2R9OA

Cathepsin s complexed with compound 8
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9oA00
1YK7A 4DMYA 2G8JA 2IPPB 3CBKA 3TNXA 2O6XA 3AI8A 2DCBA 4OELA 5JA7A 2HXZA 4Q8HA 3H8CA 3P5VA 2R9MA 4PP1A 1CTEA 3OISA 1Q6KA 4AXLA 2YJ8A 4I04A 4WA6A 4N79A 3O0UA 3F75A 1AYUA 4P6EA 1PPPA 2CIOA 2XU1A 1PPNA 1EWOA 2NQDB 3KWBX 4W5CA 4XR7A 4ZUXU 2E03A 4X6HA 3PDFA 1EF7A 2R9NA 2G6DA 2BDLA 4YYWA 2FO5A 2YJCA 4Q8GA 2HD5A 4AXMA 1KXRA 2PADA 1AU3A 4CDDB 5CVNB 3PBHA 2HHNA 3KW9A 4QBBA 3HWNA 3GCBA 2AU1A 1ICFA 2DCDA 1GCBA 1EWMA 1ZIVA 1CV8A 3BOWA 2WBFX 1U9XA 3D6SA 3WXEA 2AUZA 1QOLA 3OVXA 2G7YA 3KKUA 1ZCMA 2NQGA 1YALA 3HHIA 3S3RA 2DC6A 2NQIA 1PPOA 1KFXL 1TU6A 3HHAA 5K16A 1HUCB 6PADA 3HD3A 3QJ3A 3BC3A 1CB5A 3QT4A 4N4ZA 4YV8A 2PREA 1YK8A 3N3GA 2AUXA 4X6IA 1THEA 1AYWA 2JQGR 1CSBB 2NQAA 2P7UA 4KLBA 1U9QX 2P86A 2AS8A 3IMAA 3P5XA 3IHPA 1QXPA 2E01A 4W5BA 3C9EA 2E02A 4CDFB 1BP4A 1A6RA 1Y4HA 1CQDA 1YT7A 1TL9A 1KHQA 2DZYA 1NL6A 3BPMA 2AYNA 5CHVA 1NB5A 2DC9A 4MZSA 3I06A 1EWLA 1NLJA 2YJ9A 3IV2A 1PCIA 4P6GA 4QRXA 3WXFA 3IEJA 4QRVA 1ATKA 3KFQA 2HH5A 1PIPA 1BGOA 4K7CA 2Y6EA 1PXVA 1PPDA 3I3TA 2H7JA 3M99A 2ACTA 7PCKA 3B79A 1JQPA 3RVXA 3DF0A 3KSEA 2FRAA 1TLOA 2VHFA 2DJFB 4CDEB 2FUDA 3H7DA 4BPVA 4BS6A 1KHPA 1U9VA 3OVZA 2P0RA 2PNSA 1AECA 1CJLA 1O0EA 5CVOB 3N3KA 3RVVA 2FYEA 1SP4B 2R9FA 3H8BA 2GHUA 1VSNA 1S4VA 2FT2A 5CVMA 1GECE 4X6JA 1U5IA 4QRGA 4PP2E 2XU3A 3MORA 3O1GA 2R6NA 2JQFR 3H89A 1FH0A 3H6SA 4CDCB 4YYUA 5A24A 2F1GA 1SNKA 3KWZA 3LXSA 5EGWA 1CS8A 3WXGA 1F2BA 2ARYA 3BCNA 2C0YA 1STFE 3USVA 4QH6A 2DC7A 3U8EA 2R9OA 3P5WA 2VHSA 5CHTA 3QSDA 5J94A 3MHHA 1IWDA 2DJGB 3CH2X 3K8UA 4YYVA 1POPA 2DCAA 1YVBA 2XU4A 1CVZA 2YJ2A 4I07A 1AIMA 3CBJA 2AVWA 3KX1A 4RY2A 2PBHA 2AYOA 3V6EA 1QMYA 2R9CA 2DC8A 3MTNA 3IOQA 9PAPA 8PCHA 1XKGA 2YJBA 2OZ2A 2OULA 2AIMA 1BQIA 1MEGA 4BQVA 1QDQA 2FTDA 2GFOA 1MS6A 1PBHA 2F7DA 5F02A 1CPJA 4PI3A 3OF8A 5JH3A 4YYSA 3IUTA 3BWKA 1M6DA 3ZUAA 1ITOA 4FK5A 1Y08A 2DZZA 4FJCA 1ME4A 1MIRA 1NPZA 1MDWA 3RVWA 3P5UA 1AU2A 3CH3X 1EWPA 1NQCA 1MEMA 1PADA 2DCCA 1KFUL 4W4UA 4CZWA 2ATOA 1VJVA 4G54A 5FPWA 2CB5A 2Y5BA 4I05A 3BPFA 4OEMA 4PADA 1AU4A 1K3BB 1GMYA 3E1ZB 1AYVA 4XUIA 4YYQA 1BY8A 1F2CA 2BDZA 1PE6A 1DF0A 2B1NA 5EF4A 4HWYA 3PW3A 2FQ9A 4FIPA 5PADA 3V6CA 4DMXA 4BS5A 3MHSA 3N4CA 3F5VA 1GLOA 2E00A 1DEUA 2IBIA 4BSQA 1AU0A 4YYRA 3OF9A 1NB3A 1U9WA 3LFYA 1X9YA 1F29A 3K9MA 2G8EA 4MZOA 3S3QA 4YVAA 3K24A 1F2AA 3NHEA 1ME3A 1MHWA 2FRQA 2B1MA 4N8WA 2XU5A 4MSXA 2OP3A 3ERVA 3PNRA
chains in the Genus database with same CATH superfamily
1YK7A 4DMYA 2G8JA 2IPPB 3CBKA 3PRPA 3TNXA 2O6XA 3AI8A 2DCBA 3PT2A 4OELA 5JA7A 2HXZA 4Q8HA 3H8CA 3P5VA 2R9MA 4PP1A 1CTEA 3OISA 4BOSA 1DKIA 1Q6KA 4RNAA 4AXLA 3RNVA 2YJ8A 4I04A 4WA6A 4N79A 3O0UA 3F75A 1AYUA 4P6EA 1PPPA 2CIOA 2XU1A 1PPNA 1EWOA 2NQDB 3KWBX 4W5CA 4XR7A 4ZUXU 2E03A 4X6HA 3PDFA 1EF7A 2R9NA 2G6DA 2BDLA 4YYWA 2FO5A 2YJCA 4Q8GA 2HD5A 4AXMA 1KXRA 2PADA 1AU3A 4CDDB 5CVNB 2BU3A 3PBHA 2HHNA 5EZQA 3KW9A 4QBBA 3BB7A 3HWNA 3GCBA 2AU1A 1ICFA 2DCDA 1GCBA 1EWMA 1ZIVA 1CV8A 3BOWA 2WBFX 1U9XA 3D6SA 3WXEA 2AUZA 1QOLA 3OVXA 2G7YA 3KKUA 2JTCA 1ZCMA 2NQGA 4IUMA 1YALA 3HHIA 3S3RA 2DC6A 2NQIA 1PVJA 1PPOA 1KFXL 1TU6A 4IP3A 3HHAA 5K16A 1HUCB 6PADA 3HD3A 3QJ3A 3BC3A 1CB5A 3QT4A 4N4ZA 4YV8A 2PREA 1YK8A 3N3GA 2AUXA 4X6IA 1THEA 1AYWA 2JQGR 1CSBB 2NQAA 2P7UA 4KLBA 1U9QX 4GUAA 2P86A 4XZXA 4PT5A 5KO3A 2AS8A 3IMAA 3P5XA 4RF0A 3BBAA 3IHPA 4BOQA 1QXPA 2E01A 4W5BA 3C9EA 2BTWA 3W31A 2E02A 4CDFB 1BP4A 1A6RA 1UKFA 1Y4HA 1CQDA 1YT7A 1TL9A 1YZBA 3IFUA 1KHQA 2DZYA 1NL6A 4RKXA 3BPMA 2AYNA 3O65A 5CHVA 1NB5A 2DC9A 4MZSA 3I06A 1EWLA 1NLJA 2YJ9A 3IV2A 4RF1A 1PCIA 4P6GA 4QRXA 3WXFA 3IEJA 4R3DA 2FE8A 4QRVA 3ZNHA 1ATKA 3KFQA 2HH5A 1PIPA 1BGOA 4K7CA 2Y6EA 1PXVA 1PPDA 3I3TA 3C0RA 2H7JA 4HXDB 3M99A 2ACTA 2Z84A 7PCKA 3B79A 1JQPA 3RVXA 3DF0A 3KSEA 2FRAA 1TLOA 4M0WA 2VHFA 2DJFB 4CDEB 3B21A 4D8EA 4OW0A 2FUDA 3H7DA 4BPVA 4BS6A 1KHPA 1U9VA 2J7QA 3OVZA 3W30A 2P0RA 2PNSA 1AECA 1CJLA 1O0EA 5CVOB 3N3KA 3RVVA 2FYEA 4OVZA 1SP4B 2R9FA 3H8BA 2GHUA 1VSNA 1S4VA 4BOZA 2FT2A 4WURA 5CVMA 1GECE 4X6JA 1U5IA 3OQCA 4QRGA 4PP2E 2XU3A 3MORA 3O1GA 2R6NA 2JQFR 3H89A 1FH0A 3H6SA 4CDCB 4YYUA 5A24A 2F1GA 5EZSA 1SNKA 3KWZA 3LXSA 5EGWA 1CS8A 3WXGA 1F2BA 2J7QC 2ARYA 3BCNA 2C0YA 1STFE 4QH6A 3USVA 2DC7A 3U8EA 2R9OA 3P5WA 2HWKA 2VHSA 5CHTA 3QSDA 5J94A 4D8IA 3MHHA 1IWDA 2DJGB 3CH2X 3K8UA 4YYVA 1POPA 2DCAA 1YVBA 2XU4A 1CVZA 2YJ2A 4I07A 1AIMA 3CBJA 2AVWA 3BY4A 3KX1A 4OVZB 4RY2A 2PBHA 2AYOA 3V6EA 1QMYA 4BOPA 4P16A 2R9CA 2DC8A 3MTNA 3IOQA 9PAPA 8PCHA 1XKGA 2YJBA 2OZ2A 3MP2A 2OULA 2AIMA 1BQIA 1MEGA 4BQVA 1QDQA 2FTDA 2GFOA 1MS6A 1PBHA 2F7DA 5F02A 1CPJA 4PI3A 3OF8A 3MJ5A 5JH3A 4YYSA 3IUTA 3BWKA 1M6DA 3ZUAA 1ITOA 4FK5A 3MTVA 1Y08A 3PHXA 2DZZA 4ZTBA 4FJCA 1ME4A 1MIRA 1NPZA 1MDWA 2AGAA 4A5UA 3RVWA 3P5UA 3TRKA 1AU2A 3CH3X 1EWPA 1NQCA 1MEMA 1PADA 2DCCA 1KFUL 4W4UA 3PHUA 4CZWA 2ATOA 2JRIA 1VJVA 4G54A 5FPWA 2CB5A 2Y5BA 4I05A 3BPFA 4OEMA 4PADA 1AU4A 1K3BB 1GMYA 2BTWB 4MM3B 3E1ZB 1AYVA 4XUIA 4YYQA 1BY8A 1F2CA 3E9SA 2BDZA 1PE6A 1DF0A 2B1NA 4BOUA 5EF4A 5JZEA 4HWYA 3PW3A 2FQ9A 4FIPA 5PADA 3V6CA 3PSEA 4DMXA 3PRMA 4BS5A 3MHSA 3TMPA 3N4CA 3F5VA 3PHWA 4MI7A 1GLOA 4D8BA 2E00A 1DEUA 2IBIA 4BSQA 1AU0A 4YYRA 5E6JA 3OF9A 1NB3A 1U9WA 3LFYA 1X9YA 1F29A 3K9MA 4REZA 2G8EA 4MZOA 3S3QA 4YVAA 3K24A 1F2AA 3NHEA 1ME3A 1MHWA 2FRQA 2DOSA 2B1MA 4N8WA 2XU5A 4MSXA 2OP3A 3ERVA 3PNRA 2UZJA
chains in the Genus database with same CATH topology
1YK7A 4DMYA 2G8JA 2IPPB 3CBKA 3TNXA 2O6XA 3AI8A 2DCBA 4OELA 5JA7A 2HXZA 4Q8HA 3H8CA 3P5VA 2R9MA 4PP1A 1CTEA 3OISA 1Q6KA 4AXLA 2YJ8A 4I04A 4WA6A 4N79A 3O0UA 3F75A 1AYUA 4P6EA 1PPPA 2CIOA 2XU1A 1PPNA 1EWOA 2NQDB 3KWBX 4W5CA 4XR7A 4ZUXU 2E03A 4X6HA 3PDFA 1EF7A 2R9NA 3LTWA 2G6DA 2BDLA 4YYWA 2FO5A 2YJCA 4Q8GA 2HD5A 4AXMA 1KXRA 2PADA 1AU3A 4CDDB 2VFCA 5CVNB 3PBHA 2HHNA 3KW9A 4QBBA 3HWNA 3GCBA 2AU1A 1ICFA 2DCDA 1GCBA 1EWMA 1ZIVA 1CV8A 3BOWA 2WBFX 1U9XA 3D6SA 3WXEA 2AUZA 1QOLA 3OVXA 2G7YA 3KKUA 1ZCMA 3D9WA 2NQGA 1YALA 3HHIA 3S3RA 2DC6A 2NQIA 1PPOA 1KFXL 1TU6A 3HHAA 4GUZA 5K16A 1HUCB 6PADA 3HD3A 3QJ3A 3BC3A 1CB5A 3QT4A 4N4ZA 4YV8A 2PREA 1YK8A 3N3GA 2AUXA 4X6IA 1THEA 1AYWA 1W4TA 2JQGR 1CSBB 2NQAA 2P7UA 4KLBA 1W6FA 1U9QX 2P86A 1W5RA 2AS8A 3IMAA 3P5XA 3IHPA 1QXPA 2E01A 4W5BA 3C9EA 2E02A 4CDFB 1BP4A 1A6RA 1Y4HA 1CQDA 1YT7A 1TL9A 1KHQA 2DZYA 1NL6A 3BPMA 2AYNA 5CHVA 1NB5A 2DC9A 4MZSA 3I06A 1EWLA 1NLJA 2YJ9A 3IV2A 1PCIA 4P6GA 4QRXA 3WXFA 3IEJA 4C5PA 4QRVA 1ATKA 3KFQA 2HH5A 1PIPA 1BGOA 4K7CA 2Y6EA 1PXVA 1PPDA 3I3TA 2H7JA 3M99A 2ACTA 7PCKA 3B79A 1JQPA 3RVXA 3DF0A 3KSEA 2FRAA 1TLOA 2VHFA 2DJFB 4CDEB 2VFBA 2FUDA 3H7DA 4BPVA 4BS6A 1KHPA 1U9VA 3OVZA 2P0RA 2PNSA 1AECA 1CJLA 1O0EA 5CVOB 3N3KA 3RVVA 2FYEA 1GX3A 1SP4B 2R9FA 3H8BA 2GHUA 1VSNA 1S4VA 2FT2A 5CVMA 1GECE 4X6JA 1U5IA 4QRGA 4PP2E 2XU3A 3MORA 3O1GA 2R6NA 2JQFR 4NV8A 3H89A 1FH0A 3H6SA 4CDCB 4YYUA 5A24A 2F1GA 1SNKA 3KWZA 3LXSA 5EGWA 1CS8A 3WXGA 1F2BA 2ARYA 3BCNA 2C0YA 1STFE 4QH6A 3USVA 2DC7A 3U8EA 2R9OA 3P5WA 2VHSA 5CHTA 3QSDA 5J94A 3MHHA 1IWDA 2DJGB 3CH2X 3K8UA 4YYVA 1POPA 2DCAA 1YVBA 2XU4A 1CVZA 2YJ2A 4I07A 1AIMA 3CBJA 2AVWA 3KX1A 4RY2A 2PBHA 2AYOA 3V6EA 1QMYA 2R9CA 2DC8A 3MTNA 3IOQA 9PAPA 8PCHA 1XKGA 2YJBA 2OZ2A 2OULA 2AIMA 1BQIA 1MEGA 4BQVA 1QDQA 2FTDA 2GFOA 1MS6A 5F02A 1PBHA 2F7DA 1CPJA 4PI3A 3OF8A 5JH3A 4YYSA 3IUTA 3BWKA 1M6DA 3ZUAA 1ITOA 4FK5A 1Y08A 2DZZA 4FJCA 1ME4A 1MIRA 1NPZA 1MDWA 3RVWA 3P5UA 1AU2A 3CH3X 1EWPA 1NQCA 1MEMA 1PADA 2DCCA 1KFUL 4W4UA 4CZWA 2ATOA 1VJVA 4G54A 5FPWA 2CB5A 2Y5BA 4I05A 3BPFA 4OEMA 4PADA 1AU4A 1K3BB 1GMYA 3E1ZB 1AYVA 4XUIA 4YYQA 1BY8A 1F2CA 2BDZA 1PE6A 1DF0A 2B1NA 2BSZA 5EF4A 4HWYA 3PW3A 2FQ9A 4FIPA 5PADA 3V6CA 4DMXA 4BS5A 3MHSA 3N4CA 3F5VA 1GLOA 2E00A 1E2TA 1DEUA 2IBIA 4BSQA 1AU0A 4NV7A 4YYRA 3OF9A 1NB3A 1U9WA 3LFYA 1X9YA 1F29A 3K9MA 2G8EA 4MZOA 3S3QA 4YVAA 3K24A 1F2AA 3NHEA 1ME3A 1MHWA 2FRQA 4BGFA 2B1MA 4N8WA 2XU5A 4MSXA 2OP3A 3ERVA 3PNRA 4B55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK7 A;  4DMY A;  2G8J A;  2IPP B;  3CBK A;  3TNX A;  2O6X A;  3AI8 A;  2DCB A;  4OEL A;  5JA7 A;  2HXZ A;  4Q8H A;  3H8C A;  3P5V A;  2R9M A;  4PP1 A;  1CTE A;  3OIS A;  1Q6K A;  4AXL A;  2YJ8 A;  4I04 A;  4WA6 A;  4N79 A;  3O0U A;  3F75 A;  1AYU A;  4P6E A;  1PPP A;  2CIO A;  2XU1 A;  1PPN A;  1EWO A;  2NQD B;  3KWB X;  4W5C A;  4XR7 A;  4ZUX U;  2E03 A;  4X6H A;  3PDF A;  1EF7 A;  2R9N A;  2G6D A;  2BDL A;  4YYW A;  2FO5 A;  2YJC A;  4Q8G A;  2HD5 A;  4AXM A;  1KXR A;  2PAD A;  1AU3 A;  4CDD B;  5CVN B;  3PBH A;  2HHN A;  3KW9 A;  4QBB A;  3HWN A;  3GCB A;  2AU1 A;  1ICF A;  2DCD A;  1GCB A;  1EWM A;  1ZIV A;  1CV8 A;  3BOW A;  2WBF X;  1U9X A;  3D6S A;  3WXE A;  2AUZ A;  1QOL A;  3OVX A;  2G7Y A;  3KKU A;  1ZCM A;  2NQG A;  1YAL A;  3HHI A;  3S3R A;  2DC6 A;  2NQI A;  1PPO A;  1KFX L;  1TU6 A;  3HHA A;  5K16 A;  1HUC B;  6PAD A;  3HD3 A;  3QJ3 A;  3BC3 A;  1CB5 A;  3QT4 A;  4N4Z A;  4YV8 A;  2PRE A;  1YK8 A;  3N3G A;  2AUX A;  4X6I A;  1THE A;  1AYW A;  2JQG R;  1CSB B;  2NQA A;  2P7U A;  4KLB A;  1U9Q X;  2P86 A;  2AS8 A;  3IMA A;  3P5X A;  3IHP A;  1QXP A;  2E01 A;  4W5B A;  3C9E A;  2E02 A;  4CDF B;  1BP4 A;  1A6R A;  1Y4H A;  1CQD A;  1YT7 A;  1TL9 A;  1KHQ A;  2DZY A;  1NL6 A;  3BPM A;  2AYN A;  5CHV A;  1NB5 A;  2DC9 A;  4MZS A;  3I06 A;  1EWL A;  1NLJ A;  2YJ9 A;  3IV2 A;  1PCI A;  4P6G A;  4QRX A;  3WXF A;  3IEJ A;  4QRV A;  1ATK A;  3KFQ A;  2HH5 A;  1PIP A;  1BGO A;  4K7C A;  2Y6E A;  1PXV A;  1PPD A;  3I3T A;  2H7J A;  3M99 A;  2ACT A;  7PCK A;  3B79 A;  1JQP A;  3RVX A;  3DF0 A;  3KSE A;  2FRA A;  1TLO A;  2VHF A;  2DJF B;  4CDE B;  2FUD A;  3H7D A;  4BPV A;  4BS6 A;  1KHP A;  1U9V A;  3OVZ A;  2P0R A;  2PNS A;  1AEC A;  1CJL A;  1O0E A;  5CVO B;  3N3K A;  3RVV A;  2FYE A;  1SP4 B;  2R9F A;  3H8B A;  2GHU A;  1VSN A;  1S4V A;  2FT2 A;  5CVM A;  1GEC E;  4X6J A;  1U5I A;  4QRG A;  4PP2 E;  2XU3 A;  3MOR A;  3O1G A;  2R6N A;  2JQF R;  3H89 A;  1FH0 A;  3H6S A;  4CDC B;  4YYU A;  5A24 A;  2F1G A;  1SNK A;  3KWZ A;  3LXS A;  5EGW A;  1CS8 A;  3WXG A;  1F2B A;  2ARY A;  3BCN A;  2C0Y A;  1STF E;  3USV A;  4QH6 A;  2DC7 A;  3U8E A;  2R9O A;  3P5W A;  2VHS A;  5CHT A;  3QSD A;  5J94 A;  3MHH A;  1IWD A;  2DJG B;  3CH2 X;  3K8U A;  4YYV A;  1POP A;  2DCA A;  1YVB A;  2XU4 A;  1CVZ A;  2YJ2 A;  4I07 A;  1AIM A;  3CBJ A;  2AVW A;  3KX1 A;  4RY2 A;  2PBH A;  2AYO A;  3V6E A;  1QMY A;  2R9C A;  2DC8 A;  3MTN A;  3IOQ A;  9PAP A;  8PCH A;  1XKG A;  2YJB A;  2OZ2 A;  2OUL A;  2AIM A;  1BQI A;  1MEG A;  4BQV A;  1QDQ A;  2FTD A;  2GFO A;  1MS6 A;  1PBH A;  2F7D A;  5F02 A;  1CPJ A;  4PI3 A;  3OF8 A;  5JH3 A;  4YYS A;  3IUT A;  3BWK A;  1M6D A;  3ZUA A;  1ITO A;  4FK5 A;  1Y08 A;  2DZZ A;  4FJC A;  1ME4 A;  1MIR A;  1NPZ A;  1MDW A;  3RVW A;  3P5U A;  1AU2 A;  3CH3 X;  1EWP A;  1NQC A;  1MEM A;  1PAD A;  2DCC A;  1KFU L;  4W4U A;  4CZW A;  2ATO A;  1VJV A;  4G54 A;  5FPW A;  2CB5 A;  2Y5B A;  4I05 A;  3BPF A;  4OEM A;  4PAD A;  1AU4 A;  1K3B B;  1GMY A;  3E1Z B;  1AYV A;  4XUI A;  4YYQ A;  1BY8 A;  1F2C A;  2BDZ A;  1PE6 A;  1DF0 A;  2B1N A;  5EF4 A;  4HWY A;  3PW3 A;  2FQ9 A;  4FIP A;  5PAD A;  3V6C A;  4DMX A;  4BS5 A;  3MHS A;  3N4C A;  3F5V A;  1GLO A;  2E00 A;  1DEU A;  2IBI A;  4BSQ A;  1AU0 A;  4YYR A;  3OF9 A;  1NB3 A;  1U9W A;  3LFY A;  1X9Y A;  1F29 A;  3K9M A;  2G8E A;  4MZO A;  3S3Q A;  4YVA A;  3K24 A;  1F2A A;  3NHE A;  1ME3 A;  1MHW A;  2FRQ A;  2B1M A;  4N8W A;  2XU5 A;  4MSX A;  2OP3 A;  3ERV A;  3PNR A; 
#chains in the Genus database with same CATH topology
 1YK7 A;  4DMY A;  2G8J A;  2IPP B;  3CBK A;  3PRP A;  3TNX A;  2O6X A;  3AI8 A;  2DCB A;  3PT2 A;  4OEL A;  5JA7 A;  2HXZ A;  4Q8H A;  3H8C A;  3P5V A;  2R9M A;  4PP1 A;  1CTE A;  3OIS A;  4BOS A;  1DKI A;  1Q6K A;  4RNA A;  4AXL A;  3RNV A;  2YJ8 A;  4I04 A;  4WA6 A;  4N79 A;  3O0U A;  3F75 A;  1AYU A;  4P6E A;  1PPP A;  2CIO A;  2XU1 A;  1PPN A;  1EWO A;  2NQD B;  3KWB X;  4W5C A;  4XR7 A;  4ZUX U;  2E03 A;  4X6H A;  3PDF A;  1EF7 A;  2R9N A;  2G6D A;  2BDL A;  4YYW A;  2FO5 A;  2YJC A;  4Q8G A;  2HD5 A;  4AXM A;  1KXR A;  2PAD A;  1AU3 A;  4CDD B;  5CVN B;  2BU3 A;  3PBH A;  2HHN A;  5EZQ A;  3KW9 A;  4QBB A;  3BB7 A;  3HWN A;  3GCB A;  2AU1 A;  1ICF A;  2DCD A;  1GCB A;  1EWM A;  1ZIV A;  1CV8 A;  3BOW A;  2WBF X;  1U9X A;  3D6S A;  3WXE A;  2AUZ A;  1QOL A;  3OVX A;  2G7Y A;  3KKU A;  2JTC A;  1ZCM A;  2NQG A;  4IUM A;  1YAL A;  3HHI A;  3S3R A;  2DC6 A;  2NQI A;  1PVJ A;  1PPO A;  1KFX L;  1TU6 A;  4IP3 A;  3HHA A;  5K16 A;  1HUC B;  6PAD A;  3HD3 A;  3QJ3 A;  3BC3 A;  1CB5 A;  3QT4 A;  4N4Z A;  4YV8 A;  2PRE A;  1YK8 A;  3N3G A;  2AUX A;  4X6I A;  1THE A;  1AYW A;  2JQG R;  1CSB B;  2NQA A;  2P7U A;  4KLB A;  1U9Q X;  4GUA A;  2P86 A;  4XZX A;  4PT5 A;  5KO3 A;  2AS8 A;  3IMA A;  3P5X A;  4RF0 A;  3BBA A;  3IHP A;  4BOQ A;  1QXP A;  2E01 A;  4W5B A;  3C9E A;  2BTW A;  3W31 A;  2E02 A;  4CDF B;  1BP4 A;  1A6R A;  1UKF A;  1Y4H A;  1CQD A;  1YT7 A;  1TL9 A;  1YZB A;  3IFU A;  1KHQ A;  2DZY A;  1NL6 A;  4RKX A;  3BPM A;  2AYN A;  3O65 A;  5CHV A;  1NB5 A;  2DC9 A;  4MZS A;  3I06 A;  1EWL A;  1NLJ A;  2YJ9 A;  3IV2 A;  4RF1 A;  1PCI A;  4P6G A;  4QRX A;  3WXF A;  3IEJ A;  4R3D A;  2FE8 A;  4QRV A;  3ZNH A;  1ATK A;  3KFQ A;  2HH5 A;  1PIP A;  1BGO A;  4K7C A;  2Y6E A;  1PXV A;  1PPD A;  3I3T A;  3C0R A;  2H7J A;  4HXD B;  3M99 A;  2ACT A;  2Z84 A;  7PCK A;  3B79 A;  1JQP A;  3RVX A;  3DF0 A;  3KSE A;  2FRA A;  1TLO A;  4M0W A;  2VHF A;  2DJF B;  4CDE B;  3B21 A;  4D8E A;  4OW0 A;  2FUD A;  3H7D A;  4BPV A;  4BS6 A;  1KHP A;  1U9V A;  2J7Q A;  3OVZ A;  3W30 A;  2P0R A;  2PNS A;  1AEC A;  1CJL A;  1O0E A;  5CVO B;  3N3K A;  3RVV A;  2FYE A;  4OVZ A;  1SP4 B;  2R9F A;  3H8B A;  2GHU A;  1VSN A;  1S4V A;  4BOZ A;  2FT2 A;  4WUR A;  5CVM A;  1GEC E;  4X6J A;  1U5I A;  3OQC A;  4QRG A;  4PP2 E;  2XU3 A;  3MOR A;  3O1G A;  2R6N A;  2JQF R;  3H89 A;  1FH0 A;  3H6S A;  4CDC B;  4YYU A;  5A24 A;  2F1G A;  5EZS A;  1SNK A;  3KWZ A;  3LXS A;  5EGW A;  1CS8 A;  3WXG A;  1F2B A;  2J7Q C;  2ARY A;  3BCN A;  2C0Y A;  1STF E;  4QH6 A;  3USV A;  2DC7 A;  3U8E A;  2R9O A;  3P5W A;  2HWK A;  2VHS A;  5CHT A;  3QSD A;  5J94 A;  4D8I A;  3MHH A;  1IWD A;  2DJG B;  3CH2 X;  3K8U A;  4YYV A;  1POP A;  2DCA A;  1YVB A;  2XU4 A;  1CVZ A;  2YJ2 A;  4I07 A;  1AIM A;  3CBJ A;  2AVW A;  3BY4 A;  3KX1 A;  4OVZ B;  4RY2 A;  2PBH A;  2AYO A;  3V6E A;  1QMY A;  4BOP A;  4P16 A;  2R9C A;  2DC8 A;  3MTN A;  3IOQ A;  9PAP A;  8PCH A;  1XKG A;  2YJB A;  2OZ2 A;  3MP2 A;  2OUL A;  2AIM A;  1BQI A;  1MEG A;  4BQV A;  1QDQ A;  2FTD A;  2GFO A;  1MS6 A;  1PBH A;  2F7D A;  5F02 A;  1CPJ A;  4PI3 A;  3OF8 A;  3MJ5 A;  5JH3 A;  4YYS A;  3IUT A;  3BWK A;  1M6D A;  3ZUA A;  1ITO A;  4FK5 A;  3MTV A;  1Y08 A;  3PHX A;  2DZZ A;  4ZTB A;  4FJC A;  1ME4 A;  1MIR A;  1NPZ A;  1MDW A;  2AGA A;  4A5U A;  3RVW A;  3P5U A;  3TRK A;  1AU2 A;  3CH3 X;  1EWP A;  1NQC A;  1MEM A;  1PAD A;  2DCC A;  1KFU L;  4W4U A;  3PHU A;  4CZW A;  2ATO A;  2JRI A;  1VJV A;  4G54 A;  5FPW A;  2CB5 A;  2Y5B A;  4I05 A;  3BPF A;  4OEM A;  4PAD A;  1AU4 A;  1K3B B;  1GMY A;  2BTW B;  4MM3 B;  3E1Z B;  1AYV A;  4XUI A;  4YYQ A;  1BY8 A;  1F2C A;  3E9S A;  2BDZ A;  1PE6 A;  1DF0 A;  2B1N A;  4BOU A;  5EF4 A;  5JZE A;  4HWY A;  3PW3 A;  2FQ9 A;  4FIP A;  5PAD A;  3V6C A;  3PSE A;  4DMX A;  3PRM A;  4BS5 A;  3MHS A;  3TMP A;  3N4C A;  3F5V A;  3PHW A;  4MI7 A;  1GLO A;  4D8B A;  2E00 A;  1DEU A;  2IBI A;  4BSQ A;  1AU0 A;  4YYR A;  5E6J A;  3OF9 A;  1NB3 A;  1U9W A;  3LFY A;  1X9Y A;  1F29 A;  3K9M A;  4REZ A;  2G8E A;  4MZO A;  3S3Q A;  4YVA A;  3K24 A;  1F2A A;  3NHE A;  1ME3 A;  1MHW A;  2FRQ A;  2DOS A;  2B1M A;  4N8W A;  2XU5 A;  4MSX A;  2OP3 A;  3ERV A;  3PNR A;  2UZJ A; 
#chains in the Genus database with same CATH homology
 1YK7 A;  4DMY A;  2G8J A;  2IPP B;  3CBK A;  3TNX A;  2O6X A;  3AI8 A;  2DCB A;  4OEL A;  5JA7 A;  2HXZ A;  4Q8H A;  3H8C A;  3P5V A;  2R9M A;  4PP1 A;  1CTE A;  3OIS A;  1Q6K A;  4AXL A;  2YJ8 A;  4I04 A;  4WA6 A;  4N79 A;  3O0U A;  3F75 A;  1AYU A;  4P6E A;  1PPP A;  2CIO A;  2XU1 A;  1PPN A;  1EWO A;  2NQD B;  3KWB X;  4W5C A;  4XR7 A;  4ZUX U;  2E03 A;  4X6H A;  3PDF A;  1EF7 A;  2R9N A;  3LTW A;  2G6D A;  2BDL A;  4YYW A;  2FO5 A;  2YJC A;  4Q8G A;  2HD5 A;  4AXM A;  1KXR A;  2PAD A;  1AU3 A;  4CDD B;  2VFC A;  5CVN B;  3PBH A;  2HHN A;  3KW9 A;  4QBB A;  3HWN A;  3GCB A;  2AU1 A;  1ICF A;  2DCD A;  1GCB A;  1EWM A;  1ZIV A;  1CV8 A;  3BOW A;  2WBF X;  1U9X A;  3D6S A;  3WXE A;  2AUZ A;  1QOL A;  3OVX A;  2G7Y A;  3KKU A;  1ZCM A;  3D9W A;  2NQG A;  1YAL A;  3HHI A;  3S3R A;  2DC6 A;  2NQI A;  1PPO A;  1KFX L;  1TU6 A;  3HHA A;  4GUZ A;  5K16 A;  1HUC B;  6PAD A;  3HD3 A;  3QJ3 A;  3BC3 A;  1CB5 A;  3QT4 A;  4N4Z A;  4YV8 A;  2PRE A;  1YK8 A;  3N3G A;  2AUX A;  4X6I A;  1THE A;  1AYW A;  1W4T A;  2JQG R;  1CSB B;  2NQA A;  2P7U A;  4KLB A;  1W6F A;  1U9Q X;  2P86 A;  1W5R A;  2AS8 A;  3IMA A;  3P5X A;  3IHP A;  1QXP A;  2E01 A;  4W5B A;  3C9E A;  2E02 A;  4CDF B;  1BP4 A;  1A6R A;  1Y4H A;  1CQD A;  1YT7 A;  1TL9 A;  1KHQ A;  2DZY A;  1NL6 A;  3BPM A;  2AYN A;  5CHV A;  1NB5 A;  2DC9 A;  4MZS A;  3I06 A;  1EWL A;  1NLJ A;  2YJ9 A;  3IV2 A;  1PCI A;  4P6G A;  4QRX A;  3WXF A;  3IEJ A;  4C5P A;  4QRV A;  1ATK A;  3KFQ A;  2HH5 A;  1PIP A;  1BGO A;  4K7C A;  2Y6E A;  1PXV A;  1PPD A;  3I3T A;  2H7J A;  3M99 A;  2ACT A;  7PCK A;  3B79 A;  1JQP A;  3RVX A;  3DF0 A;  3KSE A;  2FRA A;  1TLO A;  2VHF A;  2DJF B;  4CDE B;  2VFB A;  2FUD A;  3H7D A;  4BPV A;  4BS6 A;  1KHP A;  1U9V A;  3OVZ A;  2P0R A;  2PNS A;  1AEC A;  1CJL A;  1O0E A;  5CVO B;  3N3K A;  3RVV A;  2FYE A;  1GX3 A;  1SP4 B;  2R9F A;  3H8B A;  2GHU A;  1VSN A;  1S4V A;  2FT2 A;  5CVM A;  1GEC E;  4X6J A;  1U5I A;  4QRG A;  4PP2 E;  2XU3 A;  3MOR A;  3O1G A;  2R6N A;  2JQF R;  4NV8 A;  3H89 A;  1FH0 A;  3H6S A;  4CDC B;  4YYU A;  5A24 A;  2F1G A;  1SNK A;  3KWZ A;  3LXS A;  5EGW A;  1CS8 A;  3WXG A;  1F2B A;  2ARY A;  3BCN A;  2C0Y A;  1STF E;  4QH6 A;  3USV A;  2DC7 A;  3U8E A;  2R9O A;  3P5W A;  2VHS A;  5CHT A;  3QSD A;  5J94 A;  3MHH A;  1IWD A;  2DJG B;  3CH2 X;  3K8U A;  4YYV A;  1POP A;  2DCA A;  1YVB A;  2XU4 A;  1CVZ A;  2YJ2 A;  4I07 A;  1AIM A;  3CBJ A;  2AVW A;  3KX1 A;  4RY2 A;  2PBH A;  2AYO A;  3V6E A;  1QMY A;  2R9C A;  2DC8 A;  3MTN A;  3IOQ A;  9PAP A;  8PCH A;  1XKG A;  2YJB A;  2OZ2 A;  2OUL A;  2AIM A;  1BQI A;  1MEG A;  4BQV A;  1QDQ A;  2FTD A;  2GFO A;  1MS6 A;  5F02 A;  1PBH A;  2F7D A;  1CPJ A;  4PI3 A;  3OF8 A;  5JH3 A;  4YYS A;  3IUT A;  3BWK A;  1M6D A;  3ZUA A;  1ITO A;  4FK5 A;  1Y08 A;  2DZZ A;  4FJC A;  1ME4 A;  1MIR A;  1NPZ A;  1MDW A;  3RVW A;  3P5U A;  1AU2 A;  3CH3 X;  1EWP A;  1NQC A;  1MEM A;  1PAD A;  2DCC A;  1KFU L;  4W4U A;  4CZW A;  2ATO A;  1VJV A;  4G54 A;  5FPW A;  2CB5 A;  2Y5B A;  4I05 A;  3BPF A;  4OEM A;  4PAD A;  1AU4 A;  1K3B B;  1GMY A;  3E1Z B;  1AYV A;  4XUI A;  4YYQ A;  1BY8 A;  1F2C A;  2BDZ A;  1PE6 A;  1DF0 A;  2B1N A;  2BSZ A;  5EF4 A;  4HWY A;  3PW3 A;  2FQ9 A;  4FIP A;  5PAD A;  3V6C A;  4DMX A;  4BS5 A;  3MHS A;  3N4C A;  3F5V A;  1GLO A;  2E00 A;  1E2T A;  1DEU A;  2IBI A;  4BSQ A;  1AU0 A;  4NV7 A;  4YYR A;  3OF9 A;  1NB3 A;  1U9W A;  3LFY A;  1X9Y A;  1F29 A;  3K9M A;  2G8E A;  4MZO A;  3S3Q A;  4YVA A;  3K24 A;  1F2A A;  3NHE A;  1ME3 A;  1MHW A;  2FRQ A;  4BGF A;  2B1M A;  4N8W A;  2XU5 A;  4MSX A;  2OP3 A;  3ERV A;  3PNR A;  4B55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...