 A;  3WXE A;  2IBI A;  1EWO A;  1EWM A;  1U5I A;  4X6I A;  1GX3 A;  2VHS A;  3MHS A;  1F29 A;  4P6G A;  2ARY A;  2YJ2 A;  2P0R A;  4DMY A;  2OZ2 A;  2F1G A;  2DJF B;  2JQG R;  4I05 A;  3F75 A;  1F2B A;  2XU3 A;  1W6F A;  5CHT A;  1NPZ A;  2CIO A;  1MS6 A;  2HHN A;  1MEG A;  2E00 A;  3MHH A;  3ZUA A;  3E1Z B;  2DC8 A;  3LTW A;  4MSX A;  3IMA A;  3N3G A;  4BPV A;  2DC9 A;  3CBJ A;  2NQI A;  3HD3 A;  1AEC A;  2BSZ A;  4B55 A;  1MIR A;  3QSD A;  4I04 A;  2DC7 A;  1GEC E;  4FIP A;  1GLO A;  5CHV A;  1FH0 A;  1STF E;  4FK5 A;  1POP A;  2YJC A;  1U9Q X;  1A6R A;  1E2T A;  3PW3 A;  2R6N A;  3H7D A;  3RVW A;  3H89 A;  4YYU A;  2BDL A;  4ZUX U;  2B1N A;  4N4Z A;  4AXM A;  3QJ3 A;  2DZY A;  4QRV A;  1U9W A;  1CPJ A;  3MTN A;  4QRX A;  3H6S A;  1AYU A;  3ERV A;  1EF7 A;  3O1G A;  2NQD B;  2R9F A;  2VFB A;  2YJB A;  5CVN B;  2Y6E A;  2FRA A;  4PI3 A;  3PBH A;  3N4C A;  2OUL A;  4YYW A;  1CSB B;  1CB5 A;  3KFQ A;  2AVW A;  1BP4 A;  1SNK A;  4BSQ A;  4YYQ A;  2ATO A;  1TU6 A;  3QT4 A;  4RY2 A;  2AYN A;  3K8U A;  3IOQ A;  4HWY A;  1ATK A;  1PE6 A;  1IWD A;  1DEU A;  3OIS A;  1PBH A;  3P5W A;  3MOR A;  3KWZ A;  4WA6 A;  4GUZ A;  4AXL A;  4BS6 A;  3C9E A;  1ZCM A;  3OF8 A;  3U8E A;  2GHU A;  4YVA A;  5FPW A;  3BPF A;  1PPD A;  3S3R A;  2DCA A;  2VHF A;  3IV2 A;  2AUZ A;  3K24 A;  2XU4 A;  2WBF X;  2DJG B;  3M99 A;  2VFC A;  3I06 A;  1AU4 A;  2FUD A;  2FTD A;  1VSN A;  1Q6K A;  2R9O A;  1KFX L;  4NV7 A;  1SP4 B;  1YK7 A;  2CB5 A;  1EWL A;  2E01 A;  3D6S A;  3V6C A;  1KFU L;  4Q8G A;  3OVX A;  3KW9 A;  1PIP A;  2B1M A;  1QXP A;  3NHE A;  2DCD A;  1ME4 A;  5EF4 A;  1PAD A;  2R9N A;  4G54 A;  1F2A A;  1PPN A;  1Y08 A;  1PCI A;  4BQV A;  3RVX A;  2PRE A;  3PNR A;  4Q8H A;  2PBH A;  1YK8 A;  4KLB A;  2E02 A;  2C0Y A;  1AU2 A;  3HHI A;  1QMY A;  4CDC B;  2G6D A;  3PDF A;  6PAD A;  7PCK A;  4QRG A;  1QDQ A;  1ICF A;  3B79 A;  3KX1 A;  4YYS A;  5A24 A;  1XKG A;  2PNS A;  1KHQ A;  1GCB A;  1YAL A;  2HH5 A;  3P5X A;  1ZIV A;  4MZO A;  2DC6 A;  1NL6 A;  2HD5 A;  1JQP A;  2GFO A;  3N3K A;  4W5B A;  4CDE B;  2XU1 A;  2FT2 A;  2P7U A;  4XUI A;  3OF9 A;  2Y5B A;  4C5P A;  1PXV A;  3P5U A;  1NQC A;  1AU0 A;  2AU1 A;  2NQA A;  9PAP A;  3HWN A;  3F5V A;  5PAD A;  3K9M A;  3HHA A;  1AIM A;  1YVB A;  3CH2 X;  2HXZ A;  3IHP A;  3IEJ A;  4P6E A;  1X9Y A;  2BDZ A;  4K7C A;  3USV A;  4BGF A;  8PCH A;  1CQD A;  2AUX A;  1AYV A;  1M6D A;  1BGO A;  3H8B A;  2F7D A;  2XU5 A;  1TL9 A;  1YT7 A;  5F02 A;  4BS5 A;  2E03 A;  1Y4H A;  4QBB A;  1QOL A;  2R9M A;  3GCB A;  3BWK A;  2FO5 A;  3RVV A;  2DCC A;  3TNX A;  1PPP A;  3AI8 A;  4CDF B;  2YJ8 A;  1U9X A;  1CTE A;  3LFY A;  4PAD A;  2DCB A;  1U9V A;  3BCN A;  1AU3 A;  2FYE A;  2H7J A;  1GMY A;  1MEM A;  2ACT A;  2JQF R;  1KXR A;  1VJV A;  2PAD A;  2R9C A;  1EWP A;  5EGW A;  4QH6 A;  4I07 A;  1MDW A;  3CH3 X;  4DMX A;  3P5V A;  2AYO A;  2FQ9 A;  1KHP A;  1CJL A;  2IPP B;  4YYR A;  2NQG A;  1F2C A;  5CVO B;  4N79 A;  4W5C A;  1CS8 A;  4NV8 A;  5K16 A;  3OVZ A;  2FRQ A;  1K3B B;  4N8W A;  2P86 A;  2OP3 A;  3BC3 A;  5JA7 A;  3KSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...