2R9OA

Cathepsin s complexed with compound 8
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9oA00
4PP1A 5CVMA 3H8BA 4QRVA 3V6CA 3P5VA 3ERVA 2DC8A 3LXSA 3KKUA 3IHPA 1YVBA 2AUXA 1CPJA 1NQCA 3HHAA 3O0UA 2DJGB 3QT4A 1AU3A 3K9MA 5FPWA 2B1MA 2PADA 1U9XA 4XR7A 3BPFA 4W5BA 4AXMA 1U5IA 1PPNA 1CTEA 4OEMA 3P5XA 2F1GA 2DZZA 3BC3A 3MHHA 3WXEA 4X6IA 1CS8A 5JA7A 1GLOA 1PPOA 2GHUA 2FRAA 1MHWA 1VJVA 4CDEB 1FH0A 3I06A 3H89A 1S4VA 2YJ9A 2R9NA 2FO5A 1CV8A 4X6JA 3F75A 4X6HA 1EWOA 3F5VA 1CB5A 3DF0A 1AYVA 1PADA 3MHSA 3OF9A 1PXVA 2DJFB 2CIOA 3H7DA 1CQDA 4HWYA 4YVAA 3KWZA 2P86A 4PI3A 4W4UA 2AUZA 1PPDA 4CDDB 1ZCMA 5CHTA 4MSXA 2XU1A 3OISA 1SP4B 3KW9A 3E1ZB 2AU1A 3CH3X 5CHVA 1CJLA 2E00A 1PE6A 2FT2A 4FIPA 1AU2A 1DEUA 2FUDA 3N3GA 2O6XA 3B79A 1GECE 1SNKA 4KLBA 3PBHA 1MEGA 1POPA 1STFE 2IPPB 1MDWA 1Q6KA 1ATKA 4N4ZA 1F2BA 5EF4A 3M99A 5PADA 1BY8A 2VHFA 3D6SA 3IUTA 2HXZA 2ARYA 2DC9A 1ZIVA 4YV8A 1Y08A 1KHQA 3MTNA 1ME4A 2NQGA 3HWNA 1U9VA 3IMAA 2E02A 2R9OA 2YJ2A 1KFXL 3BCNA 2Y5BA 3I3TA 4P6GA 2FYEA 5CVOB 2HHNA 2ATOA 4FK5A 1VSNA 4W5CA 4YYQA 1TLOA 4I05A 1YT7A 2AIMA 3NHEA 1YK7A 1TU6A 3V6EA 1BQIA 1AYUA 2YJCA 2B1NA 3IEJA 2OP3A 1F2AA 4PADA 3RVXA 1MIRA 2AS8A 3OF8A 3N3KA 2AVWA 5J94A 2DCBA 1CSBB 2DCDA 4AXLA 4BSQA 1X9YA 4YYVA 2HH5A 1EWPA 1PPPA 1NL6A 4FJCA 2E01A 2R9MA 2NQDB 2DCCA 3H6SA 1NPZA 3N4CA 1EWMA 1MEMA 1BGOA 1AIMA 1BP4A 1CVZA 2P0RA 3O1GA 1AU0A 4P6EA 1ITOA 2R9CA 5JH3A 3MORA 1QDQA 1M6DA 3P5UA 1EWLA 3HHIA 1KFUL 3H8CA 3LFYA 4N79A 2C0YA 3OVXA 2CB5A 5CVNB 3QJ3A 4CZWA 1JQPA 2YJ8A 2AYNA 1MS6A 4QRGA 2JQFR 1NLJA 4Q8HA 6PADA 4ZUXU 3K8UA 4I07A 4OELA 3CBJA 4XUIA 2E03A 3C9EA 2H7JA 1K3BB 2OZ2A 5F02A 1THEA 3TNXA 3S3QA 4CDFB 3QSDA 3RVVA 4DMXA 3K24A 4BPVA 2G8JA 2NQIA 2PBHA 3CBKA 2G6DA 3WXFA 1YK8A 4YYWA 2P7UA 4MZSA 3PW3A 2ACTA 1KHPA 2F7DA 3OVZA 2HD5A 3BWKA 3KSEA 2GFOA 4Q8GA 2PREA 1ME3A 1F29A 3S3RA 2AYOA 3IV2A 2XU5A 1NB5A 2XU4A 3KWBX 4PP2E 3RVWA 2DZYA 3GCBA 4QRXA 1AYWA 1YALA 1DF0A 8PCHA 2XU3A 4K7CA 2YJBA 4QBBA 2R9FA 3BPMA 2FQ9A 1GMYA 1U9QX 1ICFA 5EGWA 4QH6A 4YYRA 2DCAA 3CH2X 3IOQA 3AI8A 3WXGA 4YYSA 3U8EA 1GCBA 2Y6EA 2FTDA 1F2CA 4MZOA 3USVA 1AU4A 2R6NA 4DMYA 3P5WA 4BS5A 5K16A 2G7YA 1HUCB 1IWDA 2DC6A 2VHSA 2BDLA 4YYUA 1TL9A 1QOLA 2JQGR 3HD3A 2NQAA 1EF7A 1PCIA 1PBHA 2OULA 1QMYA 2DC7A 4N8WA 2BDZA 3ZUAA 1Y4HA 4BS6A 2PNSA 2WBFX 3PNRA 1O0EA 1XKGA 3KX1A 1PIPA 5A24A 4BQVA 3BOWA 9PAPA 1AECA 3KFQA 1U9WA 4G54A 1KXRA 1NB3A 1QXPA 2G8EA 4WA6A 4I04A 4CDCB 1A6RA 2FRQA 4RY2A 3PDFA 2IBIA 7PCKA
chains in the Genus database with same CATH superfamily
4PP1A 5CVMA 3H8BA 4QRVA 4BOUA 3V6CA 3P5VA 3ERVA 2DC8A 3LXSA 3KKUA 3IHPA 4MM3B 1YVBA 2AUXA 2DOSA 3E9SA 1CPJA 2BTWA 1NQCA 3HHAA 3O0UA 2DJGB 3QT4A 1AU3A 3K9MA 5FPWA 2B1MA 4RF1A 2PADA 1U9XA 4XR7A 4M0WA 4BOQA 3BPFA 4W5BA 4AXMA 1U5IA 4BOPA 4REZA 1PPNA 1CTEA 4OEMA 3P5XA 2F1GA 2DZZA 3BC3A 3MHHA 3WXEA 4X6IA 5EZQA 1CS8A 2JRIA 5JA7A 1GLOA 1PPOA 2GHUA 2FRAA 1MHWA 1VJVA 4CDEB 1FH0A 3I06A 3PT2A 3H89A 4BOZA 1S4VA 2YJ9A 3RNVA 2R9NA 5KO3A 2FO5A 1CV8A 4HXDB 4X6JA 3F75A 4RF0A 4X6HA 2HWKA 1EWOA 3MP2A 3F5VA 1CB5A 3DF0A 1AYVA 1PADA 3MHSA 2FE8A 3OF9A 1PXVA 3BBAA 2DJFB 2CIOA 3H7DA 1CQDA 4HWYA 4YVAA 3KWZA 2P86A 2BTWB 4PI3A 4W4UA 2AUZA 1PPDA 4CDDB 1ZCMA 5CHTA 4MSXA 2XU1A 3OISA 3PHXA 1SP4B 3KW9A 3E1ZB 2AU1A 3CH3X 5CHVA 1CJLA 2E00A 3MTVA 1PE6A 2FT2A 4FIPA 1AU2A 1DEUA 3PRPA 2FUDA 3N3GA 3C0RA 2O6XA 3TMPA 3B79A 1GECE 1SNKA 4KLBA 2JTCA 3PBHA 1MEGA 3BB7A 1POPA 1STFE 2IPPB 1MDWA 1Q6KA 1ATKA 4N4ZA 1F2BA 5EF4A 3M99A 5PADA 1BY8A 4P16A 2VHFA 3BY4A 3D6SA 3IUTA 4D8EA 2HXZA 4A5UA 3O65A 2ARYA 1YZBA 2DC9A 1ZIVA 4OVZA 4YV8A 1Y08A 1KHQA 3MTNA 1ME4A 2NQGA 3HWNA 1U9VA 3IMAA 4XZXA 2E02A 2R9OA 2YJ2A 1KFXL 3BCNA 2Y5BA 3I3TA 4P6GA 2FYEA 5CVOB 1DKIA 2HHNA 2ATOA 4FK5A 1VSNA 4W5CA 4YYQA 1TLOA 4I05A 4RNAA 1YT7A 2AGAA 2AIMA 3NHEA 1YK7A 1TU6A 4WURA 3B21A 3V6EA 1BQIA 1AYUA 2YJCA 2B1NA 3IEJA 2OP3A 1F2AA 4PADA 3RVXA 1MIRA 2AS8A 3OF8A 3N3KA 2AVWA 5J94A 2DCBA 1CSBB 2DCDA 4AXLA 4IP3A 4BSQA 1X9YA 4YYVA 2HH5A 1EWPA 2BU3A 1PPPA 2UZJA 1NL6A 4FJCA 2E01A 2R9MA 2NQDB 2DCCA 3H6SA 1NPZA 3N4CA 1EWMA 1MEMA 1BGOA 1AIMA 1BP4A 5EZSA 1CVZA 2P0RA 3O1GA 1AU0A 4P6EA 4ZTBA 1ITOA 1UKFA 2R9CA 5JH3A 3MORA 1QDQA 3TRKA 4OVZB 1M6DA 3P5UA 1EWLA 3OQCA 3HHIA 4BOSA 1KFUL 3H8CA 3LFYA 4N79A 2C0YA 3OVXA 2CB5A 5CVNB 3QJ3A 4CZWA 1JQPA 2YJ8A 2AYNA 1MS6A 4QRGA 2JQFR 1NLJA 2J7QC 4Q8HA 6PADA 4ZUXU 3K8UA 4D8IA 4I07A 4OELA 3CBJA 4XUIA 2E03A 3C9EA 3IFUA 2H7JA 1K3BB 2OZ2A 5F02A 1THEA 3PSEA 3TNXA 3S3QA 4CDFB 3QSDA 3RVVA 2Z84A 3K24A 4DMXA 4OW0A 4BPVA 2G8JA 2NQIA 3W31A 2PBHA 3CBKA 2G6DA 3WXFA 1YK8A 4YYWA 2P7UA 4MZSA 3PW3A 2ACTA 1KHPA 2F7DA 3PHWA 3OVZA 2HD5A 3BWKA 3KSEA 2GFOA 4Q8GA 2PREA 3PHUA 4R3DA 1ME3A 1F29A 2J7QA 3S3RA 2AYOA 3IV2A 2XU5A 1NB5A 2XU4A 3KWBX 4PP2E 3RVWA 2DZYA 3GCBA 4QRXA 1AYWA 1YALA 3W30A 1DF0A 5E6JA 8PCHA 5JZEA 2XU3A 4K7CA 2YJBA 4QBBA 3ZNHA 2R9FA 4RKXA 3BPMA 2FQ9A 1GMYA 1U9QX 1ICFA 5EGWA 4QH6A 4YYRA 2DCAA 3CH2X 3IOQA 3AI8A 3WXGA 4YYSA 3U8EA 1GCBA 2Y6EA 2FTDA 1F2CA 4MZOA 3USVA 1AU4A 2R6NA 4DMYA 3P5WA 4IUMA 4BS5A 5K16A 2G7YA 1HUCB 1IWDA 2DC6A 2VHSA 2BDLA 4YYUA 1TL9A 1QOLA 2JQGR 3HD3A 2NQAA 1EF7A 3MJ5A 1PCIA 1PBHA 2OULA 1QMYA 2DC7A 3PRMA 4N8WA 4PT5A 2BDZA 3ZUAA 1Y4HA 4BS6A 2PNSA 2WBFX 3PNRA 1O0EA 1XKGA 4GUAA 4D8BA 3KX1A 1PIPA 5A24A 4BQVA 3BOWA 9PAPA 1AECA 3KFQA 1U9WA 4G54A 1PVJA 1KXRA 1NB3A 1QXPA 2G8EA 4WA6A 4I04A 4CDCB 4MI7A 1A6RA 2FRQA 4RY2A 3PDFA 2IBIA 7PCKA
chains in the Genus database with same CATH topology
4PP1A 5CVMA 3H8BA 4QRVA 3V6CA 3P5VA 3ERVA 2DC8A 3LXSA 3KKUA 3IHPA 1YVBA 2AUXA 1CPJA 1NQCA 4BGFA 3HHAA 3O0UA 2DJGB 3QT4A 1AU3A 3K9MA 5FPWA 2B1MA 2PADA 1U9XA 4XR7A 2VFCA 3BPFA 4W5BA 4AXMA 1U5IA 1PPNA 1CTEA 4OEMA 3P5XA 2F1GA 2DZZA 3BC3A 3MHHA 3WXEA 4X6IA 1CS8A 5JA7A 1GLOA 1PPOA 2GHUA 2FRAA 1MHWA 1VJVA 4CDEB 1FH0A 3I06A 3H89A 1S4VA 2YJ9A 2R9NA 2FO5A 1CV8A 4X6JA 3F75A 4X6HA 1EWOA 3F5VA 1CB5A 3DF0A 1AYVA 1PADA 3MHSA 3OF9A 1PXVA 4C5PA 2DJFB 1W4TA 2CIOA 3H7DA 1CQDA 4HWYA 4YVAA 2BSZA 3KWZA 2P86A 4PI3A 4W4UA 2AUZA 1PPDA 4CDDB 1ZCMA 5CHTA 4MSXA 2XU1A 3OISA 1SP4B 3KW9A 3E1ZB 2AU1A 3CH3X 5CHVA 1CJLA 2E00A 1PE6A 2FT2A 4FIPA 1AU2A 1DEUA 2FUDA 3N3GA 2O6XA 3B79A 1GECE 1SNKA 4GUZA 4KLBA 3PBHA 1MEGA 1POPA 1STFE 2IPPB 1MDWA 1Q6KA 1ATKA 4N4ZA 1F2BA 5EF4A 3M99A 5PADA 1BY8A 2VHFA 3D6SA 3IUTA 2HXZA 2ARYA 2DC9A 3LTWA 1ZIVA 4YV8A 1Y08A 1KHQA 3MTNA 1ME4A 2NQGA 3HWNA 1U9VA 3IMAA 2E02A 2R9OA 2YJ2A 1KFXL 3BCNA 2Y5BA 3I3TA 4P6GA 2FYEA 5CVOB 1E2TA 2HHNA 2ATOA 4FK5A 1VSNA 4W5CA 4YYQA 1TLOA 4I05A 1YT7A 2AIMA 3NHEA 1YK7A 1TU6A 3V6EA 1BQIA 1AYUA 2YJCA 3D9WA 2B1NA 3IEJA 2OP3A 1F2AA 4PADA 3RVXA 1MIRA 2AS8A 3OF8A 3N3KA 2AVWA 5J94A 2DCBA 1CSBB 2DCDA 1W5RA 4AXLA 4BSQA 1X9YA 4YYVA 2HH5A 1EWPA 1PPPA 1NL6A 1GX3A 2E01A 4FJCA 2R9MA 2NQDB 2DCCA 3H6SA 1NPZA 3N4CA 1EWMA 1MEMA 1BGOA 1AIMA 4NV7A 1BP4A 1CVZA 2P0RA 3O1GA 1AU0A 4P6EA 1ITOA 2R9CA 5JH3A 3MORA 1QDQA 1M6DA 3P5UA 1EWLA 3HHIA 1KFUL 3H8CA 3LFYA 4N79A 2C0YA 3OVXA 2CB5A 5CVNB 3QJ3A 4NV8A 4CZWA 1JQPA 2YJ8A 2AYNA 1MS6A 4QRGA 2JQFR 1NLJA 4Q8HA 6PADA 4ZUXU 3K8UA 4I07A 4OELA 3CBJA 4XUIA 2E03A 3C9EA 2H7JA 1K3BB 2OZ2A 5F02A 1THEA 3TNXA 3S3QA 4CDFB 3QSDA 3RVVA 4DMXA 3K24A 4BPVA 2G8JA 2NQIA 2PBHA 3CBKA 2G6DA 3WXFA 1YK8A 4YYWA 2P7UA 4MZSA 3PW3A 2ACTA 1KHPA 2F7DA 3OVZA 2HD5A 3BWKA 3KSEA 2GFOA 4Q8GA 2PREA 1ME3A 1F29A 3S3RA 2AYOA 3IV2A 2XU5A 1NB5A 2XU4A 2VFBA 3KWBX 4PP2E 3RVWA 2DZYA 3GCBA 4QRXA 1AYWA 1YALA 1DF0A 8PCHA 2XU3A 4K7CA 2YJBA 4QBBA 2R9FA 3BPMA 2FQ9A 1GMYA 1U9QX 1ICFA 5EGWA 4QH6A 4YYRA 2DCAA 3CH2X 3IOQA 3AI8A 3WXGA 4YYSA 3U8EA 1GCBA 2Y6EA 2FTDA 1F2CA 4MZOA 3USVA 1AU4A 2R6NA 4DMYA 3P5WA 4BS5A 5K16A 2G7YA 1HUCB 1IWDA 2DC6A 2VHSA 2BDLA 4YYUA 1TL9A 1W6FA 1QOLA 2JQGR 3HD3A 2NQAA 1EF7A 1PCIA 1PBHA 2OULA 1QMYA 2DC7A 4N8WA 2BDZA 3ZUAA 1Y4HA 4BS6A 2PNSA 4B55A 2WBFX 3PNRA 1O0EA 1XKGA 3KX1A 1PIPA 5A24A 4BQVA 3BOWA 9PAPA 1AECA 3KFQA 1U9WA 4G54A 1KXRA 1NB3A 1QXPA 2G8EA 4WA6A 4I04A 4CDCB 1A6RA 2FRQA 4RY2A 3PDFA 2IBIA 7PCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PP1 A;  5CVM A;  3H8B A;  4QRV A;  3V6C A;  3P5V A;  3ERV A;  2DC8 A;  3LXS A;  3KKU A;  3IHP A;  1YVB A;  2AUX A;  1CPJ A;  1NQC A;  3HHA A;  3O0U A;  2DJG B;  3QT4 A;  1AU3 A;  3K9M A;  5FPW A;  2B1M A;  2PAD A;  1U9X A;  4XR7 A;  3BPF A;  4W5B A;  4AXM A;  1U5I A;  1PPN A;  1CTE A;  4OEM A;  3P5X A;  2F1G A;  2DZZ A;  3BC3 A;  3MHH A;  3WXE A;  4X6I A;  1CS8 A;  5JA7 A;  1GLO A;  1PPO A;  2GHU A;  2FRA A;  1MHW A;  1VJV A;  4CDE B;  1FH0 A;  3I06 A;  3H89 A;  1S4V A;  2YJ9 A;  2R9N A;  2FO5 A;  1CV8 A;  4X6J A;  3F75 A;  4X6H A;  1EWO A;  3F5V A;  1CB5 A;  3DF0 A;  1AYV A;  1PAD A;  3MHS A;  3OF9 A;  1PXV A;  2DJF B;  2CIO A;  3H7D A;  1CQD A;  4HWY A;  4YVA A;  3KWZ A;  2P86 A;  4PI3 A;  4W4U A;  2AUZ A;  1PPD A;  4CDD B;  1ZCM A;  5CHT A;  4MSX A;  2XU1 A;  3OIS A;  1SP4 B;  3KW9 A;  3E1Z B;  2AU1 A;  3CH3 X;  5CHV A;  1CJL A;  2E00 A;  1PE6 A;  2FT2 A;  4FIP A;  1AU2 A;  1DEU A;  2FUD A;  3N3G A;  2O6X A;  3B79 A;  1GEC E;  1SNK A;  4KLB A;  3PBH A;  1MEG A;  1POP A;  1STF E;  2IPP B;  1MDW A;  1Q6K A;  1ATK A;  4N4Z A;  1F2B A;  5EF4 A;  3M99 A;  5PAD A;  1BY8 A;  2VHF A;  3D6S A;  3IUT A;  2HXZ A;  2ARY A;  2DC9 A;  1ZIV A;  4YV8 A;  1Y08 A;  1KHQ A;  3MTN A;  1ME4 A;  2NQG A;  3HWN A;  1U9V A;  3IMA A;  2E02 A;  2R9O A;  2YJ2 A;  1KFX L;  3BCN A;  2Y5B A;  3I3T A;  4P6G A;  2FYE A;  5CVO B;  2HHN A;  2ATO A;  4FK5 A;  1VSN A;  4W5C A;  4YYQ A;  1TLO A;  4I05 A;  1YT7 A;  2AIM A;  3NHE A;  1YK7 A;  1TU6 A;  3V6E A;  1BQI A;  1AYU A;  2YJC A;  2B1N A;  3IEJ A;  2OP3 A;  1F2A A;  4PAD A;  3RVX A;  1MIR A;  2AS8 A;  3OF8 A;  3N3K A;  2AVW A;  5J94 A;  2DCB A;  1CSB B;  2DCD A;  4AXL A;  4BSQ A;  1X9Y A;  4YYV A;  2HH5 A;  1EWP A;  1PPP A;  1NL6 A;  4FJC A;  2E01 A;  2R9M A;  2NQD B;  2DCC A;  3H6S A;  1NPZ A;  3N4C A;  1EWM A;  1MEM A;  1BGO A;  1AIM A;  1BP4 A;  1CVZ A;  2P0R A;  3O1G A;  1AU0 A;  4P6E A;  1ITO A;  2R9C A;  5JH3 A;  3MOR A;  1QDQ A;  1M6D A;  3P5U A;  1EWL A;  3HHI A;  1KFU L;  3H8C A;  3LFY A;  4N79 A;  2C0Y A;  3OVX A;  2CB5 A;  5CVN B;  3QJ3 A;  4CZW A;  1JQP A;  2YJ8 A;  2AYN A;  1MS6 A;  4QRG A;  2JQF R;  1NLJ A;  4Q8H A;  6PAD A;  4ZUX U;  3K8U A;  4I07 A;  4OEL A;  3CBJ A;  4XUI A;  2E03 A;  3C9E A;  2H7J A;  1K3B B;  2OZ2 A;  5F02 A;  1THE A;  3TNX A;  3S3Q A;  4CDF B;  3QSD A;  3RVV A;  4DMX A;  3K24 A;  4BPV A;  2G8J A;  2NQI A;  2PBH A;  3CBK A;  2G6D A;  3WXF A;  1YK8 A;  4YYW A;  2P7U A;  4MZS A;  3PW3 A;  2ACT A;  1KHP A;  2F7D A;  3OVZ A;  2HD5 A;  3BWK A;  3KSE A;  2GFO A;  4Q8G A;  2PRE A;  1ME3 A;  1F29 A;  3S3R A;  2AYO A;  3IV2 A;  2XU5 A;  1NB5 A;  2XU4 A;  3KWB X;  4PP2 E;  3RVW A;  2DZY A;  3GCB A;  4QRX A;  1AYW A;  1YAL A;  1DF0 A;  8PCH A;  2XU3 A;  4K7C A;  2YJB A;  4QBB A;  2R9F A;  3BPM A;  2FQ9 A;  1GMY A;  1U9Q X;  1ICF A;  5EGW A;  4QH6 A;  4YYR A;  2DCA A;  3CH2 X;  3IOQ A;  3AI8 A;  3WXG A;  4YYS A;  3U8E A;  1GCB A;  2Y6E A;  2FTD A;  1F2C A;  4MZO A;  3USV A;  1AU4 A;  2R6N A;  4DMY A;  3P5W A;  4BS5 A;  5K16 A;  2G7Y A;  1HUC B;  1IWD A;  2DC6 A;  2VHS A;  2BDL A;  4YYU A;  1TL9 A;  1QOL A;  2JQG R;  3HD3 A;  2NQA A;  1EF7 A;  1PCI A;  1PBH A;  2OUL A;  1QMY A;  2DC7 A;  4N8W A;  2BDZ A;  3ZUA A;  1Y4H A;  4BS6 A;  2PNS A;  2WBF X;  3PNR A;  1O0E A;  1XKG A;  3KX1 A;  1PIP A;  5A24 A;  4BQV A;  3BOW A;  9PAP A;  1AEC A;  3KFQ A;  1U9W A;  4G54 A;  1KXR A;  1NB3 A;  1QXP A;  2G8E A;  4WA6 A;  4I04 A;  4CDC B;  1A6R A;  2FRQ A;  4RY2 A;  3PDF A;  2IBI A;  7PCK A; 
#chains in the Genus database with same CATH topology
 4PP1 A;  5CVM A;  3H8B A;  4QRV A;  4BOU A;  3V6C A;  3P5V A;  3ERV A;  2DC8 A;  3LXS A;  3KKU A;  3IHP A;  4MM3 B;  1YVB A;  2AUX A;  2DOS A;  3E9S A;  1CPJ A;  2BTW A;  1NQC A;  3HHA A;  3O0U A;  2DJG B;  3QT4 A;  1AU3 A;  3K9M A;  5FPW A;  2B1M A;  4RF1 A;  2PAD A;  1U9X A;  4XR7 A;  4M0W A;  4BOQ A;  3BPF A;  4W5B A;  4AXM A;  1U5I A;  4BOP A;  4REZ A;  1PPN A;  1CTE A;  4OEM A;  3P5X A;  2F1G A;  2DZZ A;  3BC3 A;  3MHH A;  3WXE A;  4X6I A;  5EZQ A;  1CS8 A;  2JRI A;  5JA7 A;  1GLO A;  1PPO A;  2GHU A;  2FRA A;  1MHW A;  1VJV A;  4CDE B;  1FH0 A;  3I06 A;  3PT2 A;  3H89 A;  4BOZ A;  1S4V A;  2YJ9 A;  3RNV A;  2R9N A;  5KO3 A;  2FO5 A;  1CV8 A;  4HXD B;  4X6J A;  3F75 A;  4RF0 A;  4X6H A;  2HWK A;  1EWO A;  3MP2 A;  3F5V A;  1CB5 A;  3DF0 A;  1AYV A;  1PAD A;  3MHS A;  2FE8 A;  3OF9 A;  1PXV A;  3BBA A;  2DJF B;  2CIO A;  3H7D A;  1CQD A;  4HWY A;  4YVA A;  3KWZ A;  2P86 A;  2BTW B;  4PI3 A;  4W4U A;  2AUZ A;  1PPD A;  4CDD B;  1ZCM A;  5CHT A;  4MSX A;  2XU1 A;  3OIS A;  3PHX A;  1SP4 B;  3KW9 A;  3E1Z B;  2AU1 A;  3CH3 X;  5CHV A;  1CJL A;  2E00 A;  3MTV A;  1PE6 A;  2FT2 A;  4FIP A;  1AU2 A;  1DEU A;  3PRP A;  2FUD A;  3N3G A;  3C0R A;  2O6X A;  3TMP A;  3B79 A;  1GEC E;  1SNK A;  4KLB A;  2JTC A;  3PBH A;  1MEG A;  3BB7 A;  1POP A;  1STF E;  2IPP B;  1MDW A;  1Q6K A;  1ATK A;  4N4Z A;  1F2B A;  5EF4 A;  3M99 A;  5PAD A;  1BY8 A;  4P16 A;  2VHF A;  3BY4 A;  3D6S A;  3IUT A;  4D8E A;  2HXZ A;  4A5U A;  3O65 A;  2ARY A;  1YZB A;  2DC9 A;  1ZIV A;  4OVZ A;  4YV8 A;  1Y08 A;  1KHQ A;  3MTN A;  1ME4 A;  2NQG A;  3HWN A;  1U9V A;  3IMA A;  4XZX A;  2E02 A;  2R9O A;  2YJ2 A;  1KFX L;  3BCN A;  2Y5B A;  3I3T A;  4P6G A;  2FYE A;  5CVO B;  1DKI A;  2HHN A;  2ATO A;  4FK5 A;  1VSN A;  4W5C A;  4YYQ A;  1TLO A;  4I05 A;  4RNA A;  1YT7 A;  2AGA A;  2AIM A;  3NHE A;  1YK7 A;  1TU6 A;  4WUR A;  3B21 A;  3V6E A;  1BQI A;  1AYU A;  2YJC A;  2B1N A;  3IEJ A;  2OP3 A;  1F2A A;  4PAD A;  3RVX A;  1MIR A;  2AS8 A;  3OF8 A;  3N3K A;  2AVW A;  5J94 A;  2DCB A;  1CSB B;  2DCD A;  4AXL A;  4IP3 A;  4BSQ A;  1X9Y A;  4YYV A;  2HH5 A;  1EWP A;  2BU3 A;  1PPP A;  2UZJ A;  1NL6 A;  4FJC A;  2E01 A;  2R9M A;  2NQD B;  2DCC A;  3H6S A;  1NPZ A;  3N4C A;  1EWM A;  1MEM A;  1BGO A;  1AIM A;  1BP4 A;  5EZS A;  1CVZ A;  2P0R A;  3O1G A;  1AU0 A;  4P6E A;  4ZTB A;  1ITO A;  1UKF A;  2R9C A;  5JH3 A;  3MOR A;  1QDQ A;  3TRK A;  4OVZ B;  1M6D A;  3P5U A;  1EWL A;  3OQC A;  3HHI A;  4BOS A;  1KFU L;  3H8C A;  3LFY A;  4N79 A;  2C0Y A;  3OVX A;  2CB5 A;  5CVN B;  3QJ3 A;  4CZW A;  1JQP A;  2YJ8 A;  2AYN A;  1MS6 A;  4QRG A;  2JQF R;  1NLJ A;  2J7Q C;  4Q8H A;  6PAD A;  4ZUX U;  3K8U A;  4D8I A;  4I07 A;  4OEL A;  3CBJ A;  4XUI A;  2E03 A;  3C9E A;  3IFU A;  2H7J A;  1K3B B;  2OZ2 A;  5F02 A;  1THE A;  3PSE A;  3TNX A;  3S3Q A;  4CDF B;  3QSD A;  3RVV A;  2Z84 A;  3K24 A;  4DMX A;  4OW0 A;  4BPV A;  2G8J A;  2NQI A;  3W31 A;  2PBH A;  3CBK A;  2G6D A;  3WXF A;  1YK8 A;  4YYW A;  2P7U A;  4MZS A;  3PW3 A;  2ACT A;  1KHP A;  2F7D A;  3PHW A;  3OVZ A;  2HD5 A;  3BWK A;  3KSE A;  2GFO A;  4Q8G A;  2PRE A;  3PHU A;  4R3D A;  1ME3 A;  1F29 A;  2J7Q A;  3S3R A;  2AYO A;  3IV2 A;  2XU5 A;  1NB5 A;  2XU4 A;  3KWB X;  4PP2 E;  3RVW A;  2DZY A;  3GCB A;  4QRX A;  1AYW A;  1YAL A;  3W30 A;  1DF0 A;  5E6J A;  8PCH A;  5JZE A;  2XU3 A;  4K7C A;  2YJB A;  4QBB A;  3ZNH A;  2R9F A;  4RKX A;  3BPM A;  2FQ9 A;  1GMY A;  1U9Q X;  1ICF A;  5EGW A;  4QH6 A;  4YYR A;  2DCA A;  3CH2 X;  3IOQ A;  3AI8 A;  3WXG A;  4YYS A;  3U8E A;  1GCB A;  2Y6E A;  2FTD A;  1F2C A;  4MZO A;  3USV A;  1AU4 A;  2R6N A;  4DMY A;  3P5W A;  4IUM A;  4BS5 A;  5K16 A;  2G7Y A;  1HUC B;  1IWD A;  2DC6 A;  2VHS A;  2BDL A;  4YYU A;  1TL9 A;  1QOL A;  2JQG R;  3HD3 A;  2NQA A;  1EF7 A;  3MJ5 A;  1PCI A;  1PBH A;  2OUL A;  1QMY A;  2DC7 A;  3PRM A;  4N8W A;  4PT5 A;  2BDZ A;  3ZUA A;  1Y4H A;  4BS6 A;  2PNS A;  2WBF X;  3PNR A;  1O0E A;  1XKG A;  4GUA A;  4D8B A;  3KX1 A;  1PIP A;  5A24 A;  4BQV A;  3BOW A;  9PAP A;  1AEC A;  3KFQ A;  1U9W A;  4G54 A;  1PVJ A;  1KXR A;  1NB3 A;  1QXP A;  2G8E A;  4WA6 A;  4I04 A;  4CDC B;  4MI7 A;  1A6R A;  2FRQ A;  4RY2 A;  3PDF A;  2IBI A;  7PCK A; 
#chains in the Genus database with same CATH homology
 4PP1 A;  5CVM A;  3H8B A;  4QRV A;  3V6C A;  3P5V A;  3ERV A;  2DC8 A;  3LXS A;  3KKU A;  3IHP A;  1YVB A;  2AUX A;  1CPJ A;  1NQC A;  4BGF A;  3HHA A;  3O0U A;  2DJG B;  3QT4 A;  1AU3 A;  3K9M A;  5FPW A;  2B1M A;  2PAD A;  1U9X A;  4XR7 A;  2VFC A;  3BPF A;  4W5B A;  4AXM A;  1U5I A;  1PPN A;  1CTE A;  4OEM A;  3P5X A;  2F1G A;  2DZZ A;  3BC3 A;  3MHH A;  3WXE A;  4X6I A;  1CS8 A;  5JA7 A;  1GLO A;  1PPO A;  2GHU A;  2FRA A;  1MHW A;  1VJV A;  4CDE B;  1FH0 A;  3I06 A;  3H89 A;  1S4V A;  2YJ9 A;  2R9N A;  2FO5 A;  1CV8 A;  4X6J A;  3F75 A;  4X6H A;  1EWO A;  3F5V A;  1CB5 A;  3DF0 A;  1AYV A;  1PAD A;  3MHS A;  3OF9 A;  1PXV A;  4C5P A;  2DJF B;  1W4T A;  2CIO A;  3H7D A;  1CQD A;  4HWY A;  4YVA A;  2BSZ A;  3KWZ A;  2P86 A;  4PI3 A;  4W4U A;  2AUZ A;  1PPD A;  4CDD B;  1ZCM A;  5CHT A;  4MSX A;  2XU1 A;  3OIS A;  1SP4 B;  3KW9 A;  3E1Z B;  2AU1 A;  3CH3 X;  5CHV A;  1CJL A;  2E00 A;  1PE6 A;  2FT2 A;  4FIP A;  1AU2 A;  1DEU A;  2FUD A;  3N3G A;  2O6X A;  3B79 A;  1GEC E;  1SNK A;  4GUZ A;  4KLB A;  3PBH A;  1MEG A;  1POP A;  1STF E;  2IPP B;  1MDW A;  1Q6K A;  1ATK A;  4N4Z A;  1F2B A;  5EF4 A;  3M99 A;  5PAD A;  1BY8 A;  2VHF A;  3D6S A;  3IUT A;  2HXZ A;  2ARY A;  2DC9 A;  3LTW A;  1ZIV A;  4YV8 A;  1Y08 A;  1KHQ A;  3MTN A;  1ME4 A;  2NQG A;  3HWN A;  1U9V A;  3IMA A;  2E02 A;  2R9O A;  2YJ2 A;  1KFX L;  3BCN A;  2Y5B A;  3I3T A;  4P6G A;  2FYE A;  5CVO B;  1E2T A;  2HHN A;  2ATO A;  4FK5 A;  1VSN A;  4W5C A;  4YYQ A;  1TLO A;  4I05 A;  1YT7 A;  2AIM A;  3NHE A;  1YK7 A;  1TU6 A;  3V6E A;  1BQI A;  1AYU A;  2YJC A;  3D9W A;  2B1N A;  3IEJ A;  2OP3 A;  1F2A A;  4PAD A;  3RVX A;  1MIR A;  2AS8 A;  3OF8 A;  3N3K A;  2AVW A;  5J94 A;  2DCB A;  1CSB B;  2DCD A;  1W5R A;  4AXL A;  4BSQ A;  1X9Y A;  4YYV A;  2HH5 A;  1EWP A;  1PPP A;  1NL6 A;  1GX3 A;  2E01 A;  4FJC A;  2R9M A;  2NQD B;  2DCC A;  3H6S A;  1NPZ A;  3N4C A;  1EWM A;  1MEM A;  1BGO A;  1AIM A;  4NV7 A;  1BP4 A;  1CVZ A;  2P0R A;  3O1G A;  1AU0 A;  4P6E A;  1ITO A;  2R9C A;  5JH3 A;  3MOR A;  1QDQ A;  1M6D A;  3P5U A;  1EWL A;  3HHI A;  1KFU L;  3H8C A;  3LFY A;  4N79 A;  2C0Y A;  3OVX A;  2CB5 A;  5CVN B;  3QJ3 A;  4NV8 A;  4CZW A;  1JQP A;  2YJ8 A;  2AYN A;  1MS6 A;  4QRG A;  2JQF R;  1NLJ A;  4Q8H A;  6PAD A;  4ZUX U;  3K8U A;  4I07 A;  4OEL A;  3CBJ A;  4XUI A;  2E03 A;  3C9E A;  2H7J A;  1K3B B;  2OZ2 A;  5F02 A;  1THE A;  3TNX A;  3S3Q A;  4CDF B;  3QSD A;  3RVV A;  4DMX A;  3K24 A;  4BPV A;  2G8J A;  2NQI A;  2PBH A;  3CBK A;  2G6D A;  3WXF A;  1YK8 A;  4YYW A;  2P7U A;  4MZS A;  3PW3 A;  2ACT A;  1KHP A;  2F7D A;  3OVZ A;  2HD5 A;  3BWK A;  3KSE A;  2GFO A;  4Q8G A;  2PRE A;  1ME3 A;  1F29 A;  3S3R A;  2AYO A;  3IV2 A;  2XU5 A;  1NB5 A;  2XU4 A;  2VFB A;  3KWB X;  4PP2 E;  3RVW A;  2DZY A;  3GCB A;  4QRX A;  1AYW A;  1YAL A;  1DF0 A;  8PCH A;  2XU3 A;  4K7C A;  2YJB A;  4QBB A;  2R9F A;  3BPM A;  2FQ9 A;  1GMY A;  1U9Q X;  1ICF A;  5EGW A;  4QH6 A;  4YYR A;  2DCA A;  3CH2 X;  3IOQ A;  3AI8 A;  3WXG A;  4YYS A;  3U8E A;  1GCB A;  2Y6E A;  2FTD A;  1F2C A;  4MZO A;  3USV A;  1AU4 A;  2R6N A;  4DMY A;  3P5W A;  4BS5 A;  5K16 A;  2G7Y A;  1HUC B;  1IWD A;  2DC6 A;  2VHS A;  2BDL A;  4YYU A;  1TL9 A;  1W6F A;  1QOL A;  2JQG R;  3HD3 A;  2NQA A;  1EF7 A;  1PCI A;  1PBH A;  2OUL A;  1QMY A;  2DC7 A;  4N8W A;  2BDZ A;  3ZUA A;  1Y4H A;  4BS6 A;  2PNS A;  4B55 A;  2WBF X;  3PNR A;  1O0E A;  1XKG A;  3KX1 A;  1PIP A;  5A24 A;  4BQV A;  3BOW A;  9PAP A;  1AEC A;  3KFQ A;  1U9W A;  4G54 A;  1KXR A;  1NB3 A;  1QXP A;  2G8E A;  4WA6 A;  4I04 A;  4CDC B;  1A6R A;  2FRQ A;  4RY2 A;  3PDF A;  2IBI A;  7PCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...